BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 043289
(695 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1MSZ|A Chain A, Solution Structure Of The R3h Domain From Human Smubp-2
pdb|2LRR|A Chain A, Solution Structure Of The R3h Domain From Human Smubp-2 In
Complex With 2'-Deoxyguanosine-5'-Monophosphate
Length = 86
Score = 32.7 bits (73), Expect = 0.78, Method: Compositional matrix adjust.
Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
Query: 454 FQP-MHHRDCSQVRRLAAIYRLRSDSQGSGKKRFVTVTR 491
F P ++ D +V ++A + LR DS G GK+RF+TV++
Sbjct: 38 FPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSK 76
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.129 0.361
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,393,109
Number of Sequences: 62578
Number of extensions: 647777
Number of successful extensions: 1157
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1156
Number of HSP's gapped (non-prelim): 1
length of query: 695
length of database: 14,973,337
effective HSP length: 106
effective length of query: 589
effective length of database: 8,340,069
effective search space: 4912300641
effective search space used: 4912300641
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 55 (25.8 bits)