Citrus Sinensis ID: 043296

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650

MAAKTEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFSDPSVQSDMRHWPFKVASGPGDKPMIAVTYKGEEKRFSPEEISSMVLTKMKEIAEAYLGHAVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAAIAYGLDKKASRTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVAEFRRKHKKDISGNARALRRLRTACERAKRTLSSTTQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSLVHDIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTTLIPRNTTVPAKKEQVFSTYADNQTSVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEDIERMVQEAEKYKAEDEQVKKKVEAKNKLENYAYSMRNTVKDDKVAGKLAAADKQKIEKAVDETVEWLDGNQLAEVDEFEDKLKELEGLCNPIIAKMYQGDGGDVPMGGGYGSSGSGGSGAGAGPKIEEVD

ccccccccEEEEEccccccEEEEEEccEEEEEcccccccccccCEEEccccccccHHHHHHccccccccccccccccccccccHHHHcccccccCEEEEccccccEEEEEEccEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccccccEEEEEEEccccccEEEEEEEEccEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccccccccccccccccEEEEEcccccccEEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc

******G*AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFSDPSVQSDMRHWPFKVASGPGDKPMIAVTYKGEEKRFSPEEISSMVLTKMKEIAEAYLGHAVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAAIAYGLDKKASRTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVAEFRRKHKKDISGNARALRRLRTACERAKRTLSSTTQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSLVHDIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTTLIPRNTTVPAKKEQVFSTYADNQTSVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEDIERMVQEAEKYKA**********AKNKLENYAYSMRNTVK**************KIEKAVDETVEWLDGNQLAEVDEFEDKLKELEGLCNPIIAKMYQG*******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAKTEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFSDPSVQSDMRHWPFKVASGPGDKPMIAVTYKGEEKRFSPEEISSMVLTKMKEIAEAYLGHAVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAAIAYGLDKKASRTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVAEFRRKHKKDISGNARALRRLRTACERAKRTLSSTTQTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSLVHDIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTTLIPRNTTVPAKKEQVFSTYADNQTSVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQINVCFDIDANGILHVSAEDKTAGVKNQITITNDKGRLSKEDxxxxxxxxxxxxxxxxxxxxxxxxxNKLENYAYSMRNTVKDDKVAGKLAAADKQKIEKAVDETVEWLDGNQLAEVDEFEDKLKELEGLCNPIIAKMYQGDGGDVPMGGGYGSSGSGGSGAGAGPKIEEVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Heat shock 70 kDa protein cognate 1		confident	P29843
Heat shock cognate 71 kDa protein	Acts as a repressor of transcriptional activation. Inhibits the transcriptional coactivator activity of CITED1 on Smad-mediated transcription. Chaperone.	confident	Q5NVM9
Heat shock 70 kDa protein 5	In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.	confident	Q9S9N1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 6-559
View the alignment between query and template
View the model in PyMOL

Template: 2KHO, chain A
Confidence level:very confident
Coverage over the Query: 9-617
View the alignment between query and template
View the model in PyMOL

Template: 3LOF, chain A
Confidence level:very confident
Coverage over the Query: 537-617
View the alignment between query and template
View the model in PyMOL