Citrus Sinensis ID: 043322


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MIIQKDEATNEKLGDITIGDNNNEEIGDDNPGEWLNLKLGGNSLSTSRDPDSPARPTTAKVFSCNFCMRKFFSSQALGGHQNAHKRERGAAKRYQSQRMMTMMGLPVHTNMVRSLGVRAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVNLQLPEPPPEPLKLDLNLRL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccc
cccccccccccccccHcccccccccccccccccccEEEccccccccccccccccccccccEEEEccccccccccHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccc
miiqkdeatneklgditigdnnneeigddnpgewlnlklggnslstsrdpdsparpttakvfscnfcmrkffssqalgghqnahkRERGAAKRYQSQRMMTMMGLPVHTNMVRSLGVrahslvhkpsrdgagvgarfndadtgfgmawtpyvleeatdvmwpgsfrvnlqlpepppeplkldlnlrl
miiqkdeatneklgditigdnnneeigddNPGEWLNLKLGGNSlstsrdpdsparPTTAKVFSCNFCMRKFFSsqalgghqnahkrerGAAKRYQSQRMMTMMGLPVHTNMVRSLGVRAHSLvhkpsrdgagvgARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVNlqlpepppeplkldlnlrl
MIIQKDEATNEKLGDITigdnnneeigddnpgeWLNLKLGGNSLSTSRDPDSPARPTTAKVFSCNFCMRKFFSSQALGGHQNAHKRERGAAKRYQSQRMMTMMGLPVHTNMVRSLGVRAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVnlqlpepppeplkldlnlRL
**********************************************************AKVFSCNFCMRKFFSS*****************************GLPVHTNMVRSLGVRAHSLVH*****GAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVNL******************
*************************************************************FSCNFCMRKFFSSQALGG**************************PVHTNMV********************************************************************LDLNLRL
MIIQKDEATNEKLGDITIGDNNNEEIGDDNPGEWLNLKLGGNS**************TAKVFSCNFCMRKFFSSQ*******************QSQRMMTMMGLPVHTNMVRSLGVRAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVNLQLPEPPPEPLKLDLNLRL
**********************************************************AKVFSCNFCMRKFFSSQALGGHQNAHKRERGAAKRYQSQRMMTMMGLPVHTNMVRSLGVRAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSF****************D*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIIQKDEATNEKLGDITIGDNNNEEIGDDNPGEWLNLKLGGNSLSTSRDPDSPARPTTAKVFSCNFCMRKFFSSQALGGHQNAHKRERGAAKRYQSQRMMTMMGLPVHTNMVRSLGVRAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVNLQLPEPPPEPLKLDLNLRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
Q39266209 Zinc finger protein 7 OS= yes no 0.721 0.645 0.404 7e-17
Q39263260 Zinc finger protein 4 OS= no no 0.566 0.407 0.405 8e-17
Q42485228 Zinc finger protein 1 OS= no no 0.363 0.298 0.488 3e-16
Q39262235 Zinc finger protein 3 OS= no no 0.368 0.293 0.542 4e-15
Q9FFX4161 Zinc finger protein KNUCK no no 0.213 0.248 0.65 9e-11
Q39261150 Zinc finger protein 2 OS= no no 0.181 0.226 0.764 1e-09
Q39265197 Zinc finger protein 6 OS= no no 0.406 0.385 0.413 8e-09
Q9LHS9226 Probable transcriptional no no 0.433 0.358 0.329 3e-05
Q6S591253 Zinc finger protein JAGGE no no 0.229 0.169 0.441 8e-05
Q38895204 Transcriptional regulator no no 0.192 0.176 0.472 0.0002
>sp|Q39266|ZFP7_ARATH Zinc finger protein 7 OS=Arabidopsis thaliana GN=ZFP7 PE=2 SV=1 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 77/146 (52%), Gaps = 11/146 (7%)

Query: 35  LNLKLGGNSLSTSRDPDSPARPTTAKVFSCNFCMRKFFSSQALGGHQNAHKRERGAAKRY 94
           L+LKL       ++     A P   +VFSCN+C RKF+SSQALGGHQNAHKRER  AKR 
Sbjct: 35  LDLKLNDTFNDDTKSTKCEANP---RVFSCNYCRRKFYSSQALGGHQNAHKRERTMAKRA 91

Query: 95  QSQ-RMMTMMGLPVHTNMVRSLGVRAHS-LVHKPSRDGAGVGARFNDADTGFGMAWTPYV 152
               RM      P +T    SLG++AHS L+H        + +RF+    G+     P  
Sbjct: 92  MHMGRMFGHHHRP-YTYTSSSLGMQAHSGLLHHTLSQPQPLVSRFH--HQGYFGNTVPLF 148

Query: 153 LEE---ATDVMWPGSFRVNLQLPEPP 175
            +     +D  WPGSFR  ++  E P
Sbjct: 149 FDYDDGGSDFFWPGSFRQVVEEAEAP 174





Arabidopsis thaliana (taxid: 3702)
>sp|Q39263|ZFP4_ARATH Zinc finger protein 4 OS=Arabidopsis thaliana GN=ZFP4 PE=2 SV=2 Back     alignment and function description
>sp|Q42485|ZFP1_ARATH Zinc finger protein 1 OS=Arabidopsis thaliana GN=ZFP1 PE=2 SV=1 Back     alignment and function description
>sp|Q39262|ZFP3_ARATH Zinc finger protein 3 OS=Arabidopsis thaliana GN=ZFP3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFX4|KNU_ARATH Zinc finger protein KNUCKLES OS=Arabidopsis thaliana GN=KNU PE=1 SV=1 Back     alignment and function description
>sp|Q39261|ZFP2_ARATH Zinc finger protein 2 OS=Arabidopsis thaliana GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q39265|ZFP6_ARATH Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHS9|RBE_ARATH Probable transcriptional regulator RABBIT EARS OS=Arabidopsis thaliana GN=RBE PE=2 SV=2 Back     alignment and function description
>sp|Q6S591|JAG_ARATH Zinc finger protein JAGGED OS=Arabidopsis thaliana GN=JAG PE=2 SV=1 Back     alignment and function description
>sp|Q38895|SUP_ARATH Transcriptional regulator SUPERMAN OS=Arabidopsis thaliana GN=SUP PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
224103697190 predicted protein [Populus trichocarpa] 1.0 0.984 0.642 1e-66
224056210246 predicted protein [Populus trichocarpa] 1.0 0.760 0.631 4e-65
225429309189 PREDICTED: zinc finger protein 7-like [V 0.967 0.957 0.653 1e-64
302398659187 C2H2L domain class transcription factor 0.930 0.930 0.612 1e-55
255573085204 zinc finger protein, putative [Ricinus c 1.0 0.916 0.602 4e-55
351726684188 uncharacterized protein LOC100306296 [Gl 0.978 0.973 0.578 6e-55
147790933248 hypothetical protein VITISV_001090 [Viti 0.989 0.745 0.562 7e-54
225438896193 PREDICTED: zinc finger protein 7-like [V 0.989 0.958 0.562 1e-53
356575696191 PREDICTED: zinc finger protein 4-like [G 0.967 0.947 0.598 1e-52
388519679197 unknown [Lotus japonicus] 0.978 0.928 0.567 1e-51
>gi|224103697|ref|XP_002313159.1| predicted protein [Populus trichocarpa] gi|222849567|gb|EEE87114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 150/190 (78%), Gaps = 3/190 (1%)

Query: 1   MIIQKDE---ATNEKLGDITIGDNNNEEIGDDNPGEWLNLKLGGNSLSTSRDPDSPARPT 57
           MI Q++     T++   +I    N+NE   D+NPGEWLNL+LGGNS ST+ D DS +RPT
Sbjct: 1   MIFQEEAIEIKTSKHQNEIVGNHNSNEGYNDNNPGEWLNLRLGGNSPSTAGDYDSQSRPT 60

Query: 58  TAKVFSCNFCMRKFFSSQALGGHQNAHKRERGAAKRYQSQRMMTMMGLPVHTNMVRSLGV 117
           ++KVFSCNFC RKFFSSQALGGHQNAHKRERGAA+RY SQRMMTMMGLP+++ M RSLGV
Sbjct: 61  SSKVFSCNFCRRKFFSSQALGGHQNAHKRERGAARRYHSQRMMTMMGLPINSPMARSLGV 120

Query: 118 RAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEATDVMWPGSFRVNLQLPEPPPE 177
           R H+LVHKP+RDG  +G RFN+A+ GF M+W P+ L++  D+ WPGSFR++ QLPE   E
Sbjct: 121 RPHALVHKPTRDGTPIGGRFNEANPGFVMSWMPFALDDTADLTWPGSFRLDSQLPETSSE 180

Query: 178 PLKLDLNLRL 187
            LKLDLNLRL
Sbjct: 181 SLKLDLNLRL 190




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224056210|ref|XP_002298757.1| predicted protein [Populus trichocarpa] gi|222846015|gb|EEE83562.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225429309|ref|XP_002270534.1| PREDICTED: zinc finger protein 7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302398659|gb|ADL36624.1| C2H2L domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|255573085|ref|XP_002527472.1| zinc finger protein, putative [Ricinus communis] gi|223533112|gb|EEF34870.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351726684|ref|NP_001236623.1| uncharacterized protein LOC100306296 [Glycine max] gi|255628135|gb|ACU14412.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147790933|emb|CAN77233.1| hypothetical protein VITISV_001090 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438896|ref|XP_002279158.1| PREDICTED: zinc finger protein 7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356575696|ref|XP_003555974.1| PREDICTED: zinc finger protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|388519679|gb|AFK47901.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
TAIR|locus:2013820260 ZFP4 "AT1G66140" [Arabidopsis 0.315 0.226 0.583 9.7e-22
TAIR|locus:2825107209 ZFP7 "AT1G24625" [Arabidopsis 0.673 0.602 0.423 2.5e-17
TAIR|locus:2183780272 AT5G10970 "AT5G10970" [Arabido 0.379 0.261 0.531 9.8e-16
TAIR|locus:2146960235 ZFP3 "AT5G25160" [Arabidopsis 0.395 0.314 0.539 5.4e-15
TAIR|locus:2025777228 ZFP1 "AT1G80730" [Arabidopsis 0.342 0.280 0.569 1e-13
TAIR|locus:2159088161 KNU "AT5G14010" [Arabidopsis t 0.224 0.260 0.642 2.8e-11
TAIR|locus:2174547150 ZFP2 "AT5G57520" [Arabidopsis 0.315 0.393 0.539 3.5e-11
TAIR|locus:2019723197 ZFP6 "AT1G67030" [Arabidopsis 0.385 0.365 0.445 1.5e-10
TAIR|locus:2156529173 LATE "LATE FLOWERING" [Arabido 0.288 0.312 0.509 3.2e-10
TAIR|locus:2181007215 AT5G01860 "AT5G01860" [Arabido 0.187 0.162 0.685 2.2e-09
TAIR|locus:2013820 ZFP4 "AT1G66140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 176 (67.0 bits), Expect = 9.7e-22, Sum P(2) = 9.7e-22
 Identities = 35/60 (58%), Positives = 43/60 (71%)

Query:    35 LNLKLGGNSLSTSRDPDSPARPTTAK-VFSCNFCMRKFFSSQALGGHQNAHKRERGAAKR 93
             L L L   S S++ +     +P+ +K VFSCN+C RKF+SSQALGGHQNAHKRER  AKR
Sbjct:    57 LTLPLSSTSESSNPEQQQQQQPSVSKRVFSCNYCQRKFYSSQALGGHQNAHKRERTLAKR 116


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2825107 ZFP7 "AT1G24625" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183780 AT5G10970 "AT5G10970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146960 ZFP3 "AT5G25160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025777 ZFP1 "AT1G80730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159088 KNU "AT5G14010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174547 ZFP2 "AT5G57520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019723 ZFP6 "AT1G67030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156529 LATE "LATE FLOWERING" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181007 AT5G01860 "AT5G01860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_IX000697
hypothetical protein (190 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.39
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.3
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 98.66
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.46
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.39
KOG3576267 consensus Ovo and related transcription factors [T 98.33
KOG3576267 consensus Ovo and related transcription factors [T 98.25
PHA0061644 hypothetical protein 98.2
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.09
PHA0276855 hypothetical protein; Provisional 97.94
KOG1074958 consensus Transcriptional repressor SALM [Transcri 97.94
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.75
PHA00733128 hypothetical protein 97.57
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.42
KOG3608 467 consensus Zn finger proteins [General function pre 97.39
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.28
KOG3608467 consensus Zn finger proteins [General function pre 97.04
PHA0276855 hypothetical protein; Provisional 96.96
smart0035526 ZnF_C2H2 zinc finger. 96.87
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.49
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 96.42
PHA00733128 hypothetical protein 96.32
PHA0073279 hypothetical protein 95.7
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.64
KOG3993500 consensus Transcription factor (contains Zn finger 95.17
PLN03086567 PRLI-interacting factor K; Provisional 94.95
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.56
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.43
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.91
PHA0073279 hypothetical protein 93.01
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.01
COG5189423 SFP1 Putative transcriptional repressor regulating 90.32
PHA0061644 hypothetical protein 90.18
COG5189423 SFP1 Putative transcriptional repressor regulating 89.62
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 89.24
PLN03086567 PRLI-interacting factor K; Provisional 86.8
PRK04860160 hypothetical protein; Provisional 86.55
KOG3993500 consensus Transcription factor (contains Zn finger 86.35
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 84.45
COG5048467 FOG: Zn-finger [General function prediction only] 84.1
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 81.92
COG404965 Uncharacterized protein containing archaeal-type C 81.74
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.39  E-value=1.8e-13  Score=113.14  Aligned_cols=86  Identities=26%  Similarity=0.389  Sum_probs=59.6

Q ss_pred             CCCCCCCCCCCCCC-CCCC---CCCccccCcccccccCchhHHHHHhhhcC-------CCCCcccccc-hhhHhhcCC-C
Q 043322           40 GGNSLSTSRDPDSP-ARPT---TAKVFSCNFCMRKFFSSQALGGHQNAHKR-------ERGAAKRYQS-QRMMTMMGL-P  106 (187)
Q Consensus        40 ~~~sF~~~~~L~~h-~~Ht---gekpf~C~~Cgk~F~~~~~L~~H~~~H~g-------ekp~~f~~~s-~l~r~Htge-p  106 (187)
                      .|+.+++.++|.+| ++|-   ..+.+.|.+|+|.|.+..+|..|+++|+-       .|.|...|.. -|+|+|||| |
T Consensus       136 Cgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP  215 (279)
T KOG2462|consen  136 CGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKP  215 (279)
T ss_pred             cccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCC
Confidence            55677788888777 4553   35678888888888888888888888872       1222222222 237888888 7


Q ss_pred             C-----CCCCCCchhhHhhhccCC
Q 043322          107 V-----HTNMVRSLGVRAHSLVHK  125 (187)
Q Consensus       107 ~-----gk~F~~~s~L~~H~riH~  125 (187)
                      |     +|+|..+++|+.||.+|.
T Consensus       216 F~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  216 FSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             ccCCcccchhcchHHHHHHHHhhc
Confidence            7     788888888888888873



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 5e-18
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 72.5 bits (178), Expect = 5e-18
 Identities = 16/33 (48%), Positives = 25/33 (75%)

Query: 60 KVFSCNFCMRKFFSSQALGGHQNAHKRERGAAK 92
          + ++C+FC R+F S+QALGGH N H+R+R   +
Sbjct: 5  RSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 37


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.59
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.53
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.46
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.43
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.4
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.32
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.28
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.27
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.26
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.24
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.23
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.22
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.21
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.17
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.15
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.13
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.12
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.1
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.03
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.03
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.03
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.01
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.01
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.01
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.0
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.98
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.97
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.96
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.96
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.96
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.95
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.95
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.94
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.94
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.94
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.94
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.93
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.93
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.9
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.9
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.86
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.86
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.86
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.83
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.81
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.81
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.79
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.79
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.79
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.79
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.78
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.78
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.77
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.77
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.73
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.7
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.7
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.7
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.7
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.68
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.67
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.67
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.67
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.66
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.65
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.64
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.63
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.61
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.61
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.59
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.58
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.57
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.56
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.55
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.54
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.53
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.52
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.5
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.49
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.48
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.48
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.47
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.46
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.82
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.44
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.8
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.42
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.42
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.4
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.4
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.38
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.37
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.37
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.35
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.35
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.33
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.32
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.31
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.3
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.22
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.51
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.19
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.08
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.01
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.93
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.92
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.91
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.9
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.87
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.86
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 97.85
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.85
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.84
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.84
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.83
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.83
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.82
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.82
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.81
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.8
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.8
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.79
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.79
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 97.79
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.79
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.79
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.78
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.78
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.78
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.76
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.76
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.74
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.74
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.73
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 97.71
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.7
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.7
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.7
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 97.7
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.69
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.69
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 97.67
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.66
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.66
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.65
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.64
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.64
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.64
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.63
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.62
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.62
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.62
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.61
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 97.61
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.61
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 97.61
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.6
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.6
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.6
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.6
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.58
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.58
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 97.58
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.58
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.57
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.57
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.57
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.56
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.56
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 97.55
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.55
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 97.54
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.53
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 97.53
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.51
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.51
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.5
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.49
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.49
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.49
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.48
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.48
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.48
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.48
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.48
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.48
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 97.47
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.47
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.44
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.43
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.43
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.43
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 97.4
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.39
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.37
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 97.35
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 97.35
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.33
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.27
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 97.25
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.24
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.16
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 97.11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 97.06
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 96.95
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 96.95
1vd4_A62 Transcription initiation factor IIE, alpha subunit 96.93
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.86
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.64
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 96.59
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.54
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 96.13
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 96.1
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.02
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.56
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.42
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 95.37
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.32
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.32
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 95.31
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.2
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.17
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 95.15
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.09
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 94.83
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.38
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 94.25
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.04
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 93.82
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 93.79
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 93.59
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 93.42
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 93.37
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 92.86
1ard_A29 Yeast transcription factor ADR1; transcription reg 92.52
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 92.45
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 92.05
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 91.28
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 91.99
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 91.56
1paa_A30 Yeast transcription factor ADR1; transcription reg 91.5
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 91.39
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.63
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 89.46
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 84.5
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.59  E-value=3.5e-16  Score=116.85  Aligned_cols=89  Identities=15%  Similarity=0.134  Sum_probs=74.4

Q ss_pred             CCCCCCCccccCcccccccCchhHHHHHhhhcCCCCC-------cccccchh---hHhhcCC-CC-----CCCCCCchhh
Q 043322           54 ARPTTAKVFSCNFCMRKFFSSQALGGHQNAHKRERGA-------AKRYQSQR---MMTMMGL-PV-----HTNMVRSLGV  117 (187)
Q Consensus        54 ~~Htgekpf~C~~Cgk~F~~~~~L~~H~~~H~gekp~-------~f~~~s~l---~r~Htge-p~-----gk~F~~~s~L  117 (187)
                      ++|.|+++|.|++|++.|.....|..|+++|++++||       .|.....|   +++|+++ ||     |+.|.+...|
T Consensus        15 ~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L   94 (133)
T 2lt7_A           15 LIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFM   94 (133)
T ss_dssp             EEETTEEEEEETTTCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESSHHHH
T ss_pred             eecCCCcCeECCCCCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhccccCCCccccCCCCCCCcCCHHHH
Confidence            6799999999999999999999999999999999999       45554444   8899998 88     9999999999


Q ss_pred             HhhhccCCCCCCCCCCccCCCCCCCCCCCCCCcccccccC
Q 043322          118 RAHSLVHKPSRDGAGVGARFNDADTGFGMAWTPYVLEEAT  157 (187)
Q Consensus       118 ~~H~riH~p~~~~~~~~~~f~~~~~~~~~~~~p~~~~~~~  157 (187)
                      ..|+++|++..+.               ...++|.|+.++
T Consensus        95 ~~H~~~hh~~~p~---------------~~~k~~~C~~C~  119 (133)
T 2lt7_A           95 SSHIKSVHSQDPS---------------GDSKLYRLHPCR  119 (133)
T ss_dssp             HHHHHHHTCCCTT---------------SSSCCEEECCCC
T ss_pred             HHHhHHhcCCCCC---------------CCCCCeecCCCC
Confidence            9999998655331               223678888843



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 2e-13
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 59.3 bits (144), Expect = 2e-13
 Identities = 16/33 (48%), Positives = 25/33 (75%)

Query: 60 KVFSCNFCMRKFFSSQALGGHQNAHKRERGAAK 92
          + ++C+FC R+F S+QALGGH N H+R+R   +
Sbjct: 4  RSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 36


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.35
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.34
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.33
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.24
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.19
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.16
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.13
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.12
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.11
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.08
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.02
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.84
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.81
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.8
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.6
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.52
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.27
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.18
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.88
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.83
d2cota238 Zinc finger and SCAN domain-containing protein 16, 97.82
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.8
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.8
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.75
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 97.69
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 97.69
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 97.55
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.44
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.43
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 97.38
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.34
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.33
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.16
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.15
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.14
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.05
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.05
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.93
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.89
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.84
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 96.77
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.68
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.67
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 96.48
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.38
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.13
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.11
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.02
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.0
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.74
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.42
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.34
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.27
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.24
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.24
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.37
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.92
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.52
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.59
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.74
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.54
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 91.33
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 91.33
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.02
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.88
d1y0jb136 U-shaped transcription factor, different fingers { 89.46
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.37
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.36
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.16
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.45
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 87.06
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.79
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 83.59
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.99
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 80.74
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 80.51
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.35  E-value=1.6e-13  Score=77.03  Aligned_cols=33  Identities=30%  Similarity=0.431  Sum_probs=31.9

Q ss_pred             CCCCCCccccCcccccccCchhHHHHHhhhcCC
Q 043322           55 RPTTAKVFSCNFCMRKFFSSQALGGHQNAHKRE   87 (187)
Q Consensus        55 ~Htgekpf~C~~Cgk~F~~~~~L~~H~~~H~ge   87 (187)
                      +|+|+|||+|.+|||+|...+.|..|+++|+||
T Consensus         1 IHTgekpy~C~~Cgk~F~~~~~L~~H~r~HtgE   33 (33)
T d1x6ea1           1 IHSGEKPYGCVECGKAFSRSSILVQHQRVHTGE   33 (33)
T ss_dssp             TTTTCCCEECSSSCCEESSHHHHHHHHHGGGCS
T ss_pred             CcCCCCCeeCCCCCCEeCchHHhHhhccccCCC
Confidence            699999999999999999999999999999986



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure