Query         043432
Match_columns 105
No_of_seqs    106 out of 350
Neff          6.7 
Searched_HMMs 46136
Date          Fri Mar 29 05:01:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043432.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043432hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02362 B3:  B3 DNA binding do  99.8 5.8E-20 1.2E-24  118.7  11.2   86   11-101     1-87  (100)
  2 PF03754 DUF313:  Domain of unk  99.1 4.9E-10 1.1E-14   75.6   6.9   78    6-84     19-113 (114)
  3 PF09217 EcoRII-N:  Restriction  98.6 2.7E-07 5.9E-12   64.9   7.2   88    9-97      8-110 (156)
  4 cd06919 Asp_decarbox Aspartate  93.9     1.2 2.6E-05   30.0   8.9   77   11-98     10-88  (111)
  5 PRK05449 aspartate alpha-decar  93.9     1.1 2.4E-05   30.7   9.0   76   12-98     12-89  (126)
  6 TIGR00223 panD L-aspartate-alp  93.6     1.2 2.7E-05   30.5   8.8   76   12-98     12-89  (126)
  7 PF02261 Asp_decarbox:  Asparta  92.7     2.2 4.7E-05   28.9   9.3   77   10-97     10-88  (116)
  8 PF10844 DUF2577:  Protein of u  92.5    0.32 6.8E-06   31.7   4.5   75    8-105    18-94  (100)
  9 PF14250 AbrB-like:  AbrB-like   81.5     4.6  0.0001   25.0   4.4   39   55-98     25-63  (71)
 10 PF04014 Antitoxin-MazE:  Antid  78.1     4.2 9.1E-05   22.5   3.3   22   80-101    13-34  (47)
 11 PF03120 DNA_ligase_OB:  NAD-de  77.8     2.3 4.9E-05   27.0   2.3   21   80-100    42-62  (82)
 12 PRK09570 rpoH DNA-directed RNA  77.6     3.3 7.2E-05   26.2   3.0   26   80-105    44-70  (79)
 13 COG0853 PanD Aspartate 1-decar  76.2      22 0.00048   24.4   7.9   78   10-98      9-88  (126)
 14 PF09853 DUF2080:  Putative tra  74.9     4.9 0.00011   23.6   3.0   31    3-35     10-42  (53)
 15 cd04459 Rho_CSD Rho_CSD: Rho p  66.7     4.5 9.7E-05   24.8   1.7   18   80-97     33-50  (68)
 16 PRK03760 hypothetical protein;  65.9      22 0.00048   23.7   5.1   29   70-98     88-116 (117)
 17 PF12195 End_beta_barrel:  Beta  59.3     7.2 0.00016   24.7   1.6   21   83-103    23-43  (83)
 18 COG5569 Uncharacterized conser  58.3     7.4 0.00016   25.8   1.7   22   83-104    79-100 (108)
 19 PRK11507 ribosome-associated p  56.3     8.3 0.00018   23.8   1.6   19   78-96     43-61  (70)
 20 PF02643 DUF192:  Uncharacteriz  56.2      50  0.0011   21.4   5.4   25   72-96     82-106 (108)
 21 COG3466 ISA1214 Putative trans  56.0     9.5 0.00021   22.2   1.7   29    4-34     14-42  (52)
 22 TIGR02609 doc_partner putative  54.5      31 0.00067   21.0   4.0   33   64-100     4-36  (74)
 23 TIGR01439 lp_hng_hel_AbrB loop  53.0      24 0.00053   18.4   3.0   20   80-99     13-32  (43)
 24 PF14453 ThiS-like:  ThiS-like   52.6      13 0.00028   22.0   1.9   16   84-99     41-56  (57)
 25 PF01878 EVE:  EVE domain;  Int  51.5      10 0.00022   25.5   1.6   15   86-100    38-52  (143)
 26 PF07497 Rho_RNA_bind:  Rho ter  50.9      11 0.00023   23.7   1.5   15   81-95     36-50  (78)
 27 PF13275 S4_2:  S4 domain; PDB:  50.6     7.1 0.00015   23.7   0.6   20   77-96     38-57  (65)
 28 PF01191 RNA_pol_Rpb5_C:  RNA p  50.5      21 0.00046   22.2   2.7   23   80-102    41-63  (74)
 29 PF14604 SH3_9:  Variant SH3 do  50.2      14  0.0003   20.6   1.8   19   85-103    12-30  (49)
 30 TIGR01643 YD_repeat_2x YD repe  49.9      31 0.00066   18.0   3.1   22   44-66      4-25  (42)
 31 COG4043 Preprotein translocase  49.1      14 0.00029   24.7   1.8   19   80-98     26-44  (111)
 32 TIGR03595 Obg_CgtA_exten Obg f  48.6      16 0.00035   22.1   2.0   20   78-97     44-63  (69)
 33 COG1977 MoaD Molybdopterin con  48.0      16 0.00035   22.7   2.0   19   85-103    66-84  (84)
 34 COG2002 AbrB Regulators of sta  48.0      29 0.00063   21.8   3.2   23   81-103    21-43  (89)
 35 cd06555 ASCH_PF0470_like ASC-1  46.8      16 0.00034   24.3   1.9   14   86-99     30-43  (109)
 36 PF07076 DUF1344:  Protein of u  46.3      25 0.00054   21.2   2.5   20   85-104    35-54  (61)
 37 PRK06461 single-stranded DNA-b  46.1      60  0.0013   21.8   4.7   33   46-97     42-74  (129)
 38 cd00989 PDZ_metalloprotease PD  45.4      17 0.00037   21.3   1.7   14   83-96     25-38  (79)
 39 PRK01777 hypothetical protein;  45.3      16 0.00035   23.6   1.7   14   85-98     62-75  (95)
 40 PRK11347 antitoxin ChpS; Provi  44.6      69  0.0015   20.1   4.5   35   62-100     4-38  (83)
 41 PRK06488 sulfur carrier protei  43.2      28  0.0006   20.3   2.4   18   86-103    48-65  (65)
 42 PRK06944 sulfur carrier protei  42.8      28  0.0006   20.1   2.3   17   87-103    49-65  (65)
 43 cd04498 hPOT1_OB2 hPOT1_OB2: A  42.3      26 0.00056   23.9   2.4   16   80-97     71-86  (123)
 44 PF05593 RHS_repeat:  RHS Repea  42.0      52  0.0011   17.1   3.2   21   44-65      4-24  (38)
 45 cd01756 PLAT_repeat PLAT/LH2 d  41.6      50  0.0011   21.6   3.7   48   18-69     59-106 (120)
 46 PRK00809 hypothetical protein;  41.6      24 0.00053   24.4   2.3   18   81-100    30-47  (144)
 47 smart00532 LIGANc Ligase N fam  41.4      29 0.00063   28.4   3.0   20   80-99    355-374 (441)
 48 PLN03111 DNA-directed RNA poly  41.3      35 0.00076   25.3   3.1   26   80-105   173-199 (206)
 49 PF14478 DUF4430:  Domain of un  41.3      10 0.00022   22.6   0.2   17   81-97     52-68  (68)
 50 PF11792 Baculo_LEF5_C:  Baculo  41.1     5.7 0.00012   22.3  -0.8   13   83-95     19-31  (43)
 51 PF09269 DUF1967:  Domain of un  40.9      27 0.00058   21.1   2.1   20   78-97     44-63  (69)
 52 cd01764 Urm1 Urm1-like ubuitin  40.6      26 0.00055   22.4   2.1   19   85-103    76-94  (94)
 53 PTZ00061 DNA-directed RNA poly  40.2      36 0.00079   25.2   3.1   26   80-105   172-198 (205)
 54 cd01752 PLAT_polycystin PLAT/L  40.1      38 0.00082   22.2   2.9   22   47-68     84-105 (120)
 55 TIGR02219 phage_NlpC_fam putat  39.9      20 0.00043   24.2   1.6   15   83-97     72-86  (134)
 56 PRK05659 sulfur carrier protei  39.8      31 0.00068   19.9   2.3   18   86-103    49-66  (66)
 57 cd00565 ThiS ThiaminS ubiquiti  39.7      34 0.00073   19.9   2.4   17   87-103    49-65  (65)
 58 smart00326 SH3 Src homology 3   39.5      40 0.00086   17.8   2.6   18   85-102    18-35  (58)
 59 PRK05863 sulfur carrier protei  39.1      34 0.00074   20.1   2.4   16   88-103    50-65  (65)
 60 PRK14699 replication factor A;  38.9 1.5E+02  0.0032   24.6   6.7   36   47-96     97-132 (484)
 61 cd00991 PDZ_archaeal_metallopr  38.7      24 0.00053   21.1   1.7   13   84-96     24-36  (79)
 62 smart00536 AXH domain in Ataxi  38.4      17 0.00036   24.6   1.0   26   71-96     76-112 (116)
 63 cd01757 PLAT_RAB6IP1 PLAT/LH2   37.7      39 0.00085   22.5   2.7   21   47-67     75-95  (114)
 64 cd00174 SH3 Src homology 3 dom  37.5      45 0.00098   17.4   2.6   19   85-103    15-33  (54)
 65 smart00306 HintN Hint (Hedgeho  37.5      30 0.00065   21.0   2.0   15   82-96     84-98  (100)
 66 PRK11130 moaD molybdopterin sy  37.3      31 0.00067   21.0   2.1   19   85-103    63-81  (81)
 67 cd01234 PH_CADPS CADPS (Ca2+-d  36.7      17 0.00037   24.5   0.8   17   86-102    81-97  (117)
 68 PRK02268 hypothetical protein;  36.7      26 0.00057   24.4   1.8   13   86-98     34-46  (141)
 69 cd05829 Sortase_E Sortase E (S  36.5      42 0.00092   22.8   2.8   27   72-98     50-83  (144)
 70 PF13180 PDZ_2:  PDZ domain; PD  36.4      21 0.00045   21.5   1.1   13   83-95     27-39  (82)
 71 TIGR01683 thiS thiamine biosyn  36.1      41  0.0009   19.5   2.4   17   87-103    48-64  (64)
 72 PRK08053 sulfur carrier protei  36.0      41 0.00089   19.7   2.4   17   87-103    50-66  (66)
 73 PF01568 Molydop_binding:  Moly  35.9      32  0.0007   21.5   2.0   19   81-99     37-55  (110)
 74 PRK06437 hypothetical protein;  35.7      40 0.00087   20.0   2.3   20   84-103    48-67  (67)
 75 PF03658 Ub-RnfH:  RnfH family   35.7      25 0.00055   22.4   1.5   14   85-98     59-72  (84)
 76 TIGR00686 phnA alkylphosphonat  35.3      33 0.00072   23.0   2.0   14   86-99     49-62  (109)
 77 PF00018 SH3_1:  SH3 domain;  I  34.4      35 0.00076   18.5   1.8   18   85-102    13-30  (48)
 78 cd00136 PDZ PDZ domain, also c  34.4      33 0.00071   19.5   1.8   13   84-96     27-39  (70)
 79 COG2012 RPB5 DNA-directed RNA   33.7      52  0.0011   20.8   2.6   21   81-101    48-68  (80)
 80 PRK08364 sulfur carrier protei  33.2      42  0.0009   20.0   2.1   19   85-103    52-70  (70)
 81 PF08922 DUF1905:  Domain of un  33.1 1.2E+02  0.0026   18.6   8.3   79   11-97      1-79  (80)
 82 PTZ00194 60S ribosomal protein  33.0      31 0.00068   24.2   1.7   23   82-104    41-63  (143)
 83 PRK06033 hypothetical protein;  32.8      33 0.00072   21.5   1.7   15   84-98     24-38  (83)
 84 cd00990 PDZ_glycyl_aminopeptid  32.8      34 0.00073   20.0   1.7   13   83-95     25-37  (80)
 85 PF11604 CusF_Ec:  Copper bindi  32.7      31 0.00067   20.8   1.5   17   84-100    39-55  (70)
 86 PRK08097 ligB NAD-dependent DN  32.4      47   0.001   28.1   2.9   22   78-99    350-371 (562)
 87 TIGR02988 YaaA_near_RecF S4 do  32.3      33 0.00072   19.6   1.5   12   85-96     47-58  (59)
 88 COG2501 S4-like RNA binding pr  32.2      25 0.00055   21.9   1.0   16   81-96     46-61  (73)
 89 PF02298 Cu_bind_like:  Plastoc  32.0      30 0.00066   21.6   1.4   21   80-100    11-31  (85)
 90 PF03831 PhnA:  PhnA protein;    31.6      14 0.00031   21.9  -0.2   15   85-99      7-21  (56)
 91 PF07680 DoxA:  TQO small subun  31.5      71  0.0015   22.1   3.2   40   24-64     90-132 (133)
 92 PRK01191 rpl24p 50S ribosomal   31.3      38 0.00083   23.0   1.9   23   82-104    40-62  (120)
 93 PRK07956 ligA NAD-dependent DN  31.2      51  0.0011   28.4   3.0   20   80-99    360-379 (665)
 94 PF01477 PLAT:  PLAT/LH2 domain  31.0 1.1E+02  0.0023   19.0   3.9   24   47-70     80-103 (113)
 95 PF07591 PT-HINT:  Pretoxin HIN  31.0      22 0.00048   23.9   0.7   16   81-96     70-85  (130)
 96 PF10377 ATG11:  Autophagy-rela  30.8      53  0.0012   22.2   2.5   22   82-103    37-58  (129)
 97 PF04225 OapA:  Opacity-associa  30.8      41  0.0009   21.1   1.9   16   86-101    41-56  (85)
 98 cd00992 PDZ_signaling PDZ doma  30.6      39 0.00086   19.6   1.7   15   83-97     39-53  (82)
 99 PF11948 DUF3465:  Protein of u  30.1      41 0.00089   23.3   1.8   53   43-97     41-95  (131)
100 TIGR00638 Mop molybdenum-pteri  30.0      63  0.0014   18.4   2.5   21   80-100    41-61  (69)
101 PF08797 HIRAN:  HIRAN domain;   30.0      49  0.0011   21.0   2.2   21   82-102    17-37  (107)
102 smart00228 PDZ Domain present   29.9      42  0.0009   19.5   1.7   14   83-96     39-52  (85)
103 COG0272 Lig NAD-dependent DNA   29.8      53  0.0011   28.5   2.8   20   80-99    360-379 (667)
104 PRK14350 ligA NAD-dependent DN  29.7      55  0.0012   28.3   2.9   20   80-99    357-376 (669)
105 COG1917 Uncharacterized conser  29.6      23  0.0005   23.2   0.6   25   74-99     69-97  (131)
106 TIGR00575 dnlj DNA ligase, NAD  29.6      56  0.0012   28.0   3.0   20   80-99    348-367 (652)
107 cd00986 PDZ_LON_protease PDZ d  29.2      39 0.00084   20.0   1.5   10   87-96     24-33  (79)
108 cd02790 MopB_CT_Formate-Dh_H F  29.2      53  0.0011   20.7   2.2   19   81-99     42-60  (116)
109 PRK08577 hypothetical protein;  29.2      69  0.0015   21.4   2.9   25   80-104    19-43  (136)
110 PLN02799 Molybdopterin synthas  29.1      50  0.0011   19.9   2.0   19   85-103    64-82  (82)
111 TIGR01682 moaD molybdopterin c  29.0      52  0.0011   19.8   2.1   19   85-103    62-80  (80)
112 PF01052 SpoA:  Surface present  29.0      37  0.0008   20.3   1.4   15   85-99     26-40  (77)
113 PLN02311 chalcone isomerase     28.6      68  0.0015   24.7   3.0   24   78-101   192-215 (271)
114 PRK14725 pyruvate kinase; Prov  28.5      91   0.002   26.8   4.0   57   43-100   270-347 (608)
115 cd02779 MopB_CT_Arsenite-Ox Th  28.3      56  0.0012   20.9   2.2   19   81-99     40-58  (115)
116 PLN00212 glutelin; Provisional  28.3      42 0.00092   28.0   2.0   57   37-96    340-405 (493)
117 COG1430 Uncharacterized conser  28.1      62  0.0014   22.1   2.5   29   72-100    95-123 (126)
118 cd00754 MoaD Ubiquitin domain   28.0      55  0.0012   19.3   2.0   20   84-103    61-80  (80)
119 cd04491 SoSSB_OBF SoSSB_OBF: A  28.0 1.4E+02   0.003   17.8   4.7   34   46-97     25-58  (82)
120 cd05828 Sortase_D_4 Sortase D   27.9      66  0.0014   21.2   2.6   28   72-99     44-73  (127)
121 PRK14351 ligA NAD-dependent DN  27.9      62  0.0013   28.1   2.9   20   80-99    382-401 (689)
122 cd02775 MopB_CT Molybdopterin-  27.9      58  0.0013   19.8   2.2   20   81-100    30-49  (101)
123 PF02938 GAD:  GAD domain;  Int  27.8      63  0.0014   20.3   2.4   28   73-100    59-87  (95)
124 cd00988 PDZ_CTP_protease PDZ d  27.1      50  0.0011   19.5   1.7   13   84-96     27-39  (85)
125 smart00739 KOW KOW (Kyprides,   26.9      80  0.0017   14.6   2.6   16   88-103     2-17  (28)
126 cd00987 PDZ_serine_protease PD  26.7      49  0.0011   19.6   1.7   14   83-96     37-50  (90)
127 KOG3218 RNA polymerase, 25-kDa  26.6      69  0.0015   23.8   2.6   31   75-105   170-201 (208)
128 PRK08433 flagellar motor switc  26.6      48   0.001   22.1   1.7   14   85-98     50-63  (111)
129 PF07237 DUF1428:  Protein of u  26.5      54  0.0012   21.7   1.9   21   79-99     50-70  (103)
130 PRK10220 hypothetical protein;  26.4      58  0.0013   21.9   2.0   14   86-99     50-63  (111)
131 TIGR02480 fliN flagellar motor  26.2      46   0.001   20.2   1.4   14   85-98     26-39  (77)
132 PF02597 ThiS:  ThiS family;  I  26.0      40 0.00087   19.7   1.1   19   85-103    59-77  (77)
133 PF08541 ACP_syn_III_C:  3-Oxoa  25.8      59  0.0013   19.7   1.9   21   79-99     57-77  (90)
134 TIGR01687 moaD_arch MoaD famil  25.5      65  0.0014   19.6   2.1   18   86-103    71-88  (88)
135 PF00313 CSD:  'Cold-shock' DNA  25.4 1.2E+02  0.0026   17.4   3.1   28   76-103    27-56  (66)
136 cd02787 MopB_CT_ydeP The MopB_  25.4      87  0.0019   19.8   2.7   23   78-101    36-58  (112)
137 PF11520 Cren7:  Chromatin prot  25.3      44 0.00094   20.0   1.1   17   89-105    34-50  (60)
138 cd02778 MopB_CT_Thiosulfate-R-  25.3      85  0.0018   20.0   2.7   20   81-100    37-56  (123)
139 cd00508 MopB_CT_Fdh-Nap-like T  25.2      68  0.0015   20.2   2.2   19   81-99     42-60  (120)
140 PF01272 GreA_GreB:  Transcript  25.1 1.6E+02  0.0035   17.6   6.0   55   44-98      8-63  (77)
141 PRK07440 hypothetical protein;  25.0      77  0.0017   19.0   2.3   17   87-103    54-70  (70)
142 smart00308 LH2 Lipoxygenase ho  25.0 1.1E+02  0.0024   19.0   3.2   21   47-67     82-102 (105)
143 cd02786 MopB_CT_3 The MopB_CT_  24.9      66  0.0014   20.3   2.1   20   81-100    38-57  (116)
144 PF13123 DUF3978:  Protein of u  24.9      77  0.0017   22.1   2.5   50    4-53     49-100 (145)
145 COG4519 Uncharacterized protei  24.4 1.1E+02  0.0024   19.6   3.0   30   44-85     49-78  (95)
146 cd02791 MopB_CT_Nitrate-R-NapA  24.3      69  0.0015   20.4   2.1   20   81-100    42-61  (122)
147 PRK10838 spr outer membrane li  24.3      48  0.0011   24.0   1.5   16   82-97    123-138 (190)
148 PF02887 PK_C:  Pyruvate kinase  24.2 1.3E+02  0.0028   19.3   3.4   21   79-99     80-101 (117)
149 cd02792 MopB_CT_Formate-Dh-Na-  24.1      75  0.0016   20.2   2.3   19   81-99     42-60  (122)
150 cd04458 CSP_CDS Cold-Shock Pro  24.1 1.5E+02  0.0033   16.9   4.5   25   79-103    30-56  (65)
151 PRK07696 sulfur carrier protei  24.1      83  0.0018   18.6   2.3   17   87-103    51-67  (67)
152 TIGR03784 marine_sortase sorta  24.0      75  0.0016   22.6   2.4   30   71-100    90-121 (174)
153 PRK06083 sulfur carrier protei  23.8      82  0.0018   19.8   2.3   18   86-103    67-84  (84)
154 PF07653 SH3_2:  Variant SH3 do  23.7      67  0.0014   17.8   1.7   13   85-97     15-27  (55)
155 cd02781 MopB_CT_Acetylene-hydr  23.7      75  0.0016   20.6   2.2   20   81-100    40-59  (130)
156 PF12519 DUF3722:  Protein of u  23.4 1.3E+02  0.0029   23.0   3.8   14   23-36     88-101 (260)
157 PRK09838 periplasmic copper-bi  23.1      77  0.0017   21.2   2.2   18   84-101    85-102 (115)
158 PF00278 Orn_DAP_Arg_deC:  Pyri  23.1      59  0.0013   20.5   1.6   12   87-98     82-93  (116)
159 PF15057 DUF4537:  Domain of un  22.7      66  0.0014   21.6   1.8   21   85-105    53-73  (124)
160 PRK09798 antitoxin MazE; Provi  22.6   2E+02  0.0044   17.9   4.1   33   63-99      6-38  (82)
161 PF02431 Chalcone:  Chalcone-fl  22.5      63  0.0014   23.0   1.8   23   80-102   121-144 (199)
162 PF12436 USP7_ICP0_bdg:  ICP0-b  22.5      68  0.0015   23.9   2.0   15   85-99    138-152 (249)
163 PF00595 PDZ:  PDZ domain (Also  22.4      51  0.0011   19.5   1.1   12   85-96     40-51  (81)
164 COG2208 RsbU Serine phosphatas  22.4      49  0.0011   25.7   1.3   22   78-99    283-304 (367)
165 TIGR01080 rplX_A_E ribosomal p  22.2      67  0.0015   21.5   1.7   22   83-104    37-58  (114)
166 KOG4146 Ubiquitin-like protein  22.1      93   0.002   20.4   2.3   17   83-99     81-97  (101)
167 COG2824 PhnA Uncharacterized Z  22.1      63  0.0014   21.7   1.5   14   86-99     51-64  (112)
168 KOG1765 Regulator of ribosome   22.1      50  0.0011   23.9   1.2   62   37-105    60-121 (181)
169 cd04497 hPOT1_OB1_like hPOT1_O  22.0 1.7E+02  0.0036   19.7   3.7   11   88-98     69-79  (138)
170 PRK11479 hypothetical protein;  21.8      56  0.0012   25.2   1.5   17   81-97     58-74  (274)
171 PF02080 TrkA_C:  TrkA-C domain  21.7      44 0.00096   19.1   0.7   14   86-99     46-59  (71)
172 cd02793 MopB_CT_DMSOR-BSOR-TMA  21.7      87  0.0019   20.5   2.2   19   81-99     40-58  (129)
173 PF00877 NLPC_P60:  NlpC/P60 fa  21.5      50  0.0011   20.7   1.0   18   81-98     45-62  (105)
174 PF03459 TOBE:  TOBE domain;  I  21.2   1E+02  0.0023   17.3   2.3   22   79-100    38-59  (64)
175 cd02789 MopB_CT_FmdC-FwdD The   21.2      92   0.002   19.9   2.2   19   81-99     38-56  (106)
176 cd02794 MopB_CT_DmsA-EC The Mo  21.2      99  0.0021   19.9   2.4   19   81-99     37-55  (121)
177 PRK09681 putative type II secr  21.1   1E+02  0.0023   23.7   2.8   22   74-95    209-232 (276)
178 cd01753 PLAT_LOX PLAT domain o  21.1 1.2E+02  0.0025   19.8   2.7   47   18-69     58-104 (113)
179 COG2947 Uncharacterized conser  21.0 1.2E+02  0.0026   21.5   2.8   19   80-100    36-54  (156)
180 cd00113 PLAT PLAT (Polycystin-  20.9 1.2E+02  0.0026   19.2   2.8   22   47-68     83-104 (116)
181 PF03152 UFD1:  Ubiquitin fusio  20.6 3.3E+02  0.0072   19.5   7.2   77   16-97     18-95  (176)
182 cd02899 PLAT_SR Scavenger rece  20.5 1.2E+02  0.0025   20.0   2.6   46   16-68     52-97  (109)
183 PF12791 RsgI_N:  Anti-sigma fa  20.4      57  0.0012   18.4   1.0   27   73-99      8-37  (56)
184 PRK06788 flagellar motor switc  20.3      73  0.0016   21.5   1.6   13   86-98     53-65  (119)
185 PF13356 DUF4102:  Domain of un  20.3 1.6E+02  0.0035   18.0   3.1   34   43-79     22-55  (89)

No 1  
>PF02362 B3:  B3 DNA binding domain;  InterPro: IPR003340 Two DNA binding proteins, RAV1 and RAV2 from Arabidopsis thaliana contain two distinct amino acid sequence domains found only in higher plant species. The N-terminal regions of RAV1 and RAV2 are homologous to the AP2 DNA-binding domain (see IPR001471 from INTERPRO) present in a family of transcription factors, while the C-terminal region exhibits homology to the highly conserved C-terminal domain, designated B3, of VP1/ABI3 transcription factors []. The AP2 and B3-like domains of RAV1 bind autonomously to the CAACA and CACCTG motifs, respectively, and together achieve a high affinity and specificity of binding. It has been suggested that the AP2 and B3-like domains of RAV1 are connected by a highly flexible structure enabling the two domains to bind to the CAACA and CACCTG motifs in various spacings and orientations [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1WID_A 1YEL_A.
Probab=99.84  E-value=5.8e-20  Score=118.68  Aligned_cols=86  Identities=24%  Similarity=0.367  Sum_probs=63.7

Q ss_pred             EEEecccCCCCCCCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeec-ChHHHHhhcCCC
Q 043432           11 FEKQLKNSDVNAAGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFE-NTRAFIKRYCLE   89 (105)
Q Consensus        11 f~K~LT~SDv~~~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~-gW~~fV~~k~L~   89 (105)
                      |.|+|++||+.+.++|.||++.++++  .+....++.+.+.|. .|++|.++++++.  .++.++|+ ||.+||++++|+
T Consensus         1 F~K~l~~s~~~~~~~l~iP~~f~~~~--~~~~~~~~~v~l~~~-~g~~W~v~~~~~~--~~~~~~l~~GW~~Fv~~n~L~   75 (100)
T PF02362_consen    1 FFKVLKPSDVSSSCRLIIPKEFAKKH--GGNKRKSREVTLKDP-DGRSWPVKLKYRK--NSGRYYLTGGWKKFVRDNGLK   75 (100)
T ss_dssp             EEEE--TTCCCCTT-EEE-HHHHTTT--S--SS--CEEEEEET-TTEEEEEEEEEEC--CTTEEEEETTHHHHHHHCT--
T ss_pred             CEEEEEccCcCCCCEEEeCHHHHHHh--CCCcCCCeEEEEEeC-CCCEEEEEEEEEc--cCCeEEECCCHHHHHHHcCCC
Confidence            78999999999888999999999888  222235689999998 5999999999874  44457888 799999999999


Q ss_pred             CCCEEEEEEcCC
Q 043432           90 LGDYIMVYKDEL  101 (105)
Q Consensus        90 ~GD~i~f~~~~~  101 (105)
                      +||.|+|+....
T Consensus        76 ~GD~~~F~~~~~   87 (100)
T PF02362_consen   76 EGDVCVFELIGN   87 (100)
T ss_dssp             TT-EEEEEE-SS
T ss_pred             CCCEEEEEEecC
Confidence            999999998753


No 2  
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=99.08  E-value=4.9e-10  Score=75.55  Aligned_cols=78  Identities=22%  Similarity=0.434  Sum_probs=62.7

Q ss_pred             ccceeEEEecccCCCC-CCCcEEeehhhhh--ccCCC-----C-------CCCCCEEEEEEECCCCeEEEEEEEEcCC-C
Q 043432            6 LMRFLFEKQLKNSDVN-AAGRIVLPKKLAE--TYLPP-----V-------NEKAGFWMHLEDMDFNKVWTFKFRFWPN-N   69 (105)
Q Consensus         6 ~~~~~f~K~LT~SDv~-~~~rl~iPk~~ae--~~lP~-----l-------~~~~~~~l~~~D~~~g~~W~fr~~~~~~-~   69 (105)
                      ....++.|+|++|||. ..+||.||-....  .+|-+     +       ....|+.+.+.|+. ++.|.++++.|.. +
T Consensus        19 d~kli~~K~L~~tDv~~~qsRLsmP~~qi~~~dFLt~eE~~~i~~~~~~~~~~~Gv~V~lvdp~-~~~~~m~lkkW~mg~   97 (114)
T PF03754_consen   19 DPKLIIEKTLFKTDVDPHQSRLSMPFNQIIDNDFLTEEEKRIIKEEKKNNDKKKGVEVILVDPS-LRKWTMRLKKWNMGN   97 (114)
T ss_pred             CCeEEEeeeecccCCCCCCceeeccHHHhcccccCCHHHHHHHHHhhccCcccCCceEEEECCc-CcEEEEEEEEecccC
Confidence            4578999999999999 5899999976653  23322     2       23578999999995 8999999999987 4


Q ss_pred             CCcceeec-ChHHHHh
Q 043432           70 RGRMYIFE-NTRAFIK   84 (105)
Q Consensus        70 ~s~~y~l~-gW~~fV~   84 (105)
                      .+-.|+|. ||.++|.
T Consensus        98 ~~~~YvL~~gWn~VV~  113 (114)
T PF03754_consen   98 GTSNYVLNSGWNKVVE  113 (114)
T ss_pred             CceEEEEEcChHhhcc
Confidence            55679999 8999886


No 3  
>PF09217 EcoRII-N:  Restriction endonuclease EcoRII, N-terminal;  InterPro: IPR023372 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents the N-terminal effector-binding domain of the type II restriction endonuclease EcoRII, which has a DNA recognition fold, allowing for binding to 5'-CCWGG sequences. It assumes a structure composed of an eight-stranded beta-sheet with the strands in the order of b2, b5, b4, b3, b7, b6, b1 and b8. They are mostly antiparallel to each other except that b3 is parallel to b7. Alternatively, it may also be viewed as consisting of two mini beta-sheets of four antiparallel beta-strands, sheet I from beta-strands b2, b5, b4, b3 and sheet II from strands b7, b6, b1, b8, folded into an open mixed beta-barrel with a novel topology. Sheet I has a simple Greek key motif while sheet II does not [].  The domain represented by this entry is only found in bacterial proteins.; PDB: 3HQF_A 1NA6_A.
Probab=98.58  E-value=2.7e-07  Score=64.95  Aligned_cols=88  Identities=19%  Similarity=0.320  Sum_probs=55.3

Q ss_pred             eeEEEecccCCCCC----CCcEEeehhhhhccCCCCC----CCCCEEEEEEECCCC--eEEEEEEEEcCC----CCCcce
Q 043432            9 FLFEKQLKNSDVNA----AGRIVLPKKLAETYLPPVN----EKAGFWMHLEDMDFN--KVWTFKFRFWPN----NRGRMY   74 (105)
Q Consensus         9 ~~f~K~LT~SDv~~----~~rl~iPk~~ae~~lP~l~----~~~~~~l~~~D~~~g--~~W~fr~~~~~~----~~s~~y   74 (105)
                      .+|.|.|++.|++.    ..++.|||..++.+||.+.    .++.+.|.+.+.. +  ..+.+|++|..|    +.+..|
T Consensus         8 ~~~~K~LSaNDtGaTGgHQaGiyIpk~~~~~lFp~~~~~~~~Np~~~~~~~~~s-~~~~~~~~r~iYYnn~~~~gTRNE~   86 (156)
T PF09217_consen    8 AIYCKRLSANDTGATGGHQAGIYIPKSAAELLFPSINHTKEENPDIWLKARWQS-HFVTDSQVRFIYYNNRLFGGTRNEY   86 (156)
T ss_dssp             EEEEEE--CCCCTTTSSS--EEEE-HHHHHHH-GGG-SSSSSS-EEEEEEEETT-TT---EEEEEEEE-CCCTTSS--EE
T ss_pred             EEEEEEccCCCCCCcCcccceeEecccHHHHhCCCCCcccccCCceeEEEEECC-CCccceeEEEEEEcccccCCCcCce
Confidence            57999999999984    4489999999988998764    2466888888773 4  668899999966    345679


Q ss_pred             eecChHHHHhhcC-CCCCCEEEEE
Q 043432           75 IFENTRAFIKRYC-LELGDYIMVY   97 (105)
Q Consensus        75 ~l~gW~~fV~~k~-L~~GD~i~f~   97 (105)
                      .||.|.....-.+ =.+||.++|.
T Consensus        87 RIT~~G~~~~~~~~~~tGaL~vla  110 (156)
T PF09217_consen   87 RITRFGRGFPLQNPENTGALLVLA  110 (156)
T ss_dssp             EEE---TTSGGG-GGGTT-EEEEE
T ss_pred             EEeeecCCCccCCccccccEEEEE
Confidence            9999865554333 3679998886


No 4  
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production. Decarboxylation of aspartate is  the major route of beta-alanine production in bacteria, and is catalyzed  by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which  requires a pyruvoyl group for its activity. The pyruvoyl cofactor is  covalently bound to the enzyme. The protein is synthesized as a  proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an  alpha chain (C-terminal fragment) and beta chain (N-terminal fragment),  and the pyruvoyl group. Beta-alanine is required for the biosynthesis of  pantothenate, in which the enzyme plays a critical regulatory role. The  active site of the tetrameric enzyme is located at the interface of two  subunits, with a Lysine and a Histidine from the beta chain of one  subunit forming the active site with residues from the alpha chain of  the adjacent subunit. This alignment 
Probab=93.89  E-value=1.2  Score=29.95  Aligned_cols=77  Identities=13%  Similarity=0.198  Sum_probs=58.0

Q ss_pred             EEEecccCCCCCCCcEEeehhhhhc--cCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCC
Q 043432           11 FEKQLKNSDVNAAGRIVLPKKLAET--YLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCL   88 (105)
Q Consensus        11 f~K~LT~SDv~~~~rl~iPk~~ae~--~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L   88 (105)
                      =.-..|..|+..-|.+.|..+..++  ++|.      ..|.+++..+|..|+ .|.+.....|+.-.|.|    .-++..
T Consensus        10 HratVT~a~L~YeGSitID~~Ll~aagi~~~------E~V~I~Nv~NG~Rf~-TYvI~g~~gSg~I~lNG----AAAr~~   78 (111)
T cd06919          10 HRATVTEADLNYEGSITIDEDLLEAAGILPY------EKVLVVNVNNGARFE-TYVIPGERGSGVICLNG----AAARLG   78 (111)
T ss_pred             cceEEeccccccceeEEECHHHHHhcCCCCC------CEEEEEECCCCcEEE-EEEEEcCCCCCEEEeCC----HHHhcC
Confidence            3456899999988999999988765  3554      478999987787665 45566445577778888    567788


Q ss_pred             CCCCEEEEEE
Q 043432           89 ELGDYIMVYK   98 (105)
Q Consensus        89 ~~GD~i~f~~   98 (105)
                      ++||.|++.-
T Consensus        79 ~~GD~vII~s   88 (111)
T cd06919          79 QPGDRVIIMA   88 (111)
T ss_pred             CCCCEEEEEE
Confidence            9999999853


No 5  
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=93.89  E-value=1.1  Score=30.74  Aligned_cols=76  Identities=11%  Similarity=0.239  Sum_probs=57.8

Q ss_pred             EEecccCCCCCCCcEEeehhhhhc--cCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCC
Q 043432           12 EKQLKNSDVNAAGRIVLPKKLAET--YLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLE   89 (105)
Q Consensus        12 ~K~LT~SDv~~~~rl~iPk~~ae~--~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~   89 (105)
                      .-..|..|+..-|.+.|..+..++  ++|.      -.|.+++..+|..|+ .|.+.....|+.-.|.|    .-++..+
T Consensus        12 ratVT~a~L~Y~GSitID~~Ll~aagi~p~------E~V~V~Nv~NG~Rf~-TYvI~g~~GSg~I~lNG----AAAr~~~   80 (126)
T PRK05449         12 RATVTEADLNYEGSITIDEDLLDAAGILEN------EKVQIVNVNNGARFE-TYVIAGERGSGVICLNG----AAARLVQ   80 (126)
T ss_pred             ceEEeccccccceeEEECHHHHHhcCCCCC------CEEEEEECCCCcEEE-EEEEEcCCCCCEEEeCC----HHHhcCC
Confidence            456899999988999999998875  4554      378999987788665 45566445577778888    5678889


Q ss_pred             CCCEEEEEE
Q 043432           90 LGDYIMVYK   98 (105)
Q Consensus        90 ~GD~i~f~~   98 (105)
                      +||.|++.-
T Consensus        81 ~GD~vII~a   89 (126)
T PRK05449         81 VGDLVIIAA   89 (126)
T ss_pred             CCCEEEEEE
Confidence            999999853


No 6  
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=93.64  E-value=1.2  Score=30.50  Aligned_cols=76  Identities=13%  Similarity=0.325  Sum_probs=57.7

Q ss_pred             EEecccCCCCCCCcEEeehhhhhc--cCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCC
Q 043432           12 EKQLKNSDVNAAGRIVLPKKLAET--YLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLE   89 (105)
Q Consensus        12 ~K~LT~SDv~~~~rl~iPk~~ae~--~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~   89 (105)
                      ....|..|+..-|.+.|..+..++  ++|.      -.|.+.|..+|..|+ .|.+.....|+.-.|.|    .-++..+
T Consensus        12 ratVT~a~L~Y~GSItID~~Lm~aagi~p~------E~V~V~Nv~NG~Rf~-TYvI~G~~GSg~I~lNG----AAArl~~   80 (126)
T TIGR00223        12 RATVTHANLNYEGSITIDEDLLDAAGILEN------EKVDIVNVNNGKRFS-TYAIAGKRGSRIICVNG----AAARCVS   80 (126)
T ss_pred             ceEEeccccccceeEEECHHHHHhcCCCCC------CEEEEEECCCCcEEE-EEEEEcCCCCCEEEeCC----HHHhcCC
Confidence            456789999988999999988764  4554      378899987788665 45566545577778888    5677889


Q ss_pred             CCCEEEEEE
Q 043432           90 LGDYIMVYK   98 (105)
Q Consensus        90 ~GD~i~f~~   98 (105)
                      +||.|++.-
T Consensus        81 ~GD~VII~s   89 (126)
T TIGR00223        81 VGDIVIIAS   89 (126)
T ss_pred             CCCEEEEEE
Confidence            999999853


No 7  
>PF02261 Asp_decarbox:  Aspartate decarboxylase;  InterPro: IPR003190 Decarboxylation of aspartate is the major route of alanine production in bacteria, and is catalysed by the enzyme aspartate decarboxylase. The enzyme is translated as an inactive proenzyme of two chains, A and B. This family contains both chains of aspartate decarboxylase.; GO: 0004068 aspartate 1-decarboxylase activity, 0006523 alanine biosynthetic process; PDB: 1PYU_C 1AW8_A 1PYQ_B 3TM7_C 1PT1_A 1PQH_A 1PPY_B 1PT0_B 1PQF_A 1PQE_A ....
Probab=92.66  E-value=2.2  Score=28.92  Aligned_cols=77  Identities=12%  Similarity=0.276  Sum_probs=50.5

Q ss_pred             eEEEecccCCCCCCCcEEeehhhhhc--cCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcC
Q 043432           10 LFEKQLKNSDVNAAGRIVLPKKLAET--YLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYC   87 (105)
Q Consensus        10 ~f~K~LT~SDv~~~~rl~iPk~~ae~--~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~   87 (105)
                      +=..+.|..|+...|.+.|..+..++  ++|.      -.|.+.+..+|..|+ .|.+.....|+.-.|.|    .-++.
T Consensus        10 iHratVT~a~L~Y~GSitID~~Ll~aagi~p~------E~V~V~Nv~nG~Rf~-TYvI~g~~GSg~I~lNG----aAArl   78 (116)
T PF02261_consen   10 IHRATVTEADLNYEGSITIDEDLLDAAGILPY------EQVQVVNVNNGERFE-TYVIPGERGSGVICLNG----AAARL   78 (116)
T ss_dssp             EEEEE--EEETTSTSCEEEEHHHHHHCT--TT------BEEEEEETTT--EEE-EEEEEESTTTT-EEEEG----GGGGC
T ss_pred             hcceEEeccccccceeeEECHHHHHHcCCCcC------CEEEEEECCCCcEEE-EEEEEccCCCcEEEECC----HHHhc
Confidence            33457899999988999999988764  4554      478999988788665 34455444566777777    56788


Q ss_pred             CCCCCEEEEE
Q 043432           88 LELGDYIMVY   97 (105)
Q Consensus        88 L~~GD~i~f~   97 (105)
                      .++||.|++.
T Consensus        79 ~~~GD~vII~   88 (116)
T PF02261_consen   79 VQVGDRVIIM   88 (116)
T ss_dssp             S-TT-EEEEE
T ss_pred             cCCCCEEEEE
Confidence            8999999884


No 8  
>PF10844 DUF2577:  Protein of unknown function (DUF2577);  InterPro: IPR022555 This family of proteins has no known function
Probab=92.52  E-value=0.32  Score=31.72  Aligned_cols=75  Identities=12%  Similarity=0.191  Sum_probs=45.4

Q ss_pred             ceeEEEecccCCCC-C-CCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhh
Q 043432            8 RFLFEKQLKNSDVN-A-AGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKR   85 (105)
Q Consensus         8 ~~~f~K~LT~SDv~-~-~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~   85 (105)
                      ...|.++++.+-+. + .+++.||++..  ++|..-......+.+.... ...          +.          .+.-.
T Consensus        18 ~i~~G~V~s~~PL~I~i~~~liL~~~~L--~i~~~l~~~~~~~~~~~~~-~~~----------~~----------~i~~~   74 (100)
T PF10844_consen   18 DIVIGTVVSVPPLKIKIDQKLILDKDFL--IIPELLKDYTRDITIEHNS-ETD----------NI----------TITFT   74 (100)
T ss_pred             eeEEEEEEecccEEEEECCeEEEchHHE--EeehhccceEEEEEEeccc-ccc----------ce----------eEEEe
Confidence            34788999998754 2 34588887654  4555323333444443321 110          00          05556


Q ss_pred             cCCCCCCEEEEEEcCCCCCC
Q 043432           86 YCLELGDYIMVYKDELEGSY  105 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~~g~~  105 (105)
                      .+|++||.|.+.+..++.+|
T Consensus        75 ~~Lk~GD~V~ll~~~~gQ~y   94 (100)
T PF10844_consen   75 DGLKVGDKVLLLRVQGGQKY   94 (100)
T ss_pred             cCCcCCCEEEEEEecCCCEE
Confidence            78999999999997777665


No 9  
>PF14250 AbrB-like:  AbrB-like transcriptional regulator
Probab=81.46  E-value=4.6  Score=25.05  Aligned_cols=39  Identities=15%  Similarity=0.217  Sum_probs=30.7

Q ss_pred             CCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCCCCCEEEEEE
Q 043432           55 FNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVYK   98 (105)
Q Consensus        55 ~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~~   98 (105)
                      .|++=+||.+...|++    +|-| ..|-+..+|++||++.+--
T Consensus        25 ~GR~~syr~~Vq~NGn----LLIG-~AYT~~m~L~PGdEFeI~L   63 (71)
T PF14250_consen   25 RGRKASYRVSVQGNGN----LLIG-SAYTKQMGLKPGDEFEIKL   63 (71)
T ss_pred             CCcCceEEEEEecCCC----EEEc-HHHHHHhCCCCCCEEEEEe
Confidence            5888889988886544    4555 6899999999999987743


No 10 
>PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=78.14  E-value=4.2  Score=22.53  Aligned_cols=22  Identities=14%  Similarity=0.190  Sum_probs=18.7

Q ss_pred             HHHHhhcCCCCCCEEEEEEcCC
Q 043432           80 RAFIKRYCLELGDYIMVYKDEL  101 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~~  101 (105)
                      .++.+..+|++||.|.+.-+.+
T Consensus        13 k~~~~~l~l~~Gd~v~i~~~~~   34 (47)
T PF04014_consen   13 KEIREKLGLKPGDEVEIEVEGD   34 (47)
T ss_dssp             HHHHHHTTSSTTTEEEEEEETT
T ss_pred             HHHHHHcCCCCCCEEEEEEeCC
Confidence            4788889999999999988744


No 11 
>PF03120 DNA_ligase_OB:  NAD-dependent DNA ligase OB-fold domain;  InterPro: IPR004150 DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This family is a small domain found after the adenylation domain DNA_ligase_N in NAD+-dependent ligases (IPR001679 from INTERPRO). OB-fold domains generally are involved in nucleic acid binding.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 2OWO_A 1TAE_A 3UQ8_A 1DGS_A 1V9P_B 3SGI_A.
Probab=77.81  E-value=2.3  Score=27.04  Aligned_cols=21  Identities=24%  Similarity=0.505  Sum_probs=17.0

Q ss_pred             HHHHhhcCCCCCCEEEEEEcC
Q 043432           80 RAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      .+|+++++|..||.|.++|..
T Consensus        42 ~~~i~~~~i~~Gd~V~V~raG   62 (82)
T PF03120_consen   42 YDYIKELDIRIGDTVLVTRAG   62 (82)
T ss_dssp             HHHHHHTT-BBT-EEEEEEET
T ss_pred             HHHHHHcCCCCCCEEEEEECC
Confidence            589999999999999999863


No 12 
>PRK09570 rpoH DNA-directed RNA polymerase subunit H; Reviewed
Probab=77.56  E-value=3.3  Score=26.18  Aligned_cols=26  Identities=19%  Similarity=0.273  Sum_probs=20.1

Q ss_pred             HHHHhhcCCCCCCEEEEEEcCCC-CCC
Q 043432           80 RAFIKRYCLELGDYIMVYKDELE-GSY  105 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~~~-g~~  105 (105)
                      ...++..+|+.||+|-+.|...+ |+|
T Consensus        44 DPv~r~~g~k~GdVvkI~R~S~taG~~   70 (79)
T PRK09570         44 DPVVKAIGAKPGDVIKIVRKSPTAGEA   70 (79)
T ss_pred             ChhhhhcCCCCCCEEEEEECCCCCCcc
Confidence            35677889999999999997544 554


No 13 
>COG0853 PanD Aspartate 1-decarboxylase [Coenzyme metabolism]
Probab=76.25  E-value=22  Score=24.38  Aligned_cols=78  Identities=10%  Similarity=0.259  Sum_probs=54.7

Q ss_pred             eEEEecccCCCCCCCcEEeehhhhhc--cCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcC
Q 043432           10 LFEKQLKNSDVNAAGRIVLPKKLAET--YLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYC   87 (105)
Q Consensus        10 ~f~K~LT~SDv~~~~rl~iPk~~ae~--~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~   87 (105)
                      +=.-+.|+.|+...|.+.|-.+..++  .+|.      -.+.+++..+|...+ .|.+.....|+.--|.|    .-++-
T Consensus         9 iHratVT~A~L~Y~GSitID~dlldaagile~------EkV~I~N~nNGaRf~-TYvI~g~rGSg~I~lNG----AAArl   77 (126)
T COG0853           9 IHRATVTEADLNYVGSITIDEDLLDAAGILEN------EKVDIVNVNNGARFS-TYVIAGERGSGVICLNG----AAARL   77 (126)
T ss_pred             eeeeEEeecccceEEeEEECHHHHhhcCCCCC------ceEEEEECCCCcEEE-EEEEEccCCCcEEEech----HHHhh
Confidence            44567899999988999999888764  4554      367888886666332 34455444566666666    55777


Q ss_pred             CCCCCEEEEEE
Q 043432           88 LELGDYIMVYK   98 (105)
Q Consensus        88 L~~GD~i~f~~   98 (105)
                      .++||.|+++-
T Consensus        78 ~~~GD~VII~s   88 (126)
T COG0853          78 VQVGDLVIIMS   88 (126)
T ss_pred             CCCCCEEEEEE
Confidence            89999999864


No 14 
>PF09853 DUF2080:  Putative transposon-encoded protein (DUF2080);  InterPro: IPR019205  This entry, found in various hypothetical archaeal proteins, has no known function. 
Probab=74.88  E-value=4.9  Score=23.58  Aligned_cols=31  Identities=23%  Similarity=0.280  Sum_probs=25.9

Q ss_pred             CccccceeEEEecccCCCCCCCcEE--eehhhhhc
Q 043432            3 NPFLMRFLFEKQLKNSDVNAAGRIV--LPKKLAET   35 (105)
Q Consensus         3 ~~~~~~~~f~K~LT~SDv~~~~rl~--iPk~~ae~   35 (105)
                      -++++...|.+..++.  ++.+++.  +|+++.-+
T Consensus        10 k~~~i~~~~~~~vk~~--Gnsa~v~p~lPkeyiGK   42 (53)
T PF09853_consen   10 KPRNIEPTFIGVVKPF--GNSARVYPSLPKEYIGK   42 (53)
T ss_pred             ceeeEEEEEEEEEEec--CcceeEcCCCChHHcCc
Confidence            3567888999999998  7778999  99998743


No 15 
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA are released from DNA template by an mRNA stem loop structure, which resembles the transcription termination mechanism used by eukaryotic pol III. The second mechanism is mediated by Rho factor. Rho factor terminates transcription by using energy from ATP hydrolysis to forcibly dissociate the transcripts from RNA polymerase. Rho protein contains an N-terminal S1-like domain, which binds single-stranded RNA. Rho has a C-terminal ATPase domain which hydrolyzes ATP to provide energy to strip RNA polymerase and mRNA from the DNA template. Rho functions as a homohexamer.
Probab=66.74  E-value=4.5  Score=24.75  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=15.5

Q ss_pred             HHHHhhcCCCCCCEEEEE
Q 043432           80 RAFIKRYCLELGDYIMVY   97 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~   97 (105)
                      ..-||..+|+.||.|.=.
T Consensus        33 ~~~Irr~~LR~GD~V~G~   50 (68)
T cd04459          33 PSQIRRFNLRTGDTVVGQ   50 (68)
T ss_pred             HHHHHHhCCCCCCEEEEE
Confidence            468999999999999754


No 16 
>PRK03760 hypothetical protein; Provisional
Probab=65.87  E-value=22  Score=23.72  Aligned_cols=29  Identities=28%  Similarity=0.321  Sum_probs=21.6

Q ss_pred             CCcceeecChHHHHhhcCCCCCCEEEEEE
Q 043432           70 RGRMYIFENTRAFIKRYCLELGDYIMVYK   98 (105)
Q Consensus        70 ~s~~y~l~gW~~fV~~k~L~~GD~i~f~~   98 (105)
                      .+-.|+|+==...+.+.++++||.|.|-+
T Consensus        88 ~~a~~VLEl~aG~~~~~gi~~Gd~v~~~~  116 (117)
T PRK03760         88 KPARYIIEGPVGKIRVLKVEVGDEIEWID  116 (117)
T ss_pred             ccceEEEEeCCChHHHcCCCCCCEEEEee
Confidence            34558999223457789999999998865


No 17 
>PF12195 End_beta_barrel:  Beta barrel domain of bacteriophage endosialidase;  InterPro: IPR024427 This entry represents the beta barrel domain of endosialidases which is nested in a beta propeller domain. This beta barrel domain is approximately 80 amino acids in length and represents one of the two sialic acid binding sites of the enzyme [].; PDB: 1V0E_B 1V0F_E 3JU4_A 3GVL_A 3GVK_B 3GVJ_A.
Probab=59.29  E-value=7.2  Score=24.69  Aligned_cols=21  Identities=19%  Similarity=0.404  Sum_probs=10.4

Q ss_pred             HhhcCCCCCCEEEEEEcCCCC
Q 043432           83 IKRYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        83 V~~k~L~~GD~i~f~~~~~~g  103 (105)
                      +-+++|.+||.|.|.-....|
T Consensus        23 l~~HGl~vGD~VnFsnsa~tG   43 (83)
T PF12195_consen   23 LTDHGLFVGDFVNFSNSAVTG   43 (83)
T ss_dssp             -TT----TT-EEEEES-SSTT
T ss_pred             EccCceeecceEEEecccccc
Confidence            568999999999997654443


No 18 
>COG5569 Uncharacterized conserved protein [Function unknown]
Probab=58.30  E-value=7.4  Score=25.83  Aligned_cols=22  Identities=23%  Similarity=0.262  Sum_probs=18.1

Q ss_pred             HhhcCCCCCCEEEEEEcCCCCC
Q 043432           83 IKRYCLELGDYIMVYKDELEGS  104 (105)
Q Consensus        83 V~~k~L~~GD~i~f~~~~~~g~  104 (105)
                      ..=.+|++||.|.|--+..+|+
T Consensus        79 a~lsglKeGdkV~fvferv~gk  100 (108)
T COG5569          79 AKLSGLKEGDKVEFVFERVNGK  100 (108)
T ss_pred             HHhhccccCCcEEEEEEeeCCE
Confidence            4456899999999988877775


No 19 
>PRK11507 ribosome-associated protein; Provisional
Probab=56.29  E-value=8.3  Score=23.83  Aligned_cols=19  Identities=16%  Similarity=0.109  Sum_probs=16.0

Q ss_pred             ChHHHHhhcCCCCCCEEEE
Q 043432           78 NTRAFIKRYCLELGDYIMV   96 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f   96 (105)
                      |=.+.-|.++|+.||+|.|
T Consensus        43 Geve~rRgkKl~~GD~V~~   61 (70)
T PRK11507         43 GAVETRKRCKIVAGQTVSF   61 (70)
T ss_pred             CEEecccCCCCCCCCEEEE
Confidence            4457778899999999988


No 20 
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=56.16  E-value=50  Score=21.44  Aligned_cols=25  Identities=16%  Similarity=0.501  Sum_probs=16.7

Q ss_pred             cceeecChHHHHhhcCCCCCCEEEE
Q 043432           72 RMYIFENTRAFIKRYCLELGDYIMV   96 (105)
Q Consensus        72 ~~y~l~gW~~fV~~k~L~~GD~i~f   96 (105)
                      -.|+|+==..++.+.++++||.|.|
T Consensus        82 a~~vLE~~aG~~~~~~i~~Gd~v~~  106 (108)
T PF02643_consen   82 ARYVLELPAGWFEKLGIKVGDRVRI  106 (108)
T ss_dssp             ECEEEEEETTHHHHHT--TT-EEE-
T ss_pred             cCEEEEcCCCchhhcCCCCCCEEEe
Confidence            4689993356788999999999986


No 21 
>COG3466 ISA1214 Putative transposon-encoded protein [Function unknown]
Probab=56.02  E-value=9.5  Score=22.21  Aligned_cols=29  Identities=17%  Similarity=0.328  Sum_probs=24.0

Q ss_pred             ccccceeEEEecccCCCCCCCcEEeehhhhh
Q 043432            4 PFLMRFLFEKQLKNSDVNAAGRIVLPKKLAE   34 (105)
Q Consensus         4 ~~~~~~~f~K~LT~SDv~~~~rl~iPk~~ae   34 (105)
                      +.+.+..|+|..|+-  ++.+-..+||++..
T Consensus        14 ~~~ve~~~ek~Vtpf--GnsakVdvPK~yiG   42 (52)
T COG3466          14 KEEVEVVFEKRVTPF--GNSAKVDVPKRYIG   42 (52)
T ss_pred             chheEEEEEEEEEec--CCcceeeCchHHcC
Confidence            456788999999987  66689999999873


No 22 
>TIGR02609 doc_partner putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids.
Probab=54.46  E-value=31  Score=20.99  Aligned_cols=33  Identities=18%  Similarity=0.256  Sum_probs=23.2

Q ss_pred             EEcCCCCCcceeecChHHHHhhcCCCCCCEEEEEEcC
Q 043432           64 RFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        64 ~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      ..|.  +|  +.++==.+++.+-+|.+||.|.+..+.
T Consensus         4 ~k~G--NS--~~vtIPk~i~~~lgl~~Gd~v~v~~~~   36 (74)
T TIGR02609         4 RKVG--NS--LVVTLPKEVLESLGLKEGDTLYVDEEE   36 (74)
T ss_pred             EEEC--Ce--eEEEECHHHHHHcCcCCCCEEEEEEEC
Confidence            4563  35  444422588999999999999886653


No 23 
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609.
Probab=52.96  E-value=24  Score=18.41  Aligned_cols=20  Identities=20%  Similarity=0.308  Sum_probs=17.7

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      ..|.+..++..||.|.+...
T Consensus        13 ~~~r~~l~~~~gd~~~i~~~   32 (43)
T TIGR01439        13 KEIREKLGLKEGDRLEVIRV   32 (43)
T ss_pred             HHHHHHcCcCCCCEEEEEEe
Confidence            58899999999999999865


No 24 
>PF14453 ThiS-like:  ThiS-like ubiquitin 
Probab=52.60  E-value=13  Score=22.04  Aligned_cols=16  Identities=25%  Similarity=0.370  Sum_probs=13.1

Q ss_pred             hhcCCCCCCEEEEEEc
Q 043432           84 KRYCLELGDYIMVYKD   99 (105)
Q Consensus        84 ~~k~L~~GD~i~f~~~   99 (105)
                      ....|++||.|+|.+.
T Consensus        41 ~d~~L~e~D~v~~Ikk   56 (57)
T PF14453_consen   41 EDIELKEGDEVFLIKK   56 (57)
T ss_pred             CccccCCCCEEEEEeC
Confidence            4667999999999763


No 25 
>PF01878 EVE:  EVE domain;  InterPro: IPR002740 The EVE domain is part of the wider PUA domain superfamily. The function of this domain is not known but, given the structural similarities to PUA, is likely to involve RNA binding []. ; PDB: 2G2X_B 2AR1_A 3EOP_A 2EVE_A 2HD9_A 2ZBN_A 1WMM_A 2P5D_A 2GBS_A 1ZCE_A.
Probab=51.48  E-value=10  Score=25.53  Aligned_cols=15  Identities=20%  Similarity=0.454  Sum_probs=10.7

Q ss_pred             cCCCCCCEEEEEEcC
Q 043432           86 YCLELGDYIMVYKDE  100 (105)
Q Consensus        86 k~L~~GD~i~f~~~~  100 (105)
                      +.+++||.|+||...
T Consensus        38 ~~mk~GD~vifY~s~   52 (143)
T PF01878_consen   38 KRMKPGDKVIFYHSG   52 (143)
T ss_dssp             HC--TT-EEEEEETS
T ss_pred             hcCCCCCEEEEEEcC
Confidence            499999999999976


No 26 
>PF07497 Rho_RNA_bind:  Rho termination factor, RNA-binding domain;  InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It is thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers [].; GO: 0003723 RNA binding, 0006353 transcription termination, DNA-dependent; PDB: 1A8V_B 1PVO_A 1PV4_D 3ICE_A 1XPU_C 1XPO_D 1XPR_F 2A8V_B 2HT1_B 1A63_A ....
Probab=50.95  E-value=11  Score=23.72  Aligned_cols=15  Identities=33%  Similarity=0.634  Sum_probs=11.0

Q ss_pred             HHHhhcCCCCCCEEE
Q 043432           81 AFIKRYCLELGDYIM   95 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~   95 (105)
                      .-+|..+|+.||.|.
T Consensus        36 ~qIrrf~LR~GD~V~   50 (78)
T PF07497_consen   36 SQIRRFGLRTGDLVE   50 (78)
T ss_dssp             CCCCCTT--TTEEEE
T ss_pred             HHHHHcCCCCCCEEE
Confidence            457899999999987


No 27 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=50.59  E-value=7.1  Score=23.69  Aligned_cols=20  Identities=15%  Similarity=0.134  Sum_probs=9.7

Q ss_pred             cChHHHHhhcCCCCCCEEEE
Q 043432           77 ENTRAFIKRYCLELGDYIMV   96 (105)
Q Consensus        77 ~gW~~fV~~k~L~~GD~i~f   96 (105)
                      .|=.+.-|.++|++||+|.|
T Consensus        38 NGe~e~rrg~Kl~~GD~V~~   57 (65)
T PF13275_consen   38 NGEVETRRGKKLRPGDVVEI   57 (65)
T ss_dssp             TTB----SS----SSEEEEE
T ss_pred             CCEEccccCCcCCCCCEEEE
Confidence            34566778899999999998


No 28 
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=50.48  E-value=21  Score=22.20  Aligned_cols=23  Identities=9%  Similarity=0.157  Sum_probs=17.1

Q ss_pred             HHHHhhcCCCCCCEEEEEEcCCC
Q 043432           80 RAFIKRYCLELGDYIMVYKDELE  102 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~~~  102 (105)
                      ...++..+++.||+|-+.|...+
T Consensus        41 DPv~r~~g~k~GdVvkI~R~S~t   63 (74)
T PF01191_consen   41 DPVARYLGAKPGDVVKIIRKSET   63 (74)
T ss_dssp             SHHHHHTT--TTSEEEEEEEETT
T ss_pred             ChhhhhcCCCCCCEEEEEecCCC
Confidence            46788889999999999996543


No 29 
>PF14604 SH3_9:  Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A ....
Probab=50.25  E-value=14  Score=20.58  Aligned_cols=19  Identities=26%  Similarity=0.454  Sum_probs=12.8

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +-.|++||.|.+....++|
T Consensus        12 ELs~~~Gd~i~v~~~~~~~   30 (49)
T PF14604_consen   12 ELSFKKGDVITVLEKSDDG   30 (49)
T ss_dssp             B-EB-TTEEEEEEEESSTS
T ss_pred             EeeEcCCCEEEEEEeCCCC
Confidence            4568999999998765443


No 30 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=49.87  E-value=31  Score=18.00  Aligned_cols=22  Identities=18%  Similarity=0.161  Sum_probs=16.4

Q ss_pred             CCEEEEEEECCCCeEEEEEEEEc
Q 043432           44 AGFWMHLEDMDFNKVWTFKFRFW   66 (105)
Q Consensus        44 ~~~~l~~~D~~~g~~W~fr~~~~   66 (105)
                      .|..+.+.|+. |..|+|.|--.
T Consensus         4 ~g~l~~~~~p~-G~~~~~~YD~~   25 (42)
T TIGR01643         4 AGRLTGSTDAD-GTTTRYTYDAA   25 (42)
T ss_pred             CCCEEEEECCC-CCEEEEEECCC
Confidence            45677888994 89999887543


No 31 
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=49.11  E-value=14  Score=24.72  Aligned_cols=19  Identities=32%  Similarity=0.209  Sum_probs=15.6

Q ss_pred             HHHHhhcCCCCCCEEEEEE
Q 043432           80 RAFIKRYCLELGDYIMVYK   98 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~   98 (105)
                      ...-+.++.+.||.|+|-.
T Consensus        26 l~d~krr~ik~GD~IiF~~   44 (111)
T COG4043          26 LADPKRRQIKPGDKIIFNG   44 (111)
T ss_pred             ecCHhhcCCCCCCEEEEcC
Confidence            4567788999999999963


No 32 
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=48.56  E-value=16  Score=22.07  Aligned_cols=20  Identities=10%  Similarity=0.137  Sum_probs=16.1

Q ss_pred             ChHHHHhhcCCCCCCEEEEE
Q 043432           78 NTRAFIKRYCLELGDYIMVY   97 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f~   97 (105)
                      |-.+=.++++.+.||+|.+.
T Consensus        44 Gv~~~L~~~G~~~GD~V~Ig   63 (69)
T TIGR03595        44 GVEDALRKAGAKDGDTVRIG   63 (69)
T ss_pred             CHHHHHHHcCCCCCCEEEEc
Confidence            34556789999999999875


No 33 
>COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism]
Probab=48.05  E-value=16  Score=22.72  Aligned_cols=19  Identities=21%  Similarity=0.223  Sum_probs=14.9

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +..|+.||+|.|+.-..+|
T Consensus        66 ~t~L~dGDeVa~~PPVsGG   84 (84)
T COG1977          66 DTPLKDGDEVAFFPPVSGG   84 (84)
T ss_pred             cccCCCCCEEEEeCCCCCC
Confidence            3568999999999866554


No 34 
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription]
Probab=48.05  E-value=29  Score=21.81  Aligned_cols=23  Identities=17%  Similarity=0.231  Sum_probs=19.0

Q ss_pred             HHHhhcCCCCCCEEEEEEcCCCC
Q 043432           81 AFIKRYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~~~g  103 (105)
                      ..-+..++++||.+.|+.+...|
T Consensus        21 eiR~~lgi~~Gd~lei~~~~~~~   43 (89)
T COG2002          21 EIREALGIKEGDVLEIIVDGDGG   43 (89)
T ss_pred             HHHHHhCCCCCCEEEEEEeCCCC
Confidence            55677899999999999987654


No 35 
>cd06555 ASCH_PF0470_like ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=46.80  E-value=16  Score=24.33  Aligned_cols=14  Identities=21%  Similarity=0.309  Sum_probs=11.9

Q ss_pred             cCCCCCCEEEEEEc
Q 043432           86 YCLELGDYIMVYKD   99 (105)
Q Consensus        86 k~L~~GD~i~f~~~   99 (105)
                      .++++||.|+|..-
T Consensus        30 ~~ikvGD~I~f~~~   43 (109)
T cd06555          30 QQIKVGDKILFNDL   43 (109)
T ss_pred             hcCCCCCEEEEEEc
Confidence            67999999999663


No 36 
>PF07076 DUF1344:  Protein of unknown function (DUF1344);  InterPro: IPR009780 This family consists of several short, hypothetical bacterial proteins of around 80 residues in length. Members of this family are found in Rhizobium, Agrobacterium and Brucella species. The function of this family is unknown.
Probab=46.26  E-value=25  Score=21.18  Aligned_cols=20  Identities=30%  Similarity=0.451  Sum_probs=16.8

Q ss_pred             hcCCCCCCEEEEEEcCCCCC
Q 043432           85 RYCLELGDYIMVYKDELEGS  104 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g~  104 (105)
                      --+|++|..|.++.+..+|+
T Consensus        35 ~~~L~~G~kV~V~yd~~~gk   54 (61)
T PF07076_consen   35 FDGLKPGMKVVVFYDEVDGK   54 (61)
T ss_pred             ccccCCCCEEEEEEEccCCc
Confidence            56899999999988887774


No 37 
>PRK06461 single-stranded DNA-binding protein; Reviewed
Probab=46.14  E-value=60  Score=21.75  Aligned_cols=33  Identities=15%  Similarity=0.244  Sum_probs=22.6

Q ss_pred             EEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCCCCCEEEEE
Q 043432           46 FWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVY   97 (105)
Q Consensus        46 ~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~   97 (105)
                      ..+.+.|. ||.   .+++.|.  .             .+..|++||+|.+.
T Consensus        42 ~~~~l~D~-TG~---I~~tlW~--~-------------~a~~l~~GdvV~I~   74 (129)
T PRK06461         42 SEAVVGDE-TGR---VKLTLWG--E-------------QAGSLKEGEVVEIE   74 (129)
T ss_pred             EEEEEECC-CCE---EEEEEeC--C-------------ccccCCCCCEEEEE
Confidence            35677888 675   6778883  2             12368889988875


No 38 
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=45.38  E-value=17  Score=21.25  Aligned_cols=14  Identities=29%  Similarity=0.423  Sum_probs=10.8

Q ss_pred             HhhcCCCCCCEEEE
Q 043432           83 IKRYCLELGDYIMV   96 (105)
Q Consensus        83 V~~k~L~~GD~i~f   96 (105)
                      ....+|++||+|+=
T Consensus        25 a~~~gl~~GD~I~~   38 (79)
T cd00989          25 AAKAGLKAGDRILA   38 (79)
T ss_pred             HHHcCCCCCCEEEE
Confidence            34578999999863


No 39 
>PRK01777 hypothetical protein; Validated
Probab=45.29  E-value=16  Score=23.63  Aligned_cols=14  Identities=29%  Similarity=0.515  Sum_probs=12.4

Q ss_pred             hcCCCCCCEEEEEE
Q 043432           85 RYCLELGDYIMVYK   98 (105)
Q Consensus        85 ~k~L~~GD~i~f~~   98 (105)
                      +.-|+.||.|.+|+
T Consensus        62 d~~L~dGDRVeIyr   75 (95)
T PRK01777         62 TDVLRDGDRVEIYR   75 (95)
T ss_pred             CCcCCCCCEEEEec
Confidence            55799999999998


No 40 
>PRK11347 antitoxin ChpS; Provisional
Probab=44.58  E-value=69  Score=20.10  Aligned_cols=35  Identities=14%  Similarity=0.276  Sum_probs=24.9

Q ss_pred             EEEEcCCCCCcceeecChHHHHhhcCCCCCCEEEEEEcC
Q 043432           62 KFRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        62 r~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +.+.|.|  |..-.|-  ..++++-+|.+||.|.+.-..
T Consensus         4 ~v~kwGN--S~~vriP--k~il~~l~l~~G~~v~i~v~~   38 (83)
T PRK11347          4 TIKRWGN--SAGMVIP--NIVMKELNLQPGQSVEAQVSN   38 (83)
T ss_pred             EEEEEcC--ceeEEeC--HHHHHHcCCCCCCEEEEEEEC
Confidence            4567844  5334444  489999999999999886543


No 41 
>PRK06488 sulfur carrier protein ThiS; Validated
Probab=43.21  E-value=28  Score=20.30  Aligned_cols=18  Identities=28%  Similarity=0.425  Sum_probs=14.5

Q ss_pred             cCCCCCCEEEEEEcCCCC
Q 043432           86 YCLELGDYIMVYKDELEG  103 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~~g  103 (105)
                      ..|+.||.|.|..-..+|
T Consensus        48 ~~L~dgD~Ieiv~~V~GG   65 (65)
T PRK06488         48 FVLHEGDRIEILSPMQGG   65 (65)
T ss_pred             cccCCCCEEEEEEeccCC
Confidence            469999999998866655


No 42 
>PRK06944 sulfur carrier protein ThiS; Provisional
Probab=42.79  E-value=28  Score=20.08  Aligned_cols=17  Identities=24%  Similarity=0.331  Sum_probs=13.9

Q ss_pred             CCCCCCEEEEEEcCCCC
Q 043432           87 CLELGDYIMVYKDELEG  103 (105)
Q Consensus        87 ~L~~GD~i~f~~~~~~g  103 (105)
                      -|+.||.|-++.-..+|
T Consensus        49 ~L~~gD~vei~~~v~GG   65 (65)
T PRK06944         49 ALAAGDRLDLVQPVAGG   65 (65)
T ss_pred             cCCCCCEEEEEeeccCC
Confidence            39999999999866655


No 43 
>cd04498 hPOT1_OB2 hPOT1_OB2: A subfamily of OB folds similar to the second OB fold (OB2) of human protection of telomeres 1 protein (hPOT1). POT1 proteins bind to the single-stranded (ss) 3-prime ends of the telomere. hPOT1 binds specifically to ss telomeric DNA repeats ending with the sequence GGTTAG. The hPOT1 monomer consists of two closely connected OB folds (OB1-OB2) which cooperate to bind telomeric ssDNA. OB1 makes more extensive contact with the ssDNA than OB2. OB2 protects the 3' end of the ssDNA. hPOT1 is implicated in telomere length regulation.
Probab=42.28  E-value=26  Score=23.85  Aligned_cols=16  Identities=31%  Similarity=0.704  Sum_probs=13.8

Q ss_pred             HHHHhhcCCCCCCEEEEE
Q 043432           80 RAFIKRYCLELGDYIMVY   97 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~   97 (105)
                      ..|+|+  |++||.|.++
T Consensus        71 ~~~ar~--lK~GdfV~L~   86 (123)
T cd04498          71 VELAKS--LKPGDFVRIY   86 (123)
T ss_pred             HHHHhh--CCCCCEEEEE
Confidence            578888  9999999885


No 44 
>PF05593 RHS_repeat:  RHS Repeat;  InterPro: IPR006530 These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin [, , ].
Probab=42.02  E-value=52  Score=17.12  Aligned_cols=21  Identities=10%  Similarity=0.132  Sum_probs=15.4

Q ss_pred             CCEEEEEEECCCCeEEEEEEEE
Q 043432           44 AGFWMHLEDMDFNKVWTFKFRF   65 (105)
Q Consensus        44 ~~~~l~~~D~~~g~~W~fr~~~   65 (105)
                      .|..+.+.|. .|.+|+|.|--
T Consensus         4 ~G~l~~~~d~-~G~~~~y~YD~   24 (38)
T PF05593_consen    4 NGRLTSVTDP-DGRTTRYTYDA   24 (38)
T ss_pred             CCCEEEEEcC-CCCEEEEEECC
Confidence            4567788899 48999777553


No 45 
>cd01756 PLAT_repeat PLAT/LH2 domain repeats of family of proteins with unknown function. In general, PLAT/LH2 consists of an eight stranded beta-barrel and it's proposed function is to mediate interaction with lipids or membrane bound proteins.
Probab=41.62  E-value=50  Score=21.60  Aligned_cols=48  Identities=10%  Similarity=0.079  Sum_probs=27.9

Q ss_pred             CCCCCCCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCC
Q 043432           18 SDVNAAGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNN   69 (105)
Q Consensus        18 SDv~~~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~   69 (105)
                      .|++...++.|=.+... .-|.-   .=-.|.|.|..+|+.|.|-|..|-..
T Consensus        59 ~~lG~l~~i~i~~d~~g-~~~~W---~~~~V~V~~~~~~~~~~F~~~~Wl~~  106 (120)
T cd01756          59 VDLGKLKKIRIGHDNSG-LGAGW---FLDKVEIREPGTGDEYTFPCNRWLDK  106 (120)
T ss_pred             cCCCCeEEEEEEECCCC-CCCCc---EEeEEEEEECCCceEEEEEeCCccCC
Confidence            56665555655543321 11110   00366788887789999998888543


No 46 
>PRK00809 hypothetical protein; Provisional
Probab=41.61  E-value=24  Score=24.39  Aligned_cols=18  Identities=22%  Similarity=0.593  Sum_probs=15.0

Q ss_pred             HHHhhcCCCCCCEEEEEEcC
Q 043432           81 AFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +++++  +++||.|+||-..
T Consensus        30 n~lr~--Mk~GD~v~fYhs~   47 (144)
T PRK00809         30 NTIEK--VKPGDKLIIYVSQ   47 (144)
T ss_pred             hHHhh--CCCCCEEEEEECC
Confidence            66666  9999999999865


No 47 
>smart00532 LIGANc Ligase N family.
Probab=41.41  E-value=29  Score=28.37  Aligned_cols=20  Identities=25%  Similarity=0.353  Sum_probs=18.6

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .+++++++|+.||.|.+.|.
T Consensus       355 ~~~i~~~~i~iGd~V~V~ra  374 (441)
T smart00532      355 EDEIEEKDIRIGDTVVVRKA  374 (441)
T ss_pred             HHHHHHcCCCCCCEEEEEEC
Confidence            68999999999999999985


No 48 
>PLN03111 DNA-directed RNA polymerase II subunit family protein; Provisional
Probab=41.35  E-value=35  Score=25.30  Aligned_cols=26  Identities=23%  Similarity=0.499  Sum_probs=20.9

Q ss_pred             HHHHhhcCCCCCCEEEEEEc-CCCCCC
Q 043432           80 RAFIKRYCLELGDYIMVYKD-ELEGSY  105 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~-~~~g~~  105 (105)
                      ...++..+|+.||+|-+.|. +-.|+|
T Consensus       173 DPvary~g~k~G~vvkI~R~S~taG~~  199 (206)
T PLN03111        173 DPIARYYGLKRGQVVKIIRPSETAGRY  199 (206)
T ss_pred             ChhhHhcCCCCCCEEEEEECCCCCCCc
Confidence            57788999999999999996 444554


No 49 
>PF14478 DUF4430:  Domain of unknown function (DUF4430); PDB: 3U7Z_B 2BB5_A.
Probab=41.31  E-value=10  Score=22.59  Aligned_cols=17  Identities=35%  Similarity=0.331  Sum_probs=10.2

Q ss_pred             HHHhhcCCCCCCEEEEE
Q 043432           81 AFIKRYCLELGDYIMVY   97 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~   97 (105)
                      .=+.+..|+.||.|+|+
T Consensus        52 ~ga~~~~l~~GD~i~~~   68 (68)
T PF14478_consen   52 VGAGSYKLKDGDKITWY   68 (68)
T ss_dssp             S-CCC-B--TTEEEEE-
T ss_pred             cCcceeEeCCCCEEEeC
Confidence            45677899999999985


No 50 
>PF11792 Baculo_LEF5_C:  Baculoviridae late expression factor 5 C-terminal domain;  InterPro: IPR021758  This C-terminal domain is likely to be a zinc-binding domain. 
Probab=41.13  E-value=5.7  Score=22.34  Aligned_cols=13  Identities=23%  Similarity=0.151  Sum_probs=10.3

Q ss_pred             HhhcCCCCCCEEE
Q 043432           83 IKRYCLELGDYIM   95 (105)
Q Consensus        83 V~~k~L~~GD~i~   95 (105)
                      +-+++|++||+.+
T Consensus        19 ~~E~Q~RAGDE~V   31 (43)
T PF11792_consen   19 TIEKQLRAGDEAV   31 (43)
T ss_pred             ehhhhhcccchHH
Confidence            5679999999753


No 51 
>PF09269 DUF1967:  Domain of unknown function (DUF1967);  InterPro: IPR015349 The Obg family comprises a group of ancient P-loop small G proteins (GTPases) belonging to the TRAFAC (for translation factors) class and can be subdivided into several distinct protein subfamilies []. OBG GTPases have been found in both prokaryotes and eukaryotes []. The structure of the OBG GTPase from Thermus thermophilus has been determined []. This entry represents a C-terminal domain found in certain OBG GTPases. This domain contains a four-stranded beta sheet and three alpha helices flanked by an additional beta strand. It is predominantly found in the bacterial GTP-binding protein Obg, and is functionally uncharacterised. ; GO: 0000166 nucleotide binding; PDB: 1UDX_A.
Probab=40.94  E-value=27  Score=21.08  Aligned_cols=20  Identities=10%  Similarity=0.155  Sum_probs=13.8

Q ss_pred             ChHHHHhhcCCCCCCEEEEE
Q 043432           78 NTRAFIKRYCLELGDYIMVY   97 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f~   97 (105)
                      |-.+-.++++.++||+|.+.
T Consensus        44 Gv~~~L~~~G~~~GD~V~Ig   63 (69)
T PF09269_consen   44 GVEKALRKAGAKEGDTVRIG   63 (69)
T ss_dssp             THHHHHHTTT--TT-EEEET
T ss_pred             CHHHHHHHcCCCCCCEEEEc
Confidence            55778889999999999873


No 52 
>cd01764 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Related Modifier1)  The Urm1 fold, like those of two closely related proteins MoaD (molybdopterin synthase) and ThiS (sulfur carrier protein), is similar to that of ubiquitin although there is little or no sequence similarity. The C-terminal glycines of Urm1 are conjugated to an E1-like protein Uba4 as part of a novel conjugation system in yeast.  The Urm1 fold is found only in eukaryotes.
Probab=40.59  E-value=26  Score=22.42  Aligned_cols=19  Identities=32%  Similarity=0.429  Sum_probs=15.2

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +..|+.||.|.|+.-..+|
T Consensus        76 ~t~L~dgD~v~i~P~v~GG   94 (94)
T cd01764          76 DYILEDGDHVVFISTLHGG   94 (94)
T ss_pred             ccCCCCcCEEEEECCCCCC
Confidence            4679999999999865554


No 53 
>PTZ00061 DNA-directed RNA polymerase; Provisional
Probab=40.17  E-value=36  Score=25.21  Aligned_cols=26  Identities=19%  Similarity=0.442  Sum_probs=20.5

Q ss_pred             HHHHhhcCCCCCCEEEEEEc-CCCCCC
Q 043432           80 RAFIKRYCLELGDYIMVYKD-ELEGSY  105 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~-~~~g~~  105 (105)
                      ...++..+|+.||+|-+.|. +-.|+|
T Consensus       172 DPvary~g~k~G~vvkI~R~S~taG~~  198 (205)
T PTZ00061        172 DPVARYFGLSKGQVVKIIRPSETAGRY  198 (205)
T ss_pred             ChhhHhcCCCCCCEEEEEECCCCCCcc
Confidence            57788899999999999985 444544


No 54 
>cd01752 PLAT_polycystin PLAT/LH2 domain of polycystin-1 like proteins.  Polycystins are a large family of membrane proteins composed of multiple domains, present in fish, invertebrates, mammals, and humans that are widely expressed in various cell types and whose biological functions remain poorly defined. In human, mutations in polycystin-1 (PKD1) and polycystin-2 (PKD2) have been shown to be the cause for autosomal dominant polycystic kidney disease (ADPKD).  The generally proposed function of PLAT/LH2 domains is to mediate interaction with lipids or membrane bound proteins.
Probab=40.08  E-value=38  Score=22.24  Aligned_cols=22  Identities=23%  Similarity=0.498  Sum_probs=17.9

Q ss_pred             EEEEEECCCCeEEEEEEEEcCC
Q 043432           47 WMHLEDMDFNKVWTFKFRFWPN   68 (105)
Q Consensus        47 ~l~~~D~~~g~~W~fr~~~~~~   68 (105)
                      .|.|.|..+++.|.|.|..|-.
T Consensus        84 ~V~V~~~~t~~~~~F~~~rWl~  105 (120)
T cd01752          84 RVIVRDLQTGKKWFFLCNDWLS  105 (120)
T ss_pred             EEEEEECCCCcEEEEEeCcEEC
Confidence            5678888788999999988854


No 55 
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=39.85  E-value=20  Score=24.16  Aligned_cols=15  Identities=13%  Similarity=0.204  Sum_probs=11.9

Q ss_pred             HhhcCCCCCCEEEEE
Q 043432           83 IKRYCLELGDYIMVY   97 (105)
Q Consensus        83 V~~k~L~~GD~i~f~   97 (105)
                      |....|++||.|.|-
T Consensus        72 v~~~~~qpGDlvff~   86 (134)
T TIGR02219        72 VPCDAAQPGDVLVFR   86 (134)
T ss_pred             cchhcCCCCCEEEEe
Confidence            455689999999775


No 56 
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=39.78  E-value=31  Score=19.94  Aligned_cols=18  Identities=22%  Similarity=0.231  Sum_probs=14.2

Q ss_pred             cCCCCCCEEEEEEcCCCC
Q 043432           86 YCLELGDYIMVYKDELEG  103 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~~g  103 (105)
                      .-|++||.|-++.-.++|
T Consensus        49 ~~l~~gD~vei~~~vgGG   66 (66)
T PRK05659         49 TALREGDVVEIVHALGGG   66 (66)
T ss_pred             ccCCCCCEEEEEEEecCC
Confidence            348999999998866655


No 57 
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein. ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria.  The ThiS fold, like those of two closely related proteins MoaD and Urm1, is similar to that of ubiquitin although there is little or no sequence similarity.
Probab=39.71  E-value=34  Score=19.91  Aligned_cols=17  Identities=29%  Similarity=0.225  Sum_probs=13.9

Q ss_pred             CCCCCCEEEEEEcCCCC
Q 043432           87 CLELGDYIMVYKDELEG  103 (105)
Q Consensus        87 ~L~~GD~i~f~~~~~~g  103 (105)
                      .|+.||.|.+..-.++|
T Consensus        49 ~L~~gD~V~ii~~v~GG   65 (65)
T cd00565          49 PLQDGDRIEIVTAVGGG   65 (65)
T ss_pred             ecCCCCEEEEEEeccCC
Confidence            59999999998866655


No 58 
>smart00326 SH3 Src homology 3 domains. Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
Probab=39.52  E-value=40  Score=17.82  Aligned_cols=18  Identities=22%  Similarity=0.364  Sum_probs=13.3

Q ss_pred             hcCCCCCCEEEEEEcCCC
Q 043432           85 RYCLELGDYIMVYKDELE  102 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~  102 (105)
                      +-.|++||.|.+.....+
T Consensus        18 ~l~~~~Gd~v~v~~~~~~   35 (58)
T smart00326       18 ELSFKKGDIITVLEKSDD   35 (58)
T ss_pred             CCCCCCCCEEEEEEcCCC
Confidence            346889999999876544


No 59 
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=39.15  E-value=34  Score=20.08  Aligned_cols=16  Identities=25%  Similarity=0.212  Sum_probs=13.6

Q ss_pred             CCCCCEEEEEEcCCCC
Q 043432           88 LELGDYIMVYKDELEG  103 (105)
Q Consensus        88 L~~GD~i~f~~~~~~g  103 (105)
                      |+.||.|-+..-.++|
T Consensus        50 L~~gD~ieIv~~VgGG   65 (65)
T PRK05863         50 LRDGARLEVVTAVQGG   65 (65)
T ss_pred             cCCCCEEEEEeeccCC
Confidence            9999999998876655


No 60 
>PRK14699 replication factor A; Provisional
Probab=38.93  E-value=1.5e+02  Score=24.64  Aligned_cols=36  Identities=19%  Similarity=0.349  Sum_probs=23.0

Q ss_pred             EEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCCCCCEEEE
Q 043432           47 WMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMV   96 (105)
Q Consensus        47 ~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f   96 (105)
                      .+.+.|. ||.   -+++.|  +..        .+.+.+-+|++||+|-+
T Consensus        97 ~~~iaDe-TG~---ir~tlW--~~~--------a~~~~~g~l~~GDvv~I  132 (484)
T PRK14699         97 NLIVGDE-TGK---IKLTLW--DNM--------ADLIKAGKIKAGQTLQI  132 (484)
T ss_pred             EEEEecC-CCe---EEEEEe--cCc--------cchhhhcCCCCCCEEEE
Confidence            3466777 673   566677  221        23455557999999987


No 61 
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=38.66  E-value=24  Score=21.13  Aligned_cols=13  Identities=31%  Similarity=0.396  Sum_probs=10.2

Q ss_pred             hhcCCCCCCEEEE
Q 043432           84 KRYCLELGDYIMV   96 (105)
Q Consensus        84 ~~k~L~~GD~i~f   96 (105)
                      ...+|++||+|+=
T Consensus        24 ~~aGL~~GDiI~~   36 (79)
T cd00991          24 ENAVLHTGDVIYS   36 (79)
T ss_pred             HhcCCCCCCEEEE
Confidence            4568999999873


No 62 
>smart00536 AXH domain in Ataxins and HMG containing proteins. unknown function
Probab=38.37  E-value=17  Score=24.65  Aligned_cols=26  Identities=12%  Similarity=0.198  Sum_probs=19.4

Q ss_pred             Ccceeec-ChHHH----------HhhcCCCCCCEEEE
Q 043432           71 GRMYIFE-NTRAF----------IKRYCLELGDYIMV   96 (105)
Q Consensus        71 s~~y~l~-gW~~f----------V~~k~L~~GD~i~f   96 (105)
                      -..||.. ||+.|          +....|++||++.-
T Consensus        76 HPfFV~gqGWsSc~P~lT~~~ygL~C~~L~vGDVCl~  112 (116)
T smart00536       76 HPFFVKGKGWSSCYPSLTVQLYGLPCCELQVGDVCLS  112 (116)
T ss_pred             CCeEEcCccccccChhhhhhhcCCcceecccCCEEec
Confidence            4567777 69877          45678999999864


No 63 
>cd01757 PLAT_RAB6IP1 PLAT/LH2 domain present in RAB6 interacting protein 1 (Rab6IP1)_like family. PLAT/LH2 domains consists of an eight stranded beta-barrel. In RabIP1 this domain may participate in lipid-mediated modulation of Rab6IP1's function via it's generally proposed function of mediating interaction with lipids or membrane bound proteins.
Probab=37.74  E-value=39  Score=22.51  Aligned_cols=21  Identities=10%  Similarity=0.308  Sum_probs=16.6

Q ss_pred             EEEEEECCCCeEEEEEEEEcC
Q 043432           47 WMHLEDMDFNKVWTFKFRFWP   67 (105)
Q Consensus        47 ~l~~~D~~~g~~W~fr~~~~~   67 (105)
                      .|.|.|..+|+.|.|-|-.|-
T Consensus        75 ~V~V~d~~t~~~~~FpC~rWL   95 (114)
T cd01757          75 YVMVRNEITGHTYKFPCGRWL   95 (114)
T ss_pred             EEEEEeCCCCCEEEEecCcee
Confidence            567788667899999888774


No 64 
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies.
Probab=37.52  E-value=45  Score=17.39  Aligned_cols=19  Identities=26%  Similarity=0.436  Sum_probs=13.9

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +-.|++||.|.+.....+|
T Consensus        15 ~l~~~~Gd~v~v~~~~~~~   33 (54)
T cd00174          15 ELSFKKGDIIEVLEKSDDG   33 (54)
T ss_pred             CCCCCCCCEEEEEEcCCCC
Confidence            4568899999998764443


No 65 
>smart00306 HintN Hint (Hedgehog/Intein) domain N-terminal region. Hedgehog/Intein domain, N-terminal region. Domain has been split to accommodate large insertions of endonucleases.
Probab=37.46  E-value=30  Score=20.96  Aligned_cols=15  Identities=33%  Similarity=0.649  Sum_probs=13.2

Q ss_pred             HHhhcCCCCCCEEEE
Q 043432           82 FIKRYCLELGDYIMV   96 (105)
Q Consensus        82 fV~~k~L~~GD~i~f   96 (105)
                      .+++..|++||.|.+
T Consensus        84 w~~a~~l~~gd~v~~   98 (100)
T smart00306       84 WVFASELKPGDYVLV   98 (100)
T ss_pred             EEEHHHCCCCCEEEe
Confidence            588999999999875


No 66 
>PRK11130 moaD molybdopterin synthase small subunit; Provisional
Probab=37.33  E-value=31  Score=21.04  Aligned_cols=19  Identities=21%  Similarity=0.209  Sum_probs=15.0

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +--|+.||.|.|+.-..+|
T Consensus        63 ~~~l~dgDeVai~PPVsGG   81 (81)
T PRK11130         63 DHPLTDGDEVAFFPPVTGG   81 (81)
T ss_pred             CCCCCCCCEEEEeCCCCCC
Confidence            4469999999999866554


No 67 
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain. CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain. CADPS is a calcium-dependent activator involved in secretion. It contains a central PH domain that binds to phosphoinositide 4,5  bisphosphate containing liposomes. However,  membrane association may also be mediated by binding to phosphatidlyserine via general electrostatic interactions. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=36.75  E-value=17  Score=24.49  Aligned_cols=17  Identities=18%  Similarity=0.253  Sum_probs=13.5

Q ss_pred             cCCCCCCEEEEEEcCCC
Q 043432           86 YCLELGDYIMVYKDELE  102 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~~  102 (105)
                      +.+++||.|.|--+.++
T Consensus        81 ~avkegd~~~fa~~de~   97 (117)
T cd01234          81 NAVKEGDELKFATDDEN   97 (117)
T ss_pred             heeccCcEEEEeccchH
Confidence            45899999999876654


No 68 
>PRK02268 hypothetical protein; Provisional
Probab=36.70  E-value=26  Score=24.38  Aligned_cols=13  Identities=31%  Similarity=0.677  Sum_probs=11.3

Q ss_pred             cCCCCCCEEEEEE
Q 043432           86 YCLELGDYIMVYK   98 (105)
Q Consensus        86 k~L~~GD~i~f~~   98 (105)
                      +++++||.|++|-
T Consensus        34 ~RmkpGD~ivyYs   46 (141)
T PRK02268         34 RRMKPGDWIIYYS   46 (141)
T ss_pred             hcCCCCCEEEEEe
Confidence            5679999999986


No 69 
>cd05829 Sortase_E Sortase E (SrtE) is a membrane transpeptidase found in gram-positive bacteria that cleaves surface proteins at a cell sorting motif and catalyzes a transpeptidation reaction in which the surface protein substrate is covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. The function of Sortase E is unknown. In two different sortase families, the N-terminus either functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring, or it contains a signal peptide only and the C-terminus serves as a membrane anchor. Most gram-positive bacteria contain more than one sortase and it is thought that the different sortases anchor different surface protein classes. The sortase domain is a modified beta-barrel flanked by two (SrtA) or three (SrtB) short alpha-helices.
Probab=36.46  E-value=42  Score=22.84  Aligned_cols=27  Identities=19%  Similarity=0.236  Sum_probs=21.1

Q ss_pred             cceeecC--hHH-----HHhhcCCCCCCEEEEEE
Q 043432           72 RMYIFEN--TRA-----FIKRYCLELGDYIMVYK   98 (105)
Q Consensus        72 ~~y~l~g--W~~-----fV~~k~L~~GD~i~f~~   98 (105)
                      +.++|.|  +..     |-+=..|++||.|.+..
T Consensus        50 Gn~viaGH~~~~g~~~~F~~L~~l~~GD~I~v~~   83 (144)
T cd05829          50 GTAVLAGHVDSRGGPAVFFRLGDLRKGDKVEVTR   83 (144)
T ss_pred             CCEEEEEecCCCCCChhhcchhcCCCCCEEEEEE
Confidence            4566664  443     88889999999999977


No 70 
>PF13180 PDZ_2:  PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C ....
Probab=36.42  E-value=21  Score=21.46  Aligned_cols=13  Identities=31%  Similarity=0.465  Sum_probs=9.2

Q ss_pred             HhhcCCCCCCEEE
Q 043432           83 IKRYCLELGDYIM   95 (105)
Q Consensus        83 V~~k~L~~GD~i~   95 (105)
                      +...+|++||+|+
T Consensus        27 A~~aGl~~GD~I~   39 (82)
T PF13180_consen   27 AAKAGLQPGDIIL   39 (82)
T ss_dssp             HHHTTS-TTEEEE
T ss_pred             HHHCCCCCCcEEE
Confidence            3456799999986


No 71 
>TIGR01683 thiS thiamine biosynthesis protein ThiS. This model represents ThiS, a small thiamine-biosynthesis protein related to MoaD, a molybdenum cofactor biosynthesis protein. Both proteins are involved in sulfur transfer. ThiS has a conserved Gly-Gly C-terminus that is modified, in reactions requiring ThiI, ThiF, IscS, and a sulfur atom from Cys, into the thiocarboxylate that provides the sulfur for thiazole biosynthesis.
Probab=36.14  E-value=41  Score=19.49  Aligned_cols=17  Identities=29%  Similarity=0.196  Sum_probs=14.0

Q ss_pred             CCCCCCEEEEEEcCCCC
Q 043432           87 CLELGDYIMVYKDELEG  103 (105)
Q Consensus        87 ~L~~GD~i~f~~~~~~g  103 (105)
                      .|+.||.|.++.-.++|
T Consensus        48 ~L~~gD~veii~~V~GG   64 (64)
T TIGR01683        48 ILKEGDRIEIVTFVGGG   64 (64)
T ss_pred             ecCCCCEEEEEEeccCC
Confidence            59999999998866655


No 72 
>PRK08053 sulfur carrier protein ThiS; Provisional
Probab=36.03  E-value=41  Score=19.72  Aligned_cols=17  Identities=24%  Similarity=0.436  Sum_probs=13.9

Q ss_pred             CCCCCCEEEEEEcCCCC
Q 043432           87 CLELGDYIMVYKDELEG  103 (105)
Q Consensus        87 ~L~~GD~i~f~~~~~~g  103 (105)
                      .|++||.|.+..-.++|
T Consensus        50 ~L~~gD~Ieii~~v~GG   66 (66)
T PRK08053         50 IVQDGDQILLFQVIAGG   66 (66)
T ss_pred             ccCCCCEEEEEEEccCC
Confidence            49999999998866655


No 73 
>PF01568 Molydop_binding:  Molydopterin dinucleotide binding domain;  InterPro: IPR006657 A domain in this entry corresponds to the C-terminal domain IV in dimethyl sulphoxide (DMSO)reductase which interacts with the 2-amino pyrimidone ring of both molybdopterin guanine dinucleotide molecules [].; GO: 0016491 oxidoreductase activity, 0030151 molybdenum ion binding, 0055114 oxidation-reduction process; PDB: 2IVF_A 1OGY_G 3ML1_A 3O5A_A 1TI2_G 1VLE_M 1VLD_U 1VLF_O 1TI4_I 1TI6_E ....
Probab=35.94  E-value=32  Score=21.55  Aligned_cols=19  Identities=16%  Similarity=0.225  Sum_probs=13.8

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=+++.+|+.||.|.++-.
T Consensus        37 ~dA~~~Gi~~Gd~V~v~s~   55 (110)
T PF01568_consen   37 EDAAKLGIKDGDWVRVSSP   55 (110)
T ss_dssp             HHHHHCT--TTCEEEEEET
T ss_pred             HHHHHhcCcCCCEEEEEec
Confidence            5577889999999999754


No 74 
>PRK06437 hypothetical protein; Provisional
Probab=35.72  E-value=40  Score=20.03  Aligned_cols=20  Identities=10%  Similarity=0.102  Sum_probs=15.5

Q ss_pred             hhcCCCCCCEEEEEEcCCCC
Q 043432           84 KRYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        84 ~~k~L~~GD~i~f~~~~~~g  103 (105)
                      .+.-|++||.|.+.+-.++|
T Consensus        48 ~~~~L~dgD~Veiv~~V~GG   67 (67)
T PRK06437         48 EDHNVKKEDDVLILEVFSGG   67 (67)
T ss_pred             CceEcCCCCEEEEEecccCC
Confidence            45578999999998866655


No 75 
>PF03658 Ub-RnfH:  RnfH family Ubiquitin;  InterPro: IPR005346 This is a small family of proteins of unknown function.; PDB: 2HJ1_B.
Probab=35.69  E-value=25  Score=22.37  Aligned_cols=14  Identities=29%  Similarity=0.534  Sum_probs=8.0

Q ss_pred             hcCCCCCCEEEEEE
Q 043432           85 RYCLELGDYIMVYK   98 (105)
Q Consensus        85 ~k~L~~GD~i~f~~   98 (105)
                      +.-|++||.|-+||
T Consensus        59 d~~L~~GDRVEIYR   72 (84)
T PF03658_consen   59 DTVLRDGDRVEIYR   72 (84)
T ss_dssp             T-B--TT-EEEEE-
T ss_pred             CCcCCCCCEEEEec
Confidence            45689999999998


No 76 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=35.26  E-value=33  Score=22.97  Aligned_cols=14  Identities=36%  Similarity=0.527  Sum_probs=12.1

Q ss_pred             cCCCCCCEEEEEEc
Q 043432           86 YCLELGDYIMVYKD   99 (105)
Q Consensus        86 k~L~~GD~i~f~~~   99 (105)
                      +-|+.||.|++.++
T Consensus        49 ~~L~dGDsV~liKD   62 (109)
T TIGR00686        49 NLLANGDSVILIKD   62 (109)
T ss_pred             CCccCCCEEEEEee
Confidence            46899999999886


No 77 
>PF00018 SH3_1:  SH3 domain;  InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. The crystal structure of the SH3 domain of the cytoskeletal protein spectrin, and the solution structures of SH3 domains of phospholipase C (PLC-y) and phosphatidylinositol 3-kinase p85 alpha-subunit, have been determined [, , ]. In spite of relatively limited sequence similarity, their overall structures are similar. The domains belong to the alpha+beta structural class, with 5 to 8 beta-strands forming 2 tightly-packed, anti-parallel beta-sheets arranged in a barrel-like structure, and intervening loops sometimes forming helices. Conserved aliphatic and aromatic residues form a hydrophobic core (A11, L23, A29, V34, W42, L52 and V59 in PLC-y []) and a hydrophobic pocket on the molecular surface (L12, F13, W53 and P55 in PLC-y). The conserved core is believed to stabilise the fold, while the pocket is thought to serve as a binding site for target proteins. Conserved carboxylic amino acids located in the loops, on the periphery of the pocket (D14 and E22), may be involved in protein-protein interactions via proline-rich regions. The N- and C-termini are packed in close proximity, indicating that they are independent structural modules.; GO: 0005515 protein binding; PDB: 1UHF_A 1W1F_A 1WA7_A 1SEM_A 1KFZ_A 2SEM_B 1K76_A 3SEM_B 1X2Q_A 2J06_B ....
Probab=34.39  E-value=35  Score=18.45  Aligned_cols=18  Identities=22%  Similarity=0.338  Sum_probs=12.8

Q ss_pred             hcCCCCCCEEEEEEcCCC
Q 043432           85 RYCLELGDYIMVYKDELE  102 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~  102 (105)
                      +-.+++||.|.+....++
T Consensus        13 eLs~~~Gd~i~v~~~~~~   30 (48)
T PF00018_consen   13 ELSFKKGDIIEVLEKSDD   30 (48)
T ss_dssp             BSEB-TTEEEEEEEESSS
T ss_pred             EEeEECCCEEEEEEecCC
Confidence            446889999999886554


No 78 
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(pos
Probab=34.36  E-value=33  Score=19.48  Aligned_cols=13  Identities=38%  Similarity=0.598  Sum_probs=10.3

Q ss_pred             hhcCCCCCCEEEE
Q 043432           84 KRYCLELGDYIMV   96 (105)
Q Consensus        84 ~~k~L~~GD~i~f   96 (105)
                      ...+|++||.|+=
T Consensus        27 ~~~gl~~GD~I~~   39 (70)
T cd00136          27 ERAGLQAGDVILA   39 (70)
T ss_pred             HHcCCCCCCEEEE
Confidence            3468999999873


No 79 
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=33.67  E-value=52  Score=20.85  Aligned_cols=21  Identities=14%  Similarity=0.207  Sum_probs=17.8

Q ss_pred             HHHhhcCCCCCCEEEEEEcCC
Q 043432           81 AFIKRYCLELGDYIMVYKDEL  101 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~~  101 (105)
                      ..++.-+.+.||+|-+.|...
T Consensus        48 Pva~~lgak~GdvVkIvRkS~   68 (80)
T COG2012          48 PVAKALGAKPGDVVKIVRKSP   68 (80)
T ss_pred             hhHHHccCCCCcEEEEEecCC
Confidence            568888999999999999754


No 80 
>PRK08364 sulfur carrier protein ThiS; Provisional
Probab=33.15  E-value=42  Score=20.01  Aligned_cols=19  Identities=26%  Similarity=0.247  Sum_probs=15.1

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +..|++||.|.|.+-.++|
T Consensus        52 ~~~l~~gD~Veii~~V~GG   70 (70)
T PRK08364         52 DDPVKDGDYVEVIPVVSGG   70 (70)
T ss_pred             CcCcCCCCEEEEEccccCC
Confidence            5569999999999876655


No 81 
>PF08922 DUF1905:  Domain of unknown function (DUF1905);  InterPro: IPR015018 This family consist of hypothetical bacterial proteins. ; PDB: 2D9R_A.
Probab=33.07  E-value=1.2e+02  Score=18.62  Aligned_cols=79  Identities=19%  Similarity=0.154  Sum_probs=39.1

Q ss_pred             EEEecccCCCCCCCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCCC
Q 043432           11 FEKQLKNSDVNAAGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLEL   90 (105)
Q Consensus        11 f~K~LT~SDv~~~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~   90 (105)
                      |+.+|-+++-+ -.-+.||.+.++.+-..  +...+.|.+. . .|..|+-  +..+.+ ...|+|-==.+.-++-++.+
T Consensus         1 F~a~l~~~~~~-~~fv~vP~~v~~~l~~~--~~g~v~V~~t-I-~g~~~~~--sl~p~g-~G~~~Lpv~~~vRk~~g~~~   72 (80)
T PF08922_consen    1 FTATLWKGEGG-WTFVEVPFDVAEELGEG--GWGRVPVRGT-I-DGHPWRT--SLFPMG-NGGYILPVKAAVRKAIGKEA   72 (80)
T ss_dssp             EEEE-EE-TTS--EEEE--S-HHHHH--S----S-EEEEEE-E-TTEEEEE--EEEESS-TT-EEEEE-HHHHHHHT--T
T ss_pred             CeEEEEecCCc-eEEEEeCHHHHHHhccc--cCCceEEEEE-E-CCEEEEE--EEEECC-CCCEEEEEcHHHHHHcCCCC
Confidence            45555555432 23477998888765333  1233555555 3 2565555  555422 34476662267888999999


Q ss_pred             CCEEEEE
Q 043432           91 GDYIMVY   97 (105)
Q Consensus        91 GD~i~f~   97 (105)
                      ||.|.+.
T Consensus        73 Gd~V~v~   79 (80)
T PF08922_consen   73 GDTVEVT   79 (80)
T ss_dssp             TSEEEEE
T ss_pred             CCEEEEE
Confidence            9999763


No 82 
>PTZ00194 60S ribosomal protein L26; Provisional
Probab=32.96  E-value=31  Score=24.16  Aligned_cols=23  Identities=17%  Similarity=0.291  Sum_probs=18.3

Q ss_pred             HHhhcCCCCCCEEEEEEcCCCCC
Q 043432           82 FIKRYCLELGDYIMVYKDELEGS  104 (105)
Q Consensus        82 fV~~k~L~~GD~i~f~~~~~~g~  104 (105)
                      -+|+..++.||.|.+......|+
T Consensus        41 ~~Rs~~IkkGD~V~Vi~Gk~KGk   63 (143)
T PTZ00194         41 NVRSMPVRKDDEVMVVRGHHKGR   63 (143)
T ss_pred             CCccceeecCCEEEEecCCCCCC
Confidence            45666899999999998777664


No 83 
>PRK06033 hypothetical protein; Validated
Probab=32.85  E-value=33  Score=21.51  Aligned_cols=15  Identities=13%  Similarity=0.058  Sum_probs=11.6

Q ss_pred             hhcCCCCCCEEEEEE
Q 043432           84 KRYCLELGDYIMVYK   98 (105)
Q Consensus        84 ~~k~L~~GD~i~f~~   98 (105)
                      .=-+|++||+|.|-+
T Consensus        24 dlL~L~~GDVI~L~~   38 (83)
T PRK06033         24 QVLRMGRGAVIPLDA   38 (83)
T ss_pred             HHhCCCCCCEEEeCC
Confidence            335799999999854


No 84 
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand is presumed to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=32.82  E-value=34  Score=20.04  Aligned_cols=13  Identities=23%  Similarity=0.312  Sum_probs=10.2

Q ss_pred             HhhcCCCCCCEEE
Q 043432           83 IKRYCLELGDYIM   95 (105)
Q Consensus        83 V~~k~L~~GD~i~   95 (105)
                      ....+|++||+|+
T Consensus        25 a~~aGl~~GD~I~   37 (80)
T cd00990          25 ADKAGLVAGDELV   37 (80)
T ss_pred             HHHhCCCCCCEEE
Confidence            3456899999986


No 85 
>PF11604 CusF_Ec:  Copper binding periplasmic protein CusF;  InterPro: IPR021647  CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil. CusF forms a five-stranded beta-barrel OB fold. Cu(I) binds to H36, M47 and M49 which are conserved residues in the protein []. ; PDB: 2L55_A 2VB3_X 1ZEQ_X 2QCP_X 3E6Z_X 2VB2_X.
Probab=32.67  E-value=31  Score=20.75  Aligned_cols=17  Identities=18%  Similarity=0.112  Sum_probs=10.9

Q ss_pred             hhcCCCCCCEEEEEEcC
Q 043432           84 KRYCLELGDYIMVYKDE  100 (105)
Q Consensus        84 ~~k~L~~GD~i~f~~~~  100 (105)
                      --.+|++||.|.|.-..
T Consensus        39 ~l~~l~~Gd~V~F~~~~   55 (70)
T PF11604_consen   39 DLAGLKPGDKVRFTFER   55 (70)
T ss_dssp             EESS-STT-EEEEEEEE
T ss_pred             hhhcCCCCCEEEEEEEE
Confidence            34679999999996543


No 86 
>PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed
Probab=32.38  E-value=47  Score=28.14  Aligned_cols=22  Identities=14%  Similarity=0.203  Sum_probs=19.7

Q ss_pred             ChHHHHhhcCCCCCCEEEEEEc
Q 043432           78 NTRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f~~~   99 (105)
                      +..+++++++|+.||.|.+.|.
T Consensus       350 hN~~~i~~~~I~iGD~V~V~ra  371 (562)
T PRK08097        350 GSVRRWQQWDIAPGDQVLVSLA  371 (562)
T ss_pred             CCHHHHHHcCCCCCCEEEEEec
Confidence            4579999999999999999985


No 87 
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage.
Probab=32.35  E-value=33  Score=19.56  Aligned_cols=12  Identities=33%  Similarity=0.235  Sum_probs=9.8

Q ss_pred             hcCCCCCCEEEE
Q 043432           85 RYCLELGDYIMV   96 (105)
Q Consensus        85 ~k~L~~GD~i~f   96 (105)
                      +..|++||.|.+
T Consensus        47 ~~~l~~Gd~v~i   58 (59)
T TIGR02988        47 GKKLYPGDVIEI   58 (59)
T ss_pred             CCCCCCCCEEEe
Confidence            567899999876


No 88 
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair]
Probab=32.21  E-value=25  Score=21.87  Aligned_cols=16  Identities=19%  Similarity=0.148  Sum_probs=12.5

Q ss_pred             HHHhhcCCCCCCEEEE
Q 043432           81 AFIKRYCLELGDYIMV   96 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f   96 (105)
                      +=-|.++|+.||.|.|
T Consensus        46 EtRRgkKlr~gd~V~i   61 (73)
T COG2501          46 ETRRGKKLRDGDVVEI   61 (73)
T ss_pred             eeccCCEeecCCEEEE
Confidence            3346788999999987


No 89 
>PF02298 Cu_bind_like:  Plastocyanin-like domain;  InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]. The most well known members of this class of proteins are the plant chloroplastic plastocyanins, which exchange electrons with cytochrome c6, and the distantly related bacterial azurins, which exchange electrons with cytochrome c551. This family of proteins also includes amicyanin from bacteria such as Methylobacterium extorquens or Paracoccus versutus (Thiobacillus versutus) that can grow on methylamine; auracyanins A and B from Chloroflexus aurantiacus []; blue copper protein from Alcaligenes faecalis; cupredoxin (CPC) from Cucumis sativus (Cucumber) peelings []; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from Natronomonas pharaonis (Natronobacterium pharaonis) [], a membrane associated copper-binding protein; pseudoazurin from Pseudomonas; rusticyanin from Thiobacillus ferrooxidans []; stellacyanin from Rhus vernicifera (Japanese lacquer tree); umecyanin from the roots of Armoracia rusticana (Horseradish); and allergen Ra3 from ragweed. Although there is an appreciable amount of divergence in the sequences of all these proteins, the copper ligand sites are conserved. This domain is found in a variety of plant cyanins and pollern allergen. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Amb a 3.; GO: 0005507 copper ion binding, 0009055 electron carrier activity; PDB: 1JER_A 1WS7_A 1WS8_D 1F56_B 1X9R_B 1X9U_A 2CBP_A.
Probab=31.95  E-value=30  Score=21.58  Aligned_cols=21  Identities=14%  Similarity=0.292  Sum_probs=14.7

Q ss_pred             HHHHhhcCCCCCCEEEEEEcC
Q 043432           80 RAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      ...+..+..++||+++|-.+.
T Consensus        11 ~~Wa~~~~F~vGD~LvF~y~~   31 (85)
T PF02298_consen   11 TDWASGKTFRVGDTLVFNYDS   31 (85)
T ss_dssp             HHHHCTS-BETTEEEEEE--T
T ss_pred             hHhhcCCcEeCCCEEEEEecC
Confidence            455678899999999996654


No 90 
>PF03831 PhnA:  PhnA protein;  InterPro: IPR013988 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the C-terminal domain of PhnA.; PDB: 2AKK_A 2AKL_A.
Probab=31.57  E-value=14  Score=21.88  Aligned_cols=15  Identities=33%  Similarity=0.383  Sum_probs=9.2

Q ss_pred             hcCCCCCCEEEEEEc
Q 043432           85 RYCLELGDYIMVYKD   99 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~   99 (105)
                      -+-|+.||.|++.++
T Consensus         7 Gn~L~dGDsV~~iKD   21 (56)
T PF03831_consen    7 GNELQDGDSVTLIKD   21 (56)
T ss_dssp             S-B--TTEEEEESS-
T ss_pred             CCCccCCCEEEEEee
Confidence            356899999999775


No 91 
>PF07680 DoxA:  TQO small subunit DoxA;  InterPro: IPR011636 Thiosulphate:quinone oxidoreductase (TQO) catalyses one of the early steps in elemental sulphur oxidation. A novel TQO enzyme was purified from the thermo-acidophilic archaeon Acidianus ambivalens and shown to consist of a large subunit (DoxD) and a smaller subunit (DoxA). The DoxD- and DoxA-like two subunits are fused together in a single polypeptide in Q8AAF0 from SWISSPROT.
Probab=31.46  E-value=71  Score=22.05  Aligned_cols=40  Identities=20%  Similarity=0.351  Sum_probs=26.4

Q ss_pred             CcEEeehhh-hhccCCCCC--CCCCEEEEEEECCCCeEEEEEEE
Q 043432           24 GRIVLPKKL-AETYLPPVN--EKAGFWMHLEDMDFNKVWTFKFR   64 (105)
Q Consensus        24 ~rl~iPk~~-ae~~lP~l~--~~~~~~l~~~D~~~g~~W~fr~~   64 (105)
                      -.|++|--. |.-.||...  ......|.+.|+. |..|.-..+
T Consensus        90 ~gl~vpLGakA~i~L~~~~~l~~g~Y~l~L~dis-G~~w~~~~~  132 (133)
T PF07680_consen   90 HGLVVPLGAKATITLPLPDHLPPGTYTLKLYDIS-GITWSAGIT  132 (133)
T ss_pred             eeEEEEcCCcEEEEecCCCccCCCcEEEEEEcCC-CCeeeeccc
Confidence            378999644 333454421  3455889999994 999986654


No 92 
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated
Probab=31.29  E-value=38  Score=23.01  Aligned_cols=23  Identities=22%  Similarity=0.408  Sum_probs=18.6

Q ss_pred             HHhhcCCCCCCEEEEEEcCCCCC
Q 043432           82 FIKRYCLELGDYIMVYKDELEGS  104 (105)
Q Consensus        82 fV~~k~L~~GD~i~f~~~~~~g~  104 (105)
                      -+++-.++.||.|.+......|+
T Consensus        40 ~ir~~~IkkGD~V~VisG~~KGk   62 (120)
T PRK01191         40 GIRSLPVRKGDTVKVMRGDFKGE   62 (120)
T ss_pred             CCccceEeCCCEEEEeecCCCCc
Confidence            46667899999999998877664


No 93 
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated
Probab=31.24  E-value=51  Score=28.40  Aligned_cols=20  Identities=25%  Similarity=0.399  Sum_probs=18.4

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .+++++++|+.||.|.+.|.
T Consensus       360 ~~~i~~~~i~iGD~V~V~ra  379 (665)
T PRK07956        360 ADEIERKDIRIGDTVVVRRA  379 (665)
T ss_pred             HHHHHHcCCCCCCEEEEEEC
Confidence            58999999999999999985


No 94 
>PF01477 PLAT:  PLAT/LH2 domain;  InterPro: IPR001024 Lipoxygenases (1.13.11.- from EC) are a class of iron-containing dioxygenases which catalyses the hydroperoxidation of lipids, containing a cis,cis-1,4-pentadiene structure. They are common in plants where they may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. In mammals a number of lipoxygenases isozymes are involved in the metabolism of prostaglandins and leukotrienes []. Sequence data is available for the following lipoxygenases:    Plant lipoxygenases (1.13.11.12 from EC, IPR001246 from INTERPRO). Plants express a variety of cytosolic isozymes as well as what seems to be a chloroplast isozyme []. Mammalian arachidonate 5-lipoxygenase (1.13.11.34 from EC, IPR001885 from INTERPRO). Mammalian arachidonate 12-lipoxygenase (1.13.11.31 from EC, IPR001885 from INTERPRO). Mammalian erythroid cell-specific 15-lipoxygenase (1.13.11.33 from EC, IPR001885 from INTERPRO).   The iron atom in lipoxygenases is bound by four ligands, three of which are histidine residues []. Six histidines are conserved in all lipoxygenase sequences, five of them are found clustered in a stretch of 40 amino acids. This region contains two of the three iron-ligands; the other histidines have been shown [] to be important for the activity of lipoxygenases. This entry represents a domain found in lipoxygenases and other enzymes. It is known as the PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology) domain, is found in a variety of membrane or lipid associated proteins. Structurally, this domain forms a beta-sandwich composed of two sheets of four strands each [, , ]. The most highly conserved regions coincide with the beta-strands, with most of the highly conserved residues being buried within the protein. An exception to this is a surface lysine or arginine that occurs on the surface of the fifth beta-strand of the eukaryotic domains. In pancreatic lipase, the lysine in this position forms a salt bridge with the procolipase protein. The conservation of a charged surface residue may indicate the location of a conserved ligand-binding site. It is thought that this domain may mediate membrane attachment via other protein binding partners.; GO: 0005515 protein binding; PDB: 3FG3_D 3FG1_C 3FG4_D 3DY5_A 2FNQ_B 3O8Y_B 3V99_B 3V92_A 3V98_B 1HPL_A ....
Probab=31.03  E-value=1.1e+02  Score=19.04  Aligned_cols=24  Identities=17%  Similarity=0.348  Sum_probs=18.6

Q ss_pred             EEEEEECCCCeEEEEEEEEcCCCC
Q 043432           47 WMHLEDMDFNKVWTFKFRFWPNNR   70 (105)
Q Consensus        47 ~l~~~D~~~g~~W~fr~~~~~~~~   70 (105)
                      .|.|.+..+++.|.|.|.-|-...
T Consensus        80 ~V~V~~~~~~~~~~F~~~~Wl~~~  103 (113)
T PF01477_consen   80 SVVVTDGETGRTYTFPCNRWLDPD  103 (113)
T ss_dssp             EEEEEETTTSEEEEEEEEEEESTT
T ss_pred             EEEEEeCCCCcEEEEEcCCEECCC
Confidence            567788667899999999986543


No 95 
>PF07591 PT-HINT:  Pretoxin HINT domain;  InterPro: IPR011451 This entry represents a cluster of homologous proteins identified in Leptospira interrogans. One member (Q8EZX6 from SWISSPROT) has been predicted to be a phenazine biosynthesis family protein.; PDB: 2JNQ_A 2JMZ_A.
Probab=31.02  E-value=22  Score=23.91  Aligned_cols=16  Identities=19%  Similarity=0.501  Sum_probs=10.4

Q ss_pred             HHHhhcCCCCCCEEEE
Q 043432           81 AFIKRYCLELGDYIMV   96 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f   96 (105)
                      .+|++..|++||.+.-
T Consensus        70 gWv~A~~L~~GD~L~~   85 (130)
T PF07591_consen   70 GWVEAEDLKVGDRLLT   85 (130)
T ss_dssp             --EEGGG--TTSEEEE
T ss_pred             hhhhHhhCCCCCEEEc
Confidence            5799999999999753


No 96 
>PF10377 ATG11:  Autophagy-related protein 11;  InterPro: IPR019460  This family consists of proteins involved in telomere maintenance. In Schizosaccharomyces pombe (fission yeast) this protein is called Taf1 (taz1 interacting factor) and is part of the telomere cap complex. In Saccharomyces cerevisiae (baker's yeast) this protein is called ATG11 and is known to be involved in vacuolar targeting and peroxisome degradation [, ]. 
Probab=30.81  E-value=53  Score=22.25  Aligned_cols=22  Identities=14%  Similarity=0.220  Sum_probs=16.9

Q ss_pred             HHhhcCCCCCCEEEEEEcCCCC
Q 043432           82 FIKRYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        82 fV~~k~L~~GD~i~f~~~~~~g  103 (105)
                      =+.-++.++||.+.|.++..+.
T Consensus        37 kIs~~~f~~GDlvLflpt~~~~   58 (129)
T PF10377_consen   37 KISFRNFQVGDLVLFLPTRNHN   58 (129)
T ss_pred             cEEEecCCCCCEEEEEecCCCC
Confidence            3445678999999999986654


No 97 
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=30.80  E-value=41  Score=21.05  Aligned_cols=16  Identities=25%  Similarity=0.123  Sum_probs=9.6

Q ss_pred             cCCCCCCEEEEEEcCC
Q 043432           86 YCLELGDYIMVYKDEL  101 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~  101 (105)
                      .+|++||.|.|.-+.+
T Consensus        41 ~~L~pGq~l~f~~d~~   56 (85)
T PF04225_consen   41 TRLKPGQTLEFQLDED   56 (85)
T ss_dssp             GG--TT-EEEEEE-TT
T ss_pred             hhCCCCCEEEEEECCC
Confidence            3689999999998753


No 98 
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.
Probab=30.61  E-value=39  Score=19.64  Aligned_cols=15  Identities=33%  Similarity=0.414  Sum_probs=11.4

Q ss_pred             HhhcCCCCCCEEEEE
Q 043432           83 IKRYCLELGDYIMVY   97 (105)
Q Consensus        83 V~~k~L~~GD~i~f~   97 (105)
                      +...+|++||.|+=.
T Consensus        39 a~~~gl~~GD~I~~i   53 (82)
T cd00992          39 AERGGLRVGDRILEV   53 (82)
T ss_pred             HHhCCCCCCCEEEEE
Confidence            445799999998743


No 99 
>PF11948 DUF3465:  Protein of unknown function (DUF3465);  InterPro: IPR021856  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 131 to 151 amino acids in length. This protein has a conserved HWTH sequence motif. 
Probab=30.05  E-value=41  Score=23.26  Aligned_cols=53  Identities=17%  Similarity=0.162  Sum_probs=27.7

Q ss_pred             CCCEEEEEE-ECCCCeEEEEEEEEcCCCCCcceeecChHHH-HhhcCCCCCCEEEEE
Q 043432           43 KAGFWMHLE-DMDFNKVWTFKFRFWPNNRGRMYIFENTRAF-IKRYCLELGDYIMVY   97 (105)
Q Consensus        43 ~~~~~l~~~-D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~f-V~~k~L~~GD~i~f~   97 (105)
                      ..|..+.+. |...|.. +-+|..+-.+.....+-.+ .+. =+-..|++||.|.|+
T Consensus        41 g~G~V~~vLpdd~~Gsr-HQ~Fiv~l~~g~tllIahN-IDlaprip~l~~GD~V~f~   95 (131)
T PF11948_consen   41 GCGTVVKVLPDDNKGSR-HQRFIVRLSSGQTLLIAHN-IDLAPRIPWLQKGDQVEFY   95 (131)
T ss_pred             ccEEEEEECcccCCCCc-ceEEEEEeCCCCEEEEEec-cCccccCcCcCCCCEEEEE
Confidence            355555553 3223554 6677766433322222113 222 344569999999995


No 100
>TIGR00638 Mop molybdenum-pterin binding domain. This model describes a multigene family of molybdenum-pterin binding proteins of about 70 amino acids in Clostridium pasteurianum, as a tandemly-repeated domain C-terminal to an unrelated domain in ModE, a molybdate transport gene repressor of E. coli, and in single or tandemly paired domains in several related proteins.
Probab=30.00  E-value=63  Score=18.42  Aligned_cols=21  Identities=10%  Similarity=0.061  Sum_probs=17.1

Q ss_pred             HHHHhhcCCCCCCEEEEEEcC
Q 043432           80 RAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      ..=+.+-+|++||.|.++...
T Consensus        41 ~~~~~~l~l~~G~~v~~~ik~   61 (69)
T TIGR00638        41 LESVAELGLKPGKEVYAVIKA   61 (69)
T ss_pred             HHHHhhCCCCCCCEEEEEEEC
Confidence            466788999999999987754


No 101
>PF08797 HIRAN:  HIRAN domain;  InterPro: IPR014905 The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes []. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides; PDB: 2L1I_A 3K2Y_C.
Probab=29.96  E-value=49  Score=21.04  Aligned_cols=21  Identities=19%  Similarity=0.199  Sum_probs=14.8

Q ss_pred             HHhhcCCCCCCEEEEEEcCCC
Q 043432           82 FIKRYCLELGDYIMVYKDELE  102 (105)
Q Consensus        82 fV~~k~L~~GD~i~f~~~~~~  102 (105)
                      ......|+.||.|.|.|+.+|
T Consensus        17 ~~~~~~l~~g~~v~L~re~~N   37 (107)
T PF08797_consen   17 RAGRGKLKPGDRVVLVREPDN   37 (107)
T ss_dssp             HHCCTT--TTSEEEEEEETT-
T ss_pred             cccccccCCCCEEEEEEcCCC
Confidence            345678899999999998776


No 102
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities.
Probab=29.86  E-value=42  Score=19.47  Aligned_cols=14  Identities=29%  Similarity=0.463  Sum_probs=10.1

Q ss_pred             HhhcCCCCCCEEEE
Q 043432           83 IKRYCLELGDYIMV   96 (105)
Q Consensus        83 V~~k~L~~GD~i~f   96 (105)
                      ....+|++||.|+=
T Consensus        39 a~~~gl~~GD~I~~   52 (85)
T smart00228       39 AAKAGLKVGDVILE   52 (85)
T ss_pred             HHHcCCCCCCEEEE
Confidence            33455999999864


No 103
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]
Probab=29.83  E-value=53  Score=28.50  Aligned_cols=20  Identities=35%  Similarity=0.418  Sum_probs=18.3

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .+++++++++.||+|+++|.
T Consensus       360 ~d~I~rkdIrIGDtV~V~kA  379 (667)
T COG0272         360 VDEIKRKDIRIGDTVVVRKA  379 (667)
T ss_pred             HHHHHhcCCCCCCEEEEEec
Confidence            58899999999999999985


No 104
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=29.67  E-value=55  Score=28.28  Aligned_cols=20  Identities=20%  Similarity=0.502  Sum_probs=18.6

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .+++++++|+.||.|.+.|.
T Consensus       357 ~~~I~~~di~iGD~V~V~ra  376 (669)
T PRK14350        357 QDYIDSIGLNVGDVVKISRR  376 (669)
T ss_pred             HHHHHHcCCCCCCEEEEEec
Confidence            68999999999999999985


No 105
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=29.56  E-value=23  Score=23.22  Aligned_cols=25  Identities=24%  Similarity=0.390  Sum_probs=19.5

Q ss_pred             eeecC----hHHHHhhcCCCCCCEEEEEEc
Q 043432           74 YIFEN----TRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        74 y~l~g----W~~fV~~k~L~~GD~i~f~~~   99 (105)
                      |+|.|    |.+ =..+.|++||.|.+-..
T Consensus        69 ~Vl~G~~~~~~~-g~~~~l~~Gd~i~ip~g   97 (131)
T COG1917          69 YVLEGEGTVQLE-GEKKELKAGDVIIIPPG   97 (131)
T ss_pred             EEEecEEEEEec-CCceEecCCCEEEECCC
Confidence            77775    466 78889999999988554


No 106
>TIGR00575 dnlj DNA ligase, NAD-dependent. The member of this family from Treponema pallidum differs in having three rather than just one copy of the BRCT (BRCA1 C Terminus) domain (pfam00533) at the C-terminus. It is included in the seed.
Probab=29.55  E-value=56  Score=28.05  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=18.5

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .+++++++|+.||.|.++|.
T Consensus       348 ~~~i~~~~i~iGD~V~V~ra  367 (652)
T TIGR00575       348 EDEIEELDIRIGDTVVVRKA  367 (652)
T ss_pred             HHHHHHcCCCCCCEEEEEec
Confidence            68999999999999999985


No 107
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases. Most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this bacterial subfamily of protease-associated PDZ domains a C-terminal beta-strand  is thought to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=29.24  E-value=39  Score=19.98  Aligned_cols=10  Identities=40%  Similarity=0.564  Sum_probs=8.6

Q ss_pred             CCCCCCEEEE
Q 043432           87 CLELGDYIMV   96 (105)
Q Consensus        87 ~L~~GD~i~f   96 (105)
                      +|++||+|.=
T Consensus        24 gL~~GD~I~~   33 (79)
T cd00986          24 KLKAGDHIIA   33 (79)
T ss_pred             CCCCCCEEEE
Confidence            7999999874


No 108
>cd02790 MopB_CT_Formate-Dh_H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is a monomer composed of a single polypeptide chain with a  Mo active site region and a [4Fe-4S] center. This CD (MopB_CT_Formate-Dh_H) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=29.18  E-value=53  Score=20.69  Aligned_cols=19  Identities=26%  Similarity=0.228  Sum_probs=15.7

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=.++.+|+.||.|.+.-.
T Consensus        42 ~dA~~lgi~~Gd~V~v~~~   60 (116)
T cd02790          42 EDAKRLGIEDGEKVRVSSR   60 (116)
T ss_pred             HHHHHcCCCCCCEEEEEcC
Confidence            4578899999999998754


No 109
>PRK08577 hypothetical protein; Provisional
Probab=29.16  E-value=69  Score=21.41  Aligned_cols=25  Identities=12%  Similarity=0.193  Sum_probs=20.2

Q ss_pred             HHHHhhcCCCCCCEEEEEEcCCCCC
Q 043432           80 RAFIKRYCLELGDYIMVYKDELEGS  104 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~~~g~  104 (105)
                      .+.-+.-+|++||.+.|+-+.+.|+
T Consensus        19 ~~~r~~l~~~~g~~~~~~~~~~~~~   43 (136)
T PRK08577         19 LEIREALGIREGMYVLLIADTDKKE   43 (136)
T ss_pred             HHHHHHcCcCCCCEEEEEEECCCCE
Confidence            3667788999999999998776654


No 110
>PLN02799 Molybdopterin synthase sulfur carrier subunit
Probab=29.11  E-value=50  Score=19.95  Aligned_cols=19  Identities=21%  Similarity=0.214  Sum_probs=14.6

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +.-|+.||.|.|+.-..+|
T Consensus        64 ~~~l~dgDeVai~PpvsGG   82 (82)
T PLN02799         64 SAALKDGDELAIIPPISGG   82 (82)
T ss_pred             CcCcCCCCEEEEeCCCCCC
Confidence            4568999999998765554


No 111
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal. The C-terminal Gly-Gly of this model is critical to function.
Probab=29.01  E-value=52  Score=19.80  Aligned_cols=19  Identities=21%  Similarity=0.160  Sum_probs=15.5

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +..|+.||.|.|+.-..+|
T Consensus        62 ~~~l~dgDevai~PpvsGG   80 (80)
T TIGR01682        62 DALLNEGDEVAFIPPVSGG   80 (80)
T ss_pred             CcCcCCCCEEEEeCCCCCC
Confidence            5789999999999866554


No 112
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=28.96  E-value=37  Score=20.28  Aligned_cols=15  Identities=33%  Similarity=0.363  Sum_probs=8.8

Q ss_pred             hcCCCCCCEEEEEEc
Q 043432           85 RYCLELGDYIMVYKD   99 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~   99 (105)
                      =.+|++||+|.+-..
T Consensus        26 l~~L~~Gdvi~l~~~   40 (77)
T PF01052_consen   26 LLNLKVGDVIPLDKP   40 (77)
T ss_dssp             HHC--TT-EEEECCE
T ss_pred             HhcCCCCCEEEeCCC
Confidence            357999999988554


No 113
>PLN02311 chalcone isomerase
Probab=28.59  E-value=68  Score=24.70  Aligned_cols=24  Identities=17%  Similarity=0.159  Sum_probs=18.7

Q ss_pred             ChHHHHhhcCCCCCCEEEEEEcCC
Q 043432           78 NTRAFIKRYCLELGDYIMVYKDEL  101 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f~~~~~  101 (105)
                      .-..+.+...|++||+|.|.+...
T Consensus       192 kF~~~F~~~~l~kGd~I~~~~~p~  215 (271)
T PLN02311        192 TFRSIFQNRSLNKGTVIFLTWINP  215 (271)
T ss_pred             HHHHHhcCCCCCCCCEEEEEEeCC
Confidence            345666678999999999998754


No 114
>PRK14725 pyruvate kinase; Provisional
Probab=28.53  E-value=91  Score=26.82  Aligned_cols=57  Identities=16%  Similarity=0.237  Sum_probs=37.3

Q ss_pred             CCCEEEEEEECCCCeEEEEEEEEcCCC------CCcceeecChHHHHh---------------hcCCCCCCEEEEEEcC
Q 043432           43 KAGFWMHLEDMDFNKVWTFKFRFWPNN------RGRMYIFENTRAFIK---------------RYCLELGDYIMVYKDE  100 (105)
Q Consensus        43 ~~~~~l~~~D~~~g~~W~fr~~~~~~~------~s~~y~l~gW~~fV~---------------~k~L~~GD~i~f~~~~  100 (105)
                      ..|-.+.+.|. .|+.-.|+..--...      ...-|+-+|..-..+               .-.|++||.+.|.++.
T Consensus       270 ~~Gd~i~~~Da-Rg~~R~l~V~~~~~~~~~~~~~~~~Y~~~G~~l~~~~~~~~~v~~~p~~~~~i~L~~Gd~l~lt~~~  347 (608)
T PRK14725        270 EPGDELRFTDA-RGKKRKLTVTEVDDEGVLAEGSQTAYLANGTLLRLGRHDSTRVGGLPPVEQKLRLKVGDRLVLTRDD  347 (608)
T ss_pred             CCCceeeeeec-cccceeeeEEeecCceeEEeecceeeeccCceeeeccccccccccccccCcceEecCCCEEEEecCC
Confidence            56778899998 488888776632111      112255556433334               5689999999999874


No 115
>cd02779 MopB_CT_Arsenite-Ox This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of Arsenite oxidase (Arsenite-Ox) and related proteins. Arsenite oxidase oxidizes arsenite to the less toxic arsenate; it transfers the electrons obtained from the oxidation of arsenite towards the soluble periplasmic electron carriers cytochrome c and/or amicyanin.
Probab=28.29  E-value=56  Score=20.94  Aligned_cols=19  Identities=42%  Similarity=0.513  Sum_probs=15.7

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=+++.+|+.||.|.++-.
T Consensus        40 ~dA~~lgi~~Gd~V~v~s~   58 (115)
T cd02779          40 EDAKREGLKNGDLVEVYND   58 (115)
T ss_pred             HHHHHcCCCCCCEEEEEeC
Confidence            4578899999999998754


No 116
>PLN00212 glutelin; Provisional
Probab=28.26  E-value=42  Score=27.97  Aligned_cols=57  Identities=14%  Similarity=0.190  Sum_probs=34.3

Q ss_pred             CCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecC--hHHHHhhc-------CCCCCCEEEE
Q 043432           37 LPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFEN--TRAFIKRY-------CLELGDYIMV   96 (105)
Q Consensus        37 lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~g--W~~fV~~k-------~L~~GD~i~f   96 (105)
                      ||.|. .-++.+...|...|-+-..-  +.+|..+-.|++.|  +..||..+       .|++||++++
T Consensus       340 ~P~L~-~L~LSa~rv~L~~gam~~PH--wn~nA~eI~yV~rG~g~vqvV~~~g~~vf~~~L~~GdvfVV  405 (493)
T PLN00212        340 FPILN-LIQMSATRVNLYQNALLSPF--WNVNAHSVVYITQGRARVQVVSNNGKTVFNGVLRPGQLLII  405 (493)
T ss_pred             Ccccc-ccCeeEEEEEEcCCcccCCe--ecCCCCEEEEEeecceEEEEEcCCCCEEEEEEEcCCCEEEE
Confidence            67774 23344444454323332222  22334456688886  78888766       7999999987


No 117
>COG1430 Uncharacterized conserved protein [Function unknown]
Probab=28.11  E-value=62  Score=22.08  Aligned_cols=29  Identities=17%  Similarity=0.280  Sum_probs=22.4

Q ss_pred             cceeecChHHHHhhcCCCCCCEEEEEEcC
Q 043432           72 RMYIFENTRAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        72 ~~y~l~gW~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      ..|+|+-=...+++.+++.||.|.|....
T Consensus        95 ~~yvLEl~~G~~~~~~i~vGd~v~~~~~~  123 (126)
T COG1430          95 VRYVLELPAGWAARLGIKVGDRVEFRPLG  123 (126)
T ss_pred             ccEEEEecCCchhhcCCccCCEEEecccC
Confidence            35999943455788999999999987643


No 118
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins. MoaD family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), that contains the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase, the second major step in Moco biosynthesis. MPT synthase consists of a large (MoeE) and small (MoaD) subunit. The small subunit  is inserted into the lare subunit to form the active site.  The small subunit, which is structurally similar to ubiquitin, contains a C-terminal thiocarboxylated glycine residue that serves as a sulfur donor for the synthesis of the MPT dithiolene group.
Probab=27.99  E-value=55  Score=19.27  Aligned_cols=20  Identities=20%  Similarity=0.130  Sum_probs=15.6

Q ss_pred             hhcCCCCCCEEEEEEcCCCC
Q 043432           84 KRYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        84 ~~k~L~~GD~i~f~~~~~~g  103 (105)
                      .+..|+.||.|.|+.-..+|
T Consensus        61 ~~~~l~~gD~v~i~ppv~GG   80 (80)
T cd00754          61 LDTPLKDGDEVAIIPPVSGG   80 (80)
T ss_pred             CCcccCCCCEEEEeCCCCCC
Confidence            45679999999998765554


No 119
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB). SSoSSB has a single OB fold, and it physically and functionally interacts with RNA polymerase. In vitro, SSoSSB can substitute for the basal transcription factor TBP, stimulating transcription from promoters under conditions in which TBP is limiting, and supporting transcription when TBP is absent. SSoSSB selectively melts the duplex DNA of promoter sequences. It also relieves transcriptional repression by the chromatin Alba. In addition, SSoSSB activates reverse gyrase activity, which involves DNA binding, DNA cleavage, strand passage and ligation. SSoSSB stimulates all these steps in the presence of the chromatin protein, Sul7d. SSoSSB antagonizes the inhibitory effect of Sul7d on reverse gyrase supercoiling activity. It also physically and functionally interacts with Mini-chromosome Maintenance (MCM), stimulating 
Probab=27.96  E-value=1.4e+02  Score=17.80  Aligned_cols=34  Identities=26%  Similarity=0.339  Sum_probs=22.9

Q ss_pred             EEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCCCCCEEEEE
Q 043432           46 FWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVY   97 (105)
Q Consensus        46 ~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~   97 (105)
                      ..+.+.|. +|   +.+++.|  +..         .   ...+++||.|.+.
T Consensus        25 ~~~~l~D~-TG---~i~~~~W--~~~---------~---~~~~~~G~vv~i~   58 (82)
T cd04491          25 QSGLVGDE-TG---TIRFTLW--DEK---------A---ADDLEPGDVVRIE   58 (82)
T ss_pred             EEEEEECC-CC---EEEEEEE--Cch---------h---cccCCCCCEEEEE
Confidence            56677887 57   4677888  332         1   4558889988775


No 120
>cd05828 Sortase_D_4 Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved at the cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. Class D sortases are further classified into subfamilies 4 and 5. This group contains a subset of Class D sortases belonging to subfamily-4. These sortases recognize a unique sorting signal (LPXTA) and they constitute a specialized sorting pathway found in bacilli. Their substrates are predicted to be predominantly enzymes such as 5'-nucleotidases, glycosyl hydrolase, and subtilase.
Probab=27.93  E-value=66  Score=21.22  Aligned_cols=28  Identities=21%  Similarity=0.088  Sum_probs=23.0

Q ss_pred             cceeecC--hHHHHhhcCCCCCCEEEEEEc
Q 043432           72 RMYIFEN--TRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        72 ~~y~l~g--W~~fV~~k~L~~GD~i~f~~~   99 (105)
                      ..++|.|  ..-|-+=..|+.||.|.+...
T Consensus        44 gn~vIaGH~~~~F~~L~~l~~Gd~i~v~~~   73 (127)
T cd05828          44 GNIVIAGHRDTHFRFLGELEPGDIITLQTL   73 (127)
T ss_pred             CcEEEEEeCchhhhChhcCCCCCEEEEEEC
Confidence            4577775  578999999999999999865


No 121
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=27.91  E-value=62  Score=28.07  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=18.4

Q ss_pred             HHHHhhcCCCCCCEEEEEEc
Q 043432           80 RAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .+++++++|+.||.|.+.|.
T Consensus       382 ~~~i~~~di~iGD~V~V~ra  401 (689)
T PRK14351        382 PAEIEELGVNVGDRVRVKRA  401 (689)
T ss_pred             HHHHHHcCCCCCCEEEEEec
Confidence            57999999999999999985


No 122
>cd02775 MopB_CT Molybdopterin-Binding, C-terminal (MopB_CT) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and tungsten-containing enzymes, including formate dehydrogenase-H (Fdh-H) and -N (Fdh-N), several forms of nitrate reductase (Nap, Nas, NarG), dimethylsulfoxide reductase (DMSOR), thiosulfate reductase, formylmethanofuran dehydrogenase, and arsenite oxidase. Molybdenum is present in most of these enzymes in the form of molybdopterin, a modified pterin ring with a dithiolene side chain, which is responsible for ligating the Mo. In many bacterial and archaeal species, molybdopterin is in the form of a dinucleotide, with two molybdopterin dinucleotide units per molybdenum. These proteins can function as monomers, heterodimers, or heterotrimers, depending on the protein and organism. Also included in the MopB superfamily is
Probab=27.87  E-value=58  Score=19.79  Aligned_cols=20  Identities=15%  Similarity=0.091  Sum_probs=15.6

Q ss_pred             HHHhhcCCCCCCEEEEEEcC
Q 043432           81 AFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +=+++.+|+.||.|.++-..
T Consensus        30 ~da~~lgl~~Gd~v~v~~~~   49 (101)
T cd02775          30 EDAAALGIKDGDLVRVESRR   49 (101)
T ss_pred             HHHHHcCCCCCCEEEEEcCC
Confidence            45678899999999887543


No 123
>PF02938 GAD:  GAD domain;  InterPro: IPR004115 This entry represetns an 2 layer alpha/beta insertion domain found in some glutamyl-tRNA amidotransferases and aspartyl tRNA synthetases [, ]. The function of this domain is not yet known.; GO: 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0005737 cytoplasm; PDB: 1ZQ1_D 1EQR_B 1IL2_B 1C0A_A 1L0W_A 1G51_B 1EFW_B 2D6F_D.
Probab=27.80  E-value=63  Score=20.32  Aligned_cols=28  Identities=21%  Similarity=0.434  Sum_probs=20.2

Q ss_pred             ceeecC-hHHHHhhcCCCCCCEEEEEEcC
Q 043432           73 MYIFEN-TRAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        73 ~y~l~g-W~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      .++... -...+..-++++||.|.|.-++
T Consensus        59 kfl~e~~~~~l~~~~~a~~GD~ll~~Ag~   87 (95)
T PF02938_consen   59 KFLSEEELKALIERLGAKPGDLLLFVAGK   87 (95)
T ss_dssp             CCCHHHHHHHHHHHTT--TTEEEEEEEES
T ss_pred             ccCCHHHHHHHHHHhCCCCCCEEEEECCC
Confidence            354444 6899999999999999997654


No 124
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=27.11  E-value=50  Score=19.47  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=10.1

Q ss_pred             hhcCCCCCCEEEE
Q 043432           84 KRYCLELGDYIMV   96 (105)
Q Consensus        84 ~~k~L~~GD~i~f   96 (105)
                      ...+|++||.|+=
T Consensus        27 ~~~gl~~GD~I~~   39 (85)
T cd00988          27 AKAGIKAGDIIVA   39 (85)
T ss_pred             HHcCCCCCCEEEE
Confidence            3449999999874


No 125
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=26.86  E-value=80  Score=14.64  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=12.1

Q ss_pred             CCCCCEEEEEEcCCCC
Q 043432           88 LELGDYIMVYKDELEG  103 (105)
Q Consensus        88 L~~GD~i~f~~~~~~g  103 (105)
                      +++||.|.+......|
T Consensus         2 ~~~G~~V~I~~G~~~g   17 (28)
T smart00739        2 FEVGDTVRVIAGPFKG   17 (28)
T ss_pred             CCCCCEEEEeECCCCC
Confidence            5789999888766555


No 126
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=26.71  E-value=49  Score=19.58  Aligned_cols=14  Identities=29%  Similarity=0.413  Sum_probs=10.6

Q ss_pred             HhhcCCCCCCEEEE
Q 043432           83 IKRYCLELGDYIMV   96 (105)
Q Consensus        83 V~~k~L~~GD~i~f   96 (105)
                      ....+|++||+|+=
T Consensus        37 a~~~gl~~GD~I~~   50 (90)
T cd00987          37 AAKAGLKPGDVILA   50 (90)
T ss_pred             HHHcCCCcCCEEEE
Confidence            44568999999863


No 127
>KOG3218 consensus RNA polymerase, 25-kDa subunit (common to polymerases I, II and III) [Transcription]
Probab=26.60  E-value=69  Score=23.76  Aligned_cols=31  Identities=19%  Similarity=0.435  Sum_probs=24.2

Q ss_pred             eecChHHHHhhcCCCCCCEEEEEE-cCCCCCC
Q 043432           75 IFENTRAFIKRYCLELGDYIMVYK-DELEGSY  105 (105)
Q Consensus        75 ~l~gW~~fV~~k~L~~GD~i~f~~-~~~~g~~  105 (105)
                      .+..-..++|-.||+.|++|-+.| ++-.|+|
T Consensus       170 RIq~~DpvaRYyGLKrGqVVKI~r~setag~y  201 (208)
T KOG3218|consen  170 RIQKKDPVARYYGLKRGQVVKIIRRSETAGRY  201 (208)
T ss_pred             eeeccChHHhhhccccCcEEEEEecCccCcce
Confidence            344446899999999999998866 5667776


No 128
>PRK08433 flagellar motor switch protein; Validated
Probab=26.58  E-value=48  Score=22.13  Aligned_cols=14  Identities=29%  Similarity=0.183  Sum_probs=11.3

Q ss_pred             hcCCCCCCEEEEEE
Q 043432           85 RYCLELGDYIMVYK   98 (105)
Q Consensus        85 ~k~L~~GD~i~f~~   98 (105)
                      =-+|++||+|.+=+
T Consensus        50 lL~Lq~GDVI~Ld~   63 (111)
T PRK08433         50 ILKFEKGSVIDLEK   63 (111)
T ss_pred             HhCCCCCCEEEeCC
Confidence            35799999999854


No 129
>PF07237 DUF1428:  Protein of unknown function (DUF1428);  InterPro: IPR009874 This family consists of several hypothetical bacterial and one archaeal sequence of around 120 residues in length. The function of this family is unknown.; PDB: 2OKQ_A.
Probab=26.50  E-value=54  Score=21.68  Aligned_cols=21  Identities=5%  Similarity=-0.034  Sum_probs=15.4

Q ss_pred             hHHHHhhcCCCCCCEEEEEEc
Q 043432           79 TRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        79 W~~fV~~k~L~~GD~i~f~~~   99 (105)
                      ...|-++-++++|.+|+|.|-
T Consensus        50 ~TsF~~Av~a~~~E~VVFSWi   70 (103)
T PF07237_consen   50 VTSFPRAVKAKPDETVVFSWI   70 (103)
T ss_dssp             S--HHHHTT--TTEEEEEEEE
T ss_pred             cCCHHHHhcCCCCCEEEEEEE
Confidence            579999999999999999874


No 130
>PRK10220 hypothetical protein; Provisional
Probab=26.35  E-value=58  Score=21.88  Aligned_cols=14  Identities=36%  Similarity=0.451  Sum_probs=12.0

Q ss_pred             cCCCCCCEEEEEEc
Q 043432           86 YCLELGDYIMVYKD   99 (105)
Q Consensus        86 k~L~~GD~i~f~~~   99 (105)
                      +-|..||.|++.++
T Consensus        50 ~~L~dGDsV~viKD   63 (111)
T PRK10220         50 NLLADGDSVTIVKD   63 (111)
T ss_pred             CCccCCCEEEEEee
Confidence            56889999999886


No 131
>TIGR02480 fliN flagellar motor switch protein FliN. Proteins that consist largely of the domain described by this model can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica.
Probab=26.20  E-value=46  Score=20.24  Aligned_cols=14  Identities=29%  Similarity=0.135  Sum_probs=11.1

Q ss_pred             hcCCCCCCEEEEEE
Q 043432           85 RYCLELGDYIMVYK   98 (105)
Q Consensus        85 ~k~L~~GD~i~f~~   98 (105)
                      =.+|++||+|.+-+
T Consensus        26 ll~L~~Gdvi~L~~   39 (77)
T TIGR02480        26 LLKLGEGSVIELDK   39 (77)
T ss_pred             HhcCCCCCEEEcCC
Confidence            35799999999854


No 132
>PF02597 ThiS:  ThiS family;  InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer. ThiS is coded in the thiCEFSGH operon in Escherichia coli. This family of proteins have two conserved Glycines at the COOH terminus. Thiocarboxylate is formed at the last G in the activation process. Sulphur is transferred from ThiI to ThiS in a reaction catalysed by IscS []. MoaD, a protein involved in sulphur transfer during molybdopterin synthesis, is about the same length and shows limited sequence similarity to ThiS. Both have the conserved GG at the COOH end.; PDB: 1JW9_D 1JWB_D 1JWA_D 3BII_D 1NVI_D 1FMA_D 1FM0_D 2QIE_G 2Q5W_D 2K5P_A ....
Probab=25.98  E-value=40  Score=19.70  Aligned_cols=19  Identities=21%  Similarity=0.186  Sum_probs=14.8

Q ss_pred             hcCCCCCCEEEEEEcCCCC
Q 043432           85 RYCLELGDYIMVYKDELEG  103 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g  103 (105)
                      +..|+.||.|.|+.-..+|
T Consensus        59 ~~~l~~gD~V~i~ppvsGG   77 (77)
T PF02597_consen   59 DTPLKDGDEVAILPPVSGG   77 (77)
T ss_dssp             TSBEETTEEEEEEESTSTS
T ss_pred             CcCcCCCCEEEEECCCCCC
Confidence            4567999999998866555


No 133
>PF08541 ACP_syn_III_C:  3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal  ;  InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2.3.1.41 from EC, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria. ; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups, 0008610 lipid biosynthetic process; PDB: 3IL3_A 1ZOW_C 3GWE_B 3GWA_B 1UB7_B 3LED_B 2EBD_A 1HNJ_A 2EFT_B 1HN9_B ....
Probab=25.77  E-value=59  Score=19.73  Aligned_cols=21  Identities=10%  Similarity=0.096  Sum_probs=17.1

Q ss_pred             hHHHHhhcCCCCCCEEEEEEc
Q 043432           79 TRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        79 W~~fV~~k~L~~GD~i~f~~~   99 (105)
                      -...+++..+++||.|.+.--
T Consensus        57 L~~~~~~g~~~~Gd~vl~~~~   77 (90)
T PF08541_consen   57 LADALEEGRIKPGDRVLLVGF   77 (90)
T ss_dssp             HHHHHHTTSSCTTEEEEEEEE
T ss_pred             HHHHHHcCCCCCCCEEEEEEE
Confidence            357788889999999998753


No 134
>TIGR01687 moaD_arch MoaD family protein, archaeal. Members of this family appear to be archaeal versions of MoaD, subunit 1 of molybdopterin converting factor. This model has been split from the bacterial/eukaryotic equivalog model TIGR01682 because the presence of two members of this family in a substantial number of archaeal species suggests that roles might not be interchangeable.
Probab=25.46  E-value=65  Score=19.62  Aligned_cols=18  Identities=22%  Similarity=0.327  Sum_probs=14.3

Q ss_pred             cCCCCCCEEEEEEcCCCC
Q 043432           86 YCLELGDYIMVYKDELEG  103 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~~g  103 (105)
                      ..|+.||.|.|+.-..+|
T Consensus        71 ~~l~dgdev~i~PpvsGG   88 (88)
T TIGR01687        71 TELKDGDVVAIFPPVSGG   88 (88)
T ss_pred             CCCCCCCEEEEeCCCcCC
Confidence            479999999998765554


No 135
>PF00313 CSD:  'Cold-shock' DNA-binding domain;  InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate []. During the lag phase, the expression of around 13 proteins, which contain specific DNA-binding regions [], is increased 2-10 fold. These so-called 'cold shock' proteins are thought to help the cell to survive in temperatures lower than optimum growth temperature, by contrast with heat shock proteins, which help the cell to survive in temperatures greater than the optimum, possibly by condensation of the chromosome and organisation of the prokaryotic nucleoid []. A conserved domain of about 70 amino acids has been found in prokaryotic and eukaryotic DNA-binding proteins [, , ]. This domain is known as the 'cold-shock domain' (CSD), part of which is highly similar [] to the RNP-1 RNA-binding motif.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1HZC_A 1I5F_A 1HZ9_B 1C9O_B 1HZB_B 1HZA_A 2HAX_B 2L15_A 2LSS_A 3I2Z_B ....
Probab=25.43  E-value=1.2e+02  Score=17.36  Aligned_cols=28  Identities=18%  Similarity=0.140  Sum_probs=17.3

Q ss_pred             ecChHHHHhh--cCCCCCCEEEEEEcCCCC
Q 043432           76 FENTRAFIKR--YCLELGDYIMVYKDELEG  103 (105)
Q Consensus        76 l~gW~~fV~~--k~L~~GD~i~f~~~~~~g  103 (105)
                      +-..+++...  ..|++||.|.|.-....+
T Consensus        27 Ffh~s~~~~~~~~~l~~G~~V~F~~~~~~~   56 (66)
T PF00313_consen   27 FFHISDLSGNGFRSLKEGDRVEFEVEEGKK   56 (66)
T ss_dssp             EEEGGGBCSSSSTS--TTSEEEEEEEECTT
T ss_pred             EeccccccccccccCCCCCEEEEEEEECCC
Confidence            3344555555  489999999998765544


No 136
>cd02787 MopB_CT_ydeP The MopB_CT_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=25.39  E-value=87  Score=19.83  Aligned_cols=23  Identities=26%  Similarity=0.202  Sum_probs=17.9

Q ss_pred             ChHHHHhhcCCCCCCEEEEEEcCC
Q 043432           78 NTRAFIKRYCLELGDYIMVYKDEL  101 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f~~~~~  101 (105)
                      +-.+ +++.+|+.||.|.++-..+
T Consensus        36 ~p~d-A~~lgI~dGd~V~v~s~~G   58 (112)
T cd02787          36 NPDD-IARLGLKAGDRVDLESAFG   58 (112)
T ss_pred             CHHH-HHHhCCCCCCEEEEEecCC
Confidence            4444 8899999999999986543


No 137
>PF11520 Cren7:  Chromatin protein Cren7;  InterPro: IPR020906 Cren7 is a chromatin protein found in Crenarchaeota and has a higher affinity for double-stranded DNA than for single-stranded DNA. The protein contains negative DNA supercoils and is associated with genomic DNA in vivo. Cren7 interacts with duplex DNA through a beta-sheet and a long flexible loop. Its binding to double-stranded DNA is without sequence specificity. There is approximately 1 Cren7 molecule for 12 bp of DNA. The function of Cren7 has not been completely determined but it is thought that the protein may have a role similar to that of archaeal proteins in Euryarchaea [].; GO: 0003690 double-stranded DNA binding, 0005737 cytoplasm; PDB: 3KXT_A 3LWH_A 3LWI_A 2JTM_A.
Probab=25.33  E-value=44  Score=20.04  Aligned_cols=17  Identities=35%  Similarity=0.516  Sum_probs=10.4

Q ss_pred             CCCCEEEEEEcCCCCCC
Q 043432           89 ELGDYIMVYKDELEGSY  105 (105)
Q Consensus        89 ~~GD~i~f~~~~~~g~~  105 (105)
                      +.|=.|.++++.++|+|
T Consensus        34 rkGV~igLFk~P~tGk~   50 (60)
T PF11520_consen   34 RKGVKIGLFKDPETGKY   50 (60)
T ss_dssp             S--EEEEEEE-TTT--E
T ss_pred             CCceEEEEEeCCCCCcc
Confidence            56788999999999986


No 138
>cd02778 MopB_CT_Thiosulfate-R-like The MopB_CT_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins. Thiosulfate reductase catalyzes the cleavage of sulfur-sulfur bonds in thiosulfate. Polysulfide reductase is a membrane-bound enzyme that catalyzes the reduction of polysulfide using either hydrogen or formate as the electron donor. Also included in this CD is the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), which has been characterized as a membrane-bound molybdenum-iron-sulfur enzyme involved in anaerobic metabolism of phenylalanine in the denitrifying bacterium Thauera aromatica. The MopB_CT_Thiosulfate-R-like CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=25.30  E-value=85  Score=20.00  Aligned_cols=20  Identities=20%  Similarity=0.195  Sum_probs=16.1

Q ss_pred             HHHhhcCCCCCCEEEEEEcC
Q 043432           81 AFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +=.++.+|+.||.|.++-+.
T Consensus        37 ~dA~~~gi~~Gd~V~v~s~~   56 (123)
T cd02778          37 ETAARLGIKDGDRVEVSSAR   56 (123)
T ss_pred             HHHHHcCCCCCCEEEEEeCC
Confidence            45778999999999987653


No 139
>cd00508 MopB_CT_Fdh-Nap-like This CD includes formate dehydrogenases (Fdh) H and N; nitrate reductases, Nap and Nas; and other related proteins. Formate dehydrogenase H is a component of the anaerobic formate hydrogen lyase complex  and catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. Formate dehydrogenase N (alpha subunit) is the major electron donor to the bacterial nitrate respiratory chain and nitrate reductases, Nap and Nas, catalyze the reduction of nitrate to nitrite. This CD (MopB_CT_Fdh-Nap-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=25.19  E-value=68  Score=20.19  Aligned_cols=19  Identities=21%  Similarity=0.195  Sum_probs=15.6

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=+++.+|+.||.|.++-+
T Consensus        42 ~dA~~lgi~~Gd~V~v~~~   60 (120)
T cd00508          42 EDAARLGIKDGDLVRVSSR   60 (120)
T ss_pred             HHHHHcCCCCCCEEEEEeC
Confidence            4467899999999998864


No 140
>PF01272 GreA_GreB:  Transcription elongation factor, GreA/GreB, C-term;  InterPro: IPR001437 Bacterial proteins greA and greB are necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. Arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked DNA/RNA/ polymerase ternary complexes. Cleavage of the nascent transcript by cleavage factors, such as greA or greB, allows the resumption of elongation from the new 3' terminus [, ].  Escherichia coli GreA and GreB are sequence homologues and have homologues in every known bacterial genome []. GreA induces cleavage two or three nucleotides behind the terminus and can only prevent the formation of arrested complexes while greB releases longer sequences up to eighteen nucleotides in length and can rescue preexisting arrested complexes. These functional differences correlate with a distinctive structural feature, the distribution of positively charged residues on one face of the N-terminal coiled coil. Remarkably, despite close functional similarity, the prokaryotic Gre factors have no sequence or structural similarity with eukaryotic TFIIS. ; GO: 0003677 DNA binding, 0032784 regulation of transcription elongation, DNA-dependent; PDB: 2P4V_E 2ETN_B 3BMB_B 2PN0_D 1GRJ_A 2EUL_C 3AOH_Y 3AOI_X 2F23_A.
Probab=25.09  E-value=1.6e+02  Score=17.58  Aligned_cols=55  Identities=16%  Similarity=0.014  Sum_probs=33.7

Q ss_pred             CCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhh-cCCCCCCEEEEEE
Q 043432           44 AGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKR-YCLELGDYIMVYK   98 (105)
Q Consensus        44 ~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~-k~L~~GD~i~f~~   98 (105)
                      -|-.+.+.|..++..-.|.+..-...+...-.++-.+..-++ .+.++||.|.+.-
T Consensus         8 ~Gs~V~l~~~~~~~~~~~~lv~~~~~~~~~~~IS~~SPLG~ALlG~~~Gd~v~~~~   63 (77)
T PF01272_consen    8 IGSTVTLKDLDDGEEETYTLVGPDEADPDNGKISIDSPLGKALLGKKVGDEVEVEL   63 (77)
T ss_dssp             TTEEEEEEETTTTEEEEEEEE-GGG-BSTSTEEETTSHHHHHHTT-BTT-EEEEEE
T ss_pred             eCCEEEEEECCCCCEEEEEEEeEhHhCCceeEEEecCHHHHHhcCCCCCCEEEEEe
Confidence            467788898656888888877543333222345544566555 5889999998864


No 141
>PRK07440 hypothetical protein; Provisional
Probab=25.03  E-value=77  Score=18.98  Aligned_cols=17  Identities=18%  Similarity=0.137  Sum_probs=13.4

Q ss_pred             CCCCCCEEEEEEcCCCC
Q 043432           87 CLELGDYIMVYKDELEG  103 (105)
Q Consensus        87 ~L~~GD~i~f~~~~~~g  103 (105)
                      .|++||.|-+..-.++|
T Consensus        54 ~L~~gD~IEIv~~v~GG   70 (70)
T PRK07440         54 QVQPGDRLEIVTIVGGG   70 (70)
T ss_pred             ecCCCCEEEEEEEecCC
Confidence            49999999998766554


No 142
>smart00308 LH2 Lipoxygenase homology 2 (beta barrel) domain.
Probab=24.98  E-value=1.1e+02  Score=19.02  Aligned_cols=21  Identities=14%  Similarity=0.373  Sum_probs=13.9

Q ss_pred             EEEEEECCCCeEEEEEEEEcC
Q 043432           47 WMHLEDMDFNKVWTFKFRFWP   67 (105)
Q Consensus        47 ~l~~~D~~~g~~W~fr~~~~~   67 (105)
                      .|.|+|..+++.|.|-|.-|.
T Consensus        82 ~V~V~~~~~~~~~~F~c~~Wl  102 (105)
T smart00308       82 SITVKDLPTGGKYHFPCNSWV  102 (105)
T ss_pred             EEEEEECCCCCEEEEEcCcee
Confidence            456677555777777776663


No 143
>cd02786 MopB_CT_3 The MopB_CT_3 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=24.93  E-value=66  Score=20.35  Aligned_cols=20  Identities=25%  Similarity=0.360  Sum_probs=15.6

Q ss_pred             HHHhhcCCCCCCEEEEEEcC
Q 043432           81 AFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +=..+.+|+.||.|.++-..
T Consensus        38 ~dA~~lgi~~Gd~V~v~s~~   57 (116)
T cd02786          38 ADAAARGIADGDLVVVFNDR   57 (116)
T ss_pred             HHHHHcCCCCCCEEEEEcCC
Confidence            44678999999999887543


No 144
>PF13123 DUF3978:  Protein of unknown function (DUF3978)
Probab=24.88  E-value=77  Score=22.06  Aligned_cols=50  Identities=12%  Similarity=0.228  Sum_probs=31.0

Q ss_pred             ccccceeEEEecccCCCCC-CCcEEeehhhhhccCCCCCCCC-CEEEEEEEC
Q 043432            4 PFLMRFLFEKQLKNSDVNA-AGRIVLPKKLAETYLPPVNEKA-GFWMHLEDM   53 (105)
Q Consensus         4 ~~~~~~~f~K~LT~SDv~~-~~rl~iPk~~ae~~lP~l~~~~-~~~l~~~D~   53 (105)
                      +.+++..++|.....-.+- +...+||..+..-+||.++..+ .+.|.++-.
T Consensus        49 kenikI~~Kk~~n~~~e~~~~k~yiIPtk~FhY~lp~Ise~~~~~~iQ~qsf  100 (145)
T PF13123_consen   49 KENIKIETKKTINSRQESMIGKSYIIPTKAFHYLLPIISEGEDEMNIQVQSF  100 (145)
T ss_pred             ccceEEEEEecCCCChHHhhhheeeeehhheeeEeceeecCccceeeEEEec
Confidence            4556666776553221111 3578999888877789987654 556666543


No 145
>COG4519 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.35  E-value=1.1e+02  Score=19.62  Aligned_cols=30  Identities=10%  Similarity=0.130  Sum_probs=19.4

Q ss_pred             CCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhh
Q 043432           44 AGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKR   85 (105)
Q Consensus        44 ~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~   85 (105)
                      -|+.+.+.-.  |        .+  +....|.|+.|..|-++
T Consensus        49 lgi~l~FvQ~--G--------~R--nn~GyYql~dWGp~~~~   78 (95)
T COG4519          49 LGIVLEFVQE--G--------AR--NNQGYYQLRDWGPVRRE   78 (95)
T ss_pred             CCeEEEeeec--c--------cc--cCCCceEeeeccchhHH
Confidence            3577777654  3        23  44567999999776554


No 146
>cd02791 MopB_CT_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite. Monomeric Nas is located in the cytoplasm and participates in nitrogen assimilation. Dimeric Nap is located in the periplasm and is coupled to quinol oxidation via a membrane-anchored tetraheme cytochrome. This CD (MopB_CT_Nitrate-R-Nap) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs
Probab=24.32  E-value=69  Score=20.37  Aligned_cols=20  Identities=25%  Similarity=0.232  Sum_probs=16.1

Q ss_pred             HHHhhcCCCCCCEEEEEEcC
Q 043432           81 AFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +=.++.+++.||.|.++-+.
T Consensus        42 ~dA~~lgi~~Gd~V~v~~~~   61 (122)
T cd02791          42 EDAARLGLKEGDLVRVTSRR   61 (122)
T ss_pred             HHHHHcCCCCCCEEEEEcCC
Confidence            45778899999999987654


No 147
>PRK10838 spr outer membrane lipoprotein; Provisional
Probab=24.31  E-value=48  Score=24.04  Aligned_cols=16  Identities=25%  Similarity=0.397  Sum_probs=12.5

Q ss_pred             HHhhcCCCCCCEEEEE
Q 043432           82 FIKRYCLELGDYIMVY   97 (105)
Q Consensus        82 fV~~k~L~~GD~i~f~   97 (105)
                      -|....|++||.|.|-
T Consensus       123 ~V~~~~lqpGDLVfF~  138 (190)
T PRK10838        123 SVSRSKLRTGDLVLFR  138 (190)
T ss_pred             CcccCCCCCCcEEEEC
Confidence            4566789999998774


No 148
>PF02887 PK_C:  Pyruvate kinase, alpha/beta domain;  InterPro: IPR015795 Pyruvate kinase (2.7.1.40 from EC) (PK) catalyses the final step in glycolysis [], the conversion of phosphoenolpyruvate to pyruvate with concomitant phosphorylation of ADP to ATP:  ADP + phosphoenolpyruvate = ATP + pyruvate  The enzyme, which is found in all living organisms, requires both magnesium and potassium ions for its activity. In vertebrates, there are four tissue-specific isozymes: L (liver), R (red cells), M1 (muscle, heart and brain), and M2 (early foetal tissue). In plants, PK exists as cytoplasmic and plastid isozymes, while most bacteria and lower eukaryotes have one form, except in certain bacteria, such as Escherichia coli, that have two isozymes. All isozymes appear to be tetramers of identical subunits of ~500 residues. PK helps control the rate of glycolysis, along with phosphofructokinase (IPR000023 from INTERPRO) and hexokinase (IPR001312 from INTERPRO). PK possesses allosteric sites for numerous effectors, yet the isozymes respond differently, in keeping with their different tissue distributions []. The activity of L-type (liver) PK is increased by fructose-1,6-bisphosphate (F1,6BP) and lowered by ATP and alanine (gluconeogenic precursor), therefore when glucose levels are high, glycolysis is promoted, and when levels are low, gluconeogenesis is promoted. L-type PK is also hormonally regulated, being activated by insulin and inhibited by glucagon, which covalently modifies the PK enzyme. M1-type (muscle, brain) PK is inhibited by ATP, but F1,6BP and alanine have no effect, which correlates with the function of muscle and brain, as opposed to the liver. The structure of several pyruvate kinases from various organisms have been determined [, ]. The protein comprises three-four domains: a small N-terminal helical domain (absent in bacterial PK), a beta/alpha-barrel domain, a beta-barrel domain (inserted within the beta/alpha-barrel domain), and a 3-layer alpha/beta/alpha sandwich domain. This entry represents the 3-layer alpha/beta/alpha sandwich domain. This domain has a similar topology to the archaeal hypothetical protein, MTH1675 from Methanobacterium thermoautotrophicum.; PDB: 3QTG_B 1VP8_A 1T57_C 3N25_A 1AQF_C 2G50_B 1F3X_G 1A5U_F 1A49_E 1F3W_C ....
Probab=24.16  E-value=1.3e+02  Score=19.31  Aligned_cols=21  Identities=24%  Similarity=0.339  Sum_probs=15.7

Q ss_pred             hHHHHhhcCC-CCCCEEEEEEc
Q 043432           79 TRAFIKRYCL-ELGDYIMVYKD   99 (105)
Q Consensus        79 W~~fV~~k~L-~~GD~i~f~~~   99 (105)
                      -.++.++++| +.||.|++...
T Consensus        80 a~~~~~~~g~~~~gd~vVv~~g  101 (117)
T PF02887_consen   80 ALEYAKERGLLKPGDKVVVVAG  101 (117)
T ss_dssp             HHHHHHHTTSS-TTSEEEEEEE
T ss_pred             HHHHHHHcCCCCCCCEEEEEeC
Confidence            3566777777 88999998876


No 149
>cd02792 MopB_CT_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a  functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. This CD (MopB_CT_Formate-Dh-Na-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=24.10  E-value=75  Score=20.20  Aligned_cols=19  Identities=16%  Similarity=0.221  Sum_probs=15.4

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=.++.+|+.||.|.++-+
T Consensus        42 ~dA~~lgi~~Gd~V~v~s~   60 (122)
T cd02792          42 ELAAERGIKNGDMVWVSSP   60 (122)
T ss_pred             HHHHHcCCCCCCEEEEEcC
Confidence            4477889999999988754


No 150
>cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA.  CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and  the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.
Probab=24.09  E-value=1.5e+02  Score=16.86  Aligned_cols=25  Identities=24%  Similarity=0.162  Sum_probs=18.5

Q ss_pred             hHHHHhh--cCCCCCCEEEEEEcCCCC
Q 043432           79 TRAFIKR--YCLELGDYIMVYKDELEG  103 (105)
Q Consensus        79 W~~fV~~--k~L~~GD~i~f~~~~~~g  103 (105)
                      -+++...  ..|++||.|.|......+
T Consensus        30 ~~~~~~~~~~~~~~G~~V~f~~~~~~~   56 (65)
T cd04458          30 ISALEGDGFRSLEEGDRVEFELEEGDK   56 (65)
T ss_pred             hhHhhccCCCcCCCCCEEEEEEEECCC
Confidence            3566665  789999999997765443


No 151
>PRK07696 sulfur carrier protein ThiS; Provisional
Probab=24.06  E-value=83  Score=18.59  Aligned_cols=17  Identities=24%  Similarity=0.055  Sum_probs=13.3

Q ss_pred             CCCCCCEEEEEEcCCCC
Q 043432           87 CLELGDYIMVYKDELEG  103 (105)
Q Consensus        87 ~L~~GD~i~f~~~~~~g  103 (105)
                      .|+.||.|-+..-.++|
T Consensus        51 ~L~~gD~iEIv~~VgGG   67 (67)
T PRK07696         51 SVFDGDQIEIVTFVGGG   67 (67)
T ss_pred             ecCCCCEEEEEEEecCC
Confidence            48999999998766554


No 152
>TIGR03784 marine_sortase sortase, marine proteobacterial type. Members of this protein family are sortase enzymes, cysteine transpeptidases involved in protein sorting activities. Members of this family tend to be found in proteobacteria, rather than in Gram-positive bacteria where sortases attach proteins to the Gram-positive cell wall or participate in pilin cross-linking. Many species with this sortase appear to contain a signal target sequence, a protein with a Vault protein inter-alpha-trypsin domain (pfam08487) and a von Willebrand factor type A domain (pfam00092), encoded by an adjacent gene. These sortases are designated subfamily 6 according to Comfort and Clubb (2004).
Probab=23.96  E-value=75  Score=22.59  Aligned_cols=30  Identities=17%  Similarity=0.115  Sum_probs=23.5

Q ss_pred             CcceeecC--hHHHHhhcCCCCCCEEEEEEcC
Q 043432           71 GRMYIFEN--TRAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        71 s~~y~l~g--W~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      ...++|.|  -..|-.=.+|++||.|.+....
T Consensus        90 ~Gn~VIAGHrdt~F~~L~~L~~GD~I~v~~~~  121 (174)
T TIGR03784        90 QGNSVIAGHRDTHFAFLQELRPGDVIRLQTPD  121 (174)
T ss_pred             CCcEEEEeeCCccCCChhhCCCCCEEEEEECC
Confidence            34578875  4569999999999999998643


No 153
>PRK06083 sulfur carrier protein ThiS; Provisional
Probab=23.81  E-value=82  Score=19.78  Aligned_cols=18  Identities=28%  Similarity=0.407  Sum_probs=14.1

Q ss_pred             cCCCCCCEEEEEEcCCCC
Q 043432           86 YCLELGDYIMVYKDELEG  103 (105)
Q Consensus        86 k~L~~GD~i~f~~~~~~g  103 (105)
                      ..|++||.|-+..-.++|
T Consensus        67 t~L~egD~IEIv~~VgGG   84 (84)
T PRK06083         67 TVLSSGDAISLFQAIAGG   84 (84)
T ss_pred             ccCCCCCEEEEEEEecCC
Confidence            349999999998866655


No 154
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=23.73  E-value=67  Score=17.84  Aligned_cols=13  Identities=31%  Similarity=0.442  Sum_probs=9.4

Q ss_pred             hcCCCCCCEEEEE
Q 043432           85 RYCLELGDYIMVY   97 (105)
Q Consensus        85 ~k~L~~GD~i~f~   97 (105)
                      +-.+++||+|.+.
T Consensus        15 ~Ls~~~Gd~i~v~   27 (55)
T PF07653_consen   15 ELSFKKGDVIEVL   27 (55)
T ss_dssp             B-EB-TTEEEEEE
T ss_pred             ceEEecCCEEEEE
Confidence            3568899999998


No 155
>cd02781 MopB_CT_Acetylene-hydratase The MopB_CT_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins. The acetylene hydratase of Pelobacter acetylenicus is a tungsten iron-sulfur protein involved in the fermentation of acetylene to ethanol and acetate. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=23.71  E-value=75  Score=20.55  Aligned_cols=20  Identities=15%  Similarity=0.237  Sum_probs=16.1

Q ss_pred             HHHhhcCCCCCCEEEEEEcC
Q 043432           81 AFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~~  100 (105)
                      +=.++.+|+.||.|.++-..
T Consensus        40 ~dA~~~gi~~Gd~V~v~s~~   59 (130)
T cd02781          40 ETAAKLGIADGDWVWVETPR   59 (130)
T ss_pred             HHHHHcCCCCCCEEEEECCC
Confidence            45778999999999887643


No 156
>PF12519 DUF3722:  Protein of unknown function (DUF3722) ;  InterPro: IPR022197  This family of proteins is found in eukaryotes. Proteins in this family are typically between 415 and 473 amino acids in length. 
Probab=23.36  E-value=1.3e+02  Score=23.00  Aligned_cols=14  Identities=36%  Similarity=0.551  Sum_probs=11.0

Q ss_pred             CCcEEeehhhhhcc
Q 043432           23 AGRIVLPKKLAETY   36 (105)
Q Consensus        23 ~~rl~iPk~~ae~~   36 (105)
                      .|||.+|....|+.
T Consensus        88 YGRmylP~s~LeAl  101 (260)
T PF12519_consen   88 YGRMYLPSSRLEAL  101 (260)
T ss_pred             EEEEecChhhhhhh
Confidence            47899998887764


No 157
>PRK09838 periplasmic copper-binding protein; Provisional
Probab=23.11  E-value=77  Score=21.18  Aligned_cols=18  Identities=17%  Similarity=0.067  Sum_probs=13.4

Q ss_pred             hhcCCCCCCEEEEEEcCC
Q 043432           84 KRYCLELGDYIMVYKDEL  101 (105)
Q Consensus        84 ~~k~L~~GD~i~f~~~~~  101 (105)
                      .-.+|++||.|.|.-...
T Consensus        85 ~l~~lk~G~~V~F~~~~~  102 (115)
T PRK09838         85 KMSEIKTGDKVAFNFVQQ  102 (115)
T ss_pred             hhccCCCCCEEEEEEEEc
Confidence            456899999999954333


No 158
>PF00278 Orn_DAP_Arg_deC:  Pyridoxal-dependent decarboxylase, C-terminal sheet domain;  InterPro: IPR022643 These enzymes are collectively known as group IV decarboxylases []. Pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates can be classified into two different families on the basis of sequence similarities [, ]. Members of this family while most probably evolutionary related, do not share extensive regions of sequence similarities. The proteins contain a conserved lysine residue which is known, in mouse ODC [], to be the site of attachment of the pyridoxal-phosphate group. The proteins also contain a stretch of three consecutive glycine residues and has been proposed to be part of a substrate- binding region []. This entry represents the C-terminal region of the Orn/DAP/Arg decarboxylases.; GO: 0003824 catalytic activity; PDB: 1TWI_B 1TUF_A 3MT1_A 3N2B_C 2O0T_A 1HKW_A 1HKV_A 3VAB_A 3N2O_A 7ODC_A ....
Probab=23.06  E-value=59  Score=20.53  Aligned_cols=12  Identities=33%  Similarity=0.678  Sum_probs=9.5

Q ss_pred             CCCCCCEEEEEE
Q 043432           87 CLELGDYIMVYK   98 (105)
Q Consensus        87 ~L~~GD~i~f~~   98 (105)
                      .|++||.|+|.-
T Consensus        82 ~l~~GD~l~f~~   93 (116)
T PF00278_consen   82 ELEVGDWLVFEN   93 (116)
T ss_dssp             TTTTT-EEEESS
T ss_pred             CCCCCCEEEEec
Confidence            899999999954


No 159
>PF15057 DUF4537:  Domain of unknown function (DUF4537)
Probab=22.65  E-value=66  Score=21.57  Aligned_cols=21  Identities=24%  Similarity=0.401  Sum_probs=16.2

Q ss_pred             hcCCCCCCEEEEEEcCCCCCC
Q 043432           85 RYCLELGDYIMVYKDELEGSY  105 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~~~~g~~  105 (105)
                      +..|++||.|.--++..+-+|
T Consensus        53 ~~~L~~GD~VLA~~~~~~~~Y   73 (124)
T PF15057_consen   53 RHSLQVGDKVLAPWEPDDCRY   73 (124)
T ss_pred             cCcCCCCCEEEEecCcCCCEE
Confidence            899999999887776655443


No 160
>PRK09798 antitoxin MazE; Provisional
Probab=22.63  E-value=2e+02  Score=17.87  Aligned_cols=33  Identities=12%  Similarity=0.226  Sum_probs=23.1

Q ss_pred             EEEcCCCCCcceeecChHHHHhhcCCCCCCEEEEEEc
Q 043432           63 FRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        63 ~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~~~   99 (105)
                      ...|.|  |..-.+-  ..|+++-+|..||.|.+.-+
T Consensus         6 v~KwGN--S~~vRIP--k~~l~~l~l~~g~~vei~v~   38 (82)
T PRK09798          6 VKRWGN--SPAVRIP--ATLMQALNLNIDDEVKIDLV   38 (82)
T ss_pred             EEEEcC--cceEEcC--HHHHHHcCCCCCCEEEEEEE
Confidence            456754  4332232  48999999999999988664


No 161
>PF02431 Chalcone:  Chalcone-flavanone isomerase;  InterPro: IPR003466 Chalcone isomerase (5.5.1.6 from EC) also known as chalcone-flavanone isomerase, is a plant enzyme responsible for the isomerisation of chalcone to naringenin a key step in the biosynthesis of flavonoids. The Petunia hybrida (Petunia) genome contains two genes coding for very similar enzymes, ChiA and ChiB, but only the first seems to encode a functional chalcone isomerase. Chalcone isomerase has a core 2-layer alpha/beta structure consisting of beta(3)-alpha(2)-beta-alpha(2)-beta(3) []. This entry represents a subgroup of Chalcone isomerase.; GO: 0016872 intramolecular lyase activity, 0042398 cellular modified amino acid biosynthetic process; PDB: 1JX0_B 1JEP_A 1EYP_B 1JX1_B 1EYQ_B 1FM8_A 1FM7_A 4DOL_A 4DOI_A 4DOK_B ....
Probab=22.54  E-value=63  Score=22.98  Aligned_cols=23  Identities=17%  Similarity=0.179  Sum_probs=16.0

Q ss_pred             HHHHhhc-CCCCCCEEEEEEcCCC
Q 043432           80 RAFIKRY-CLELGDYIMVYKDELE  102 (105)
Q Consensus        80 ~~fV~~k-~L~~GD~i~f~~~~~~  102 (105)
                      ..+...+ .+++||.|.|.|..++
T Consensus       121 ~~~F~~~g~~~kG~~i~l~~~~~g  144 (199)
T PF02431_consen  121 KSLFKSKGSVPKGDVITLTWSPDG  144 (199)
T ss_dssp             HHHHTTB-EE-TT-EEEEEEETTT
T ss_pred             HHHhcccccccCCCEEEEEECCCC
Confidence            4555566 8999999999997654


No 162
>PF12436 USP7_ICP0_bdg:  ICP0-binding domain of Ubiquitin-specific protease 7;  InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found in proteins of the peptidase C19 family, which contains contains ubiquitinyl hydrolases like ubiquitin-specific protease 7 (USP7). USP7 regulates the turnover of p53 [].; PDB: 2KVR_A 2YLM_A.
Probab=22.52  E-value=68  Score=23.92  Aligned_cols=15  Identities=27%  Similarity=0.306  Sum_probs=9.8

Q ss_pred             hcCCCCCCEEEEEEc
Q 043432           85 RYCLELGDYIMVYKD   99 (105)
Q Consensus        85 ~k~L~~GD~i~f~~~   99 (105)
                      ...|+-||+|+|.+.
T Consensus       138 ~~el~~GdIi~fQ~~  152 (249)
T PF12436_consen  138 KAELQDGDIICFQRA  152 (249)
T ss_dssp             HTT--TTEEEEEEE-
T ss_pred             hcccCCCCEEEEEec
Confidence            378888888888884


No 163
>PF00595 PDZ:  PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available;  InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ]. PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated.  PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....
Probab=22.44  E-value=51  Score=19.47  Aligned_cols=12  Identities=42%  Similarity=0.609  Sum_probs=9.0

Q ss_pred             hcCCCCCCEEEE
Q 043432           85 RYCLELGDYIMV   96 (105)
Q Consensus        85 ~k~L~~GD~i~f   96 (105)
                      ..+|++||.|+=
T Consensus        40 ~~gl~~GD~Il~   51 (81)
T PF00595_consen   40 RAGLKVGDRILE   51 (81)
T ss_dssp             HHTSSTTEEEEE
T ss_pred             hcccchhhhhhe
Confidence            334999999863


No 164
>COG2208 RsbU Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]
Probab=22.40  E-value=49  Score=25.68  Aligned_cols=22  Identities=27%  Similarity=0.474  Sum_probs=19.9

Q ss_pred             ChHHHHhhcCCCCCCEEEEEEc
Q 043432           78 NTRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        78 gW~~fV~~k~L~~GD~i~f~~~   99 (105)
                      .|..++.+..|+.||.+++|-|
T Consensus       283 ~~~~~~~~~~l~~gd~lvl~tD  304 (367)
T COG2208         283 DYQYEVASLQLEPGDLLVLYTD  304 (367)
T ss_pred             CccchheeEEecCCCEEEEEcC
Confidence            5888899999999999999976


No 165
>TIGR01080 rplX_A_E ribosomal protein L24p/L26e, archaeal/eukaryotic. This model represents the archaeal and eukaryotic branch of the ribosomal protein L24p/L26e family. Bacterial and organellar forms are represented by the related TIGR01079.
Probab=22.24  E-value=67  Score=21.55  Aligned_cols=22  Identities=14%  Similarity=0.389  Sum_probs=18.3

Q ss_pred             HhhcCCCCCCEEEEEEcCCCCC
Q 043432           83 IKRYCLELGDYIMVYKDELEGS  104 (105)
Q Consensus        83 V~~k~L~~GD~i~f~~~~~~g~  104 (105)
                      +++..++.||.|.+......|+
T Consensus        37 ~r~~~IkkGD~V~Vi~Gk~KGk   58 (114)
T TIGR01080        37 KRALPVRKGDKVRIMRGDFKGH   58 (114)
T ss_pred             cccceeecCCEEEEecCCCCCC
Confidence            6777899999999998776663


No 166
>KOG4146 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=22.10  E-value=93  Score=20.44  Aligned_cols=17  Identities=35%  Similarity=0.419  Sum_probs=13.4

Q ss_pred             HhhcCCCCCCEEEEEEc
Q 043432           83 IKRYCLELGDYIMVYKD   99 (105)
Q Consensus        83 V~~k~L~~GD~i~f~~~   99 (105)
                      -.+..|+.||.|+|.-.
T Consensus        81 kedy~ledgD~ivfiST   97 (101)
T KOG4146|consen   81 KEDYPLEDGDHIVFIST   97 (101)
T ss_pred             ccccCcccCCEEEEEEe
Confidence            34568999999999754


No 167
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=22.07  E-value=63  Score=21.70  Aligned_cols=14  Identities=36%  Similarity=0.430  Sum_probs=11.5

Q ss_pred             cCCCCCCEEEEEEc
Q 043432           86 YCLELGDYIMVYKD   99 (105)
Q Consensus        86 k~L~~GD~i~f~~~   99 (105)
                      +-|+.||.|++.++
T Consensus        51 n~L~dGDsV~lIKD   64 (112)
T COG2824          51 NLLADGDSVTLIKD   64 (112)
T ss_pred             cEeccCCeEEEEEe
Confidence            45888999999886


No 168
>KOG1765 consensus Regulator of ribosome synthesis [Translation, ribosomal structure and biogenesis]
Probab=22.07  E-value=50  Score=23.89  Aligned_cols=62  Identities=16%  Similarity=0.154  Sum_probs=35.6

Q ss_pred             CCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecChHHHHhhcCCCCCCEEEEEEcCCCCCC
Q 043432           37 LPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENTRAFIKRYCLELGDYIMVYKDELEGSY  105 (105)
Q Consensus        37 lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i~f~~~~~~g~~  105 (105)
                      ||.-.-.+++.+.+=+. +-.   |   =|...-++..-.|.|..|++.||.+.--.=.+.+|+.+|-|
T Consensus        60 lp~~rt~e~vv~qLPe~-Tt~---L---PReK~lPr~k~~TkWe~FAr~KGI~krKk~~lV~DEasgew  121 (181)
T KOG1765|consen   60 LPSKRTEEGVVVQLPEP-TTR---L---PREKPLPRPKPETKWERFARKKGIEKRKKEKLVYDEASGEW  121 (181)
T ss_pred             CcccccccceeEeCCCc-ccc---C---ccccCCCCCCCccHHHHHHHHcCcchhhccCcceecccccc
Confidence            34443456676666554 211   0   01111234456788999999999987444446666666643


No 169
>cd04497 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB folds similar to the first OB fold (OB1) of human protection of telomeres 1 protein (hPOT1), the single OB fold of the N-terminal domain of Schizosaccharomyces pombe POT1 (SpPOT1), and the first OB fold of the N-terminal domain of the alpha subunit (OB1Nalpha) of Oxytricha nova telomere end binding protein (OnTEBP). POT1 proteins recognize single-stranded (ss) 3-prime ends of the telomere. A 3-prime ss overhang is conserved in ciliated protozoa, yeast, and mammals. SpPOT1 is essential for telomere maintenance. It binds specifically to the ss G-rich telomeric sequence (GGTTAC) of S. pombe. hPOT1 binds specifically to ss telomeric DNA repeats ending with the sequence GGTTAG. Deletion of the S. pombe pot1+ gene results in a rapid loss of telomere sequences, chromosome mis-segregation and chromosome circularization. hPOT1 is implicated in telomere length regulation. The hPOT1 monomer consists of two closely connected OB folds (OB1-OB
Probab=22.01  E-value=1.7e+02  Score=19.67  Aligned_cols=11  Identities=27%  Similarity=0.754  Sum_probs=9.0

Q ss_pred             CCCCCEEEEEE
Q 043432           88 LELGDYIMVYK   98 (105)
Q Consensus        88 L~~GD~i~f~~   98 (105)
                      +.+||+|.|.+
T Consensus        69 v~~GDVIll~~   79 (138)
T cd04497          69 VKVGDIILLRR   79 (138)
T ss_pred             CCCCCEEEEEE
Confidence            68899998865


No 170
>PRK11479 hypothetical protein; Provisional
Probab=21.80  E-value=56  Score=25.20  Aligned_cols=17  Identities=24%  Similarity=0.170  Sum_probs=14.2

Q ss_pred             HHHhhcCCCCCCEEEEE
Q 043432           81 AFIKRYCLELGDYIMVY   97 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~   97 (105)
                      .-|....|++||.|.|-
T Consensus        58 ~~Vs~~~LqpGDLVFfs   74 (274)
T PRK11479         58 KEITAPDLKPGDLLFSS   74 (274)
T ss_pred             cccChhhCCCCCEEEEe
Confidence            46788899999998874


No 171
>PF02080 TrkA_C:  TrkA-C domain;  InterPro: IPR006037 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus. The domain is prevalent among prokaryotic K+ channels, and also found in eukaryotic, high-conductance Ca2+-activated K+ channels (BK channels) [, , ]. Largely involved in redox-linked regulation of potassium channels, the N-terminal part of the RCK domain is predicted to be an active dehydrogenase at least in some cases []. Some have a conserved sequence motif (G-x-G-x-x-G-x(n)-[DE]) for NAD+ binding [], but others do not, reflecting the diversity of ligands for RCK domains. The C-terminal part is less conserved, being absent in some channels, such as the kefC antiporter from Escherichia coli. It is predicted to bind unidentified ligands and to regulate sulphate, sodium and other transporters. The X-ray structure of several RCK domains has been solved [, , ]. It reveals an alpha-beta fold similar to dehydrogenase enzymes. The domain forms a homodimer, producing a cleft between two lobes. It has a composite structure, with an N-terminal (RCK-N), and a C-terminal (RCK-C) subdomain. The RCK-N subdomain forms a Rossmann fold with two alpha helices on one side of a six stranded parallel beta sheet and three alpha helices on the other side. The RCK-C subdomain is an all-beta-strand fold. It forms an extention of the dimer interface and further stabilises the RCK homodimer [, , ]. Ca2+ is a ligand that opens the channel in a concentration-dependent manner. Two Ca2+ ions are located at the base of a cleft between two RCK domains, coordinated by the carboxylate groups of two glutamate residues, and by an aspartate residue [, , ]. RCK domains occur in at least five different contexts:   As a single domain on the C terminus of some K+ channels (for example, many prokaryotic K+ channels).  As two tandem RCK domains on the C terminus of some transporters that form gating rings (for example, eukaryotic BK channels). The gating ring has an arrangement of eight identical RCK domains, one from each of the four pore-forming subunits and four from the intracellular solution. As two domains, one at the N terminus and another at the C terminus of transporter (for example, the prokaryotic trk system potassium uptake protein A). As a soluble protein (not part of a K+ channel) consisting of two tandem RCK domains. As a soluble protein consisting of a single RCK domain.   This entry represents the C-terminal subdomain of RCK.; GO: 0008324 cation transmembrane transporter activity, 0006813 potassium ion transport; PDB: 2BKP_A 1VCT_A 2BKO_A 2BKN_A 3L4B_C 2FY8_D 2AEF_A 1LNQ_E 3RBX_C 3KXD_A ....
Probab=21.72  E-value=44  Score=19.11  Aligned_cols=14  Identities=36%  Similarity=0.581  Sum_probs=9.2

Q ss_pred             cCCCCCCEEEEEEc
Q 043432           86 YCLELGDYIMVYKD   99 (105)
Q Consensus        86 k~L~~GD~i~f~~~   99 (105)
                      -.|++||.+.+.-+
T Consensus        46 ~~l~~gD~l~v~g~   59 (71)
T PF02080_consen   46 TVLQAGDILIVVGD   59 (71)
T ss_dssp             -BE-TTEEEEEEEE
T ss_pred             CEECCCCEEEEEEC
Confidence            35789999988643


No 172
>cd02793 MopB_CT_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR),  trimethylamine N-oxide reductase (TMAOR) and other related proteins. DMSOR always catalyzes the reduction of DMSO to dimethylsulfide, but its cellular location and oligomerization state are organism-dependent. For example, in Rhodobacter sphaeriodes and Rhodobacter capsulatus, it is an 82-kDa monomeric soluble protein found in the periplasmic space; in E. coli, it is membrane-bound and exists as a heterotrimer. BSOR catalyzes the reduction of biotin sulfixode to biotin, and is unique among Mo enzymes because no additional auxiliary proteins or cofactors are required. TMAOR is similar to DMSOR, but its only natural substrate is TMAO.This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=21.65  E-value=87  Score=20.50  Aligned_cols=19  Identities=26%  Similarity=0.301  Sum_probs=15.6

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=+.+.+|+.||.|.++-.
T Consensus        40 ~dA~~~gi~~Gd~V~v~s~   58 (129)
T cd02793          40 ADAAARGIADGDIVRVFND   58 (129)
T ss_pred             HHHHHcCCCCCCEEEEEcC
Confidence            3478999999999988754


No 173
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=21.52  E-value=50  Score=20.68  Aligned_cols=18  Identities=22%  Similarity=0.165  Sum_probs=13.8

Q ss_pred             HHHhhcCCCCCCEEEEEE
Q 043432           81 AFIKRYCLELGDYIMVYK   98 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~   98 (105)
                      .++....+++||.|.|..
T Consensus        45 ~~~~~~~~~pGDlif~~~   62 (105)
T PF00877_consen   45 KRVPISELQPGDLIFFKG   62 (105)
T ss_dssp             EHEEGGG-TTTEEEEEEG
T ss_pred             cccchhcCCcccEEEEeC
Confidence            367888999999988765


No 174
>PF03459 TOBE:  TOBE domain;  InterPro: IPR005116  The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner. It is probably involved in the recognition of small ligands such as molybdenum (P46930 from SWISSPROT) and sulphate (P16676 from SWISSPROT), and is found in ABC transporters immediately after the ATPase domain.; GO: 0005215 transporter activity, 0005524 ATP binding, 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0006810 transport, 0043190 ATP-binding cassette (ABC) transporter complex; PDB: 1G29_2 1H9M_B 1H9J_A 1H9K_A 1H9R_B 1O7L_C 1H9S_A 1B9N_A 1B9M_A 1GUS_C ....
Probab=21.25  E-value=1e+02  Score=17.28  Aligned_cols=22  Identities=18%  Similarity=0.132  Sum_probs=15.3

Q ss_pred             hHHHHhhcCCCCCCEEEEEEcC
Q 043432           79 TRAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        79 W~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      -.+-..+-+|++||.|.+.=+.
T Consensus        38 t~~~~~~L~L~~G~~V~~~ik~   59 (64)
T PF03459_consen   38 TPESAEELGLKPGDEVYASIKA   59 (64)
T ss_dssp             EHHHHHHCT-STT-EEEEEE-G
T ss_pred             cHHHHHHcCCCCCCEEEEEEeh
Confidence            3578889999999999986543


No 175
>cd02789 MopB_CT_FmdC-FwdD The MopB_FmdC-FwdD CD includes the  C-terminus of subunit C of molybdenum formylmethanofuran dehydrogenase (FmdC) and subunit D of tungsten formylmethanofuran dehydrogenase (FwdD), and other related proteins. Formylmethanofuran dehydrogenase catalyzes the first step in methane formation from CO2 in methanogenic archaea and some eubacteria. Members of this CD belong to the molybdopterin_binding superfamily of proteins. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=21.24  E-value=92  Score=19.86  Aligned_cols=19  Identities=21%  Similarity=0.065  Sum_probs=15.4

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=.++.+|+.||.|.++-.
T Consensus        38 ~dA~~lgi~~Gd~V~v~~~   56 (106)
T cd02789          38 EDYKLLGKPEGDKVKVTSE   56 (106)
T ss_pred             HHHHHcCCCCCCEEEEEcC
Confidence            3388999999999988743


No 176
>cd02794 MopB_CT_DmsA-EC The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted N-terminal iron-sulfur [4Fe-4S] cluster binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=21.23  E-value=99  Score=19.86  Aligned_cols=19  Identities=21%  Similarity=0.319  Sum_probs=15.4

Q ss_pred             HHHhhcCCCCCCEEEEEEc
Q 043432           81 AFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        81 ~fV~~k~L~~GD~i~f~~~   99 (105)
                      +=+++.+++.||.|.++-.
T Consensus        37 ~~A~~~gi~~Gd~V~v~s~   55 (121)
T cd02794          37 LDAAARGIKDGDRVLVFND   55 (121)
T ss_pred             HHHHHcCCCCCCEEEEEcC
Confidence            3478899999999988754


No 177
>PRK09681 putative type II secretion protein GspC; Provisional
Probab=21.13  E-value=1e+02  Score=23.74  Aligned_cols=22  Identities=18%  Similarity=0.398  Sum_probs=17.1

Q ss_pred             eeec-C-hHHHHhhcCCCCCCEEE
Q 043432           74 YIFE-N-TRAFIKRYCLELGDYIM   95 (105)
Q Consensus        74 y~l~-g-W~~fV~~k~L~~GD~i~   95 (105)
                      |.++ | =....++-+|+.||+++
T Consensus       209 Yrl~Pgkd~~lF~~~GLq~GDva~  232 (276)
T PRK09681        209 YAVKPGADRSLFDASGFKEGDIAI  232 (276)
T ss_pred             EEECCCCcHHHHHHcCCCCCCEEE
Confidence            4454 3 35889999999999986


No 178
>cd01753 PLAT_LOX PLAT domain of 12/15-lipoxygenase. As a unique subfamily of the mammalian lipoxygenases, they catalyze enzymatic lipid peroxidation in complex biological structures via direct dioxygenation of phospholipids and cholesterol esters of biomembranes and plasma lipoproteins. Both types of enzymes are cytosolic but need this domain to access their sequestered membrane or micelle bound substrates.
Probab=21.07  E-value=1.2e+02  Score=19.83  Aligned_cols=47  Identities=11%  Similarity=0.116  Sum_probs=26.6

Q ss_pred             CCCCCCCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCCC
Q 043432           18 SDVNAAGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPNN   69 (105)
Q Consensus        18 SDv~~~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~~   69 (105)
                      .|++...++.|=.+..- .-|.-   .=-.|.|.|.. +++|.|-|..|-.+
T Consensus        58 ~~lG~l~~i~i~~d~~g-~~~~W---~l~~V~V~~~~-~~~~~F~c~rWl~~  104 (113)
T cd01753          58 EDLGELLLVRLRKRKYL-LFDAW---FCNYITVTGPG-GDEYHFPCYRWIEG  104 (113)
T ss_pred             cCCCCcEEEEEEECCCC-CCCCe---eecEEEEEcCC-CCEEEEEhHHeECC
Confidence            45665556665543321 11110   00256777885 89999988888643


No 179
>COG2947 Uncharacterized conserved protein [Function unknown]
Probab=21.00  E-value=1.2e+02  Score=21.54  Aligned_cols=19  Identities=26%  Similarity=0.726  Sum_probs=15.7

Q ss_pred             HHHHhhcCCCCCCEEEEEEcC
Q 043432           80 RAFIKRYCLELGDYIMVYKDE  100 (105)
Q Consensus        80 ~~fV~~k~L~~GD~i~f~~~~  100 (105)
                      .+|.|+  .+.||.+.||-..
T Consensus        36 RNfmR~--M~iGD~~fFYHSN   54 (156)
T COG2947          36 RNFMRD--MKIGDLGFFYHSN   54 (156)
T ss_pred             HHHHHh--cccCceEEEEecC
Confidence            467777  8899999999864


No 180
>cd00113 PLAT PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology 2)  domain.  It consists of an eight stranded beta-barrel. The domain can be found in various domain architectures, in case of lipoxygenases, alpha toxin, lipases and polycystin, but also as a single domain or as repeats.The putative function of this domain is to facilitate access to sequestered membrane or micelle bound substrates.
Probab=20.88  E-value=1.2e+02  Score=19.17  Aligned_cols=22  Identities=23%  Similarity=0.452  Sum_probs=16.5

Q ss_pred             EEEEEECCCCeEEEEEEEEcCC
Q 043432           47 WMHLEDMDFNKVWTFKFRFWPN   68 (105)
Q Consensus        47 ~l~~~D~~~g~~W~fr~~~~~~   68 (105)
                      .|.|+|..+|+.+.|-+..|..
T Consensus        83 ~V~V~~~~~~~~~~F~~~~Wl~  104 (116)
T cd00113          83 SITVQALGTKKVYTFPVNRWVL  104 (116)
T ss_pred             EEEEEeCCCCCEEEEEeCCCcc
Confidence            4677887667888888887754


No 181
>PF03152 UFD1:  Ubiquitin fusion degradation protein UFD1;  InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway. Several proteins involved in this pathway have been identified []. This family includes UFD1, a 40kDa protein that is essential for vegetative cell viability []. The human UFD1 gene is expressed at high levels during embryogenesis, especially in the eyes and in the inner ear primordia and is thought to be important in the determination of ectoderm-derived structures, including neural crest cells. In addition, this gene is deleted in the CATCH-22 (cardiac defects, abnormal facies, thymic hypoplasia, cleft palate and hypocalcaemia with deletions on chromosome 22) syndrome. This clinical syndrome is associated with a variety of developmental defects, all characterised by microdeletions on 22q11.2. Two such developmental defects are the DiGeorge syndrome OMIM:188400, and the velo-cardio- facial syndrome OMIM:145410. Several of the abnormalities associated with these conditions are thought to be due to defective neural crest cell differentiation []. ; GO: 0006511 ubiquitin-dependent protein catabolic process; PDB: 1ZC1_A 2YUJ_A.
Probab=20.64  E-value=3.3e+02  Score=19.50  Aligned_cols=77  Identities=14%  Similarity=0.181  Sum_probs=39.2

Q ss_pred             ccCCCCCCCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeE-EEEEEEEcCCCCCcceeecChHHHHhhcCCCCCCEE
Q 043432           16 KNSDVNAAGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKV-WTFKFRFWPNNRGRMYIFENTRAFIKRYCLELGDYI   94 (105)
Q Consensus        16 T~SDv~~~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~-W~fr~~~~~~~~s~~y~l~gW~~fV~~k~L~~GD~i   94 (105)
                      ..++++.++++++|...++... ..+-...+.+.+....+++. +-=..-|.  ...+.-+|-.|  ..+.-+|++||.|
T Consensus        18 ~~~~~~~gdKiiLP~s~L~~L~-~~~~~~P~~F~i~n~~~~~~th~GVlEFs--A~eG~i~lP~w--mm~~L~l~~g~~V   92 (176)
T PF03152_consen   18 DRPELEYGDKIILPPSALDELS-RLNIPYPMLFEISNPDNGKRTHCGVLEFS--AEEGTIYLPPW--MMQNLGLQEGDIV   92 (176)
T ss_dssp             S-CCCCCTTEEEE-HHHHHHHH-HTT--SS-EEEEEETTTTEEEEEEEEEE----CTTEEEE-CH--HHHHHT--TTEEE
T ss_pred             CCcccCCCCeEEcCHHHHHHHH-hccCCCCEEEEEecCCCCcEEEEEEEEeE--cCCCeEEeCcc--HHhhcCCCCCCEE
Confidence            4556667789999976655431 12223346677776643432 22112222  23344556678  4677899999999


Q ss_pred             EEE
Q 043432           95 MVY   97 (105)
Q Consensus        95 ~f~   97 (105)
                      .+-
T Consensus        93 ~v~   95 (176)
T PF03152_consen   93 RVE   95 (176)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            763


No 182
>cd02899 PLAT_SR Scavenger receptor protein. A subfamily of PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology 2)  domain.  It consists of an eight stranded beta-barrel. The domain can be found in various domain architectures, in case of lipoxygenases, alpha toxin, lipases and polycystin, but also as a single domain or as repeats.The putative function of this domain is to facilitate access to sequestered membrane or micelle bound substrates. This subfamily contains Toxoplasma gondii Scavenger protein TgSR1.
Probab=20.46  E-value=1.2e+02  Score=20.05  Aligned_cols=46  Identities=20%  Similarity=0.330  Sum_probs=27.7

Q ss_pred             ccCCCCCCCcEEeehhhhhccCCCCCCCCCEEEEEEECCCCeEEEEEEEEcCC
Q 043432           16 KNSDVNAAGRIVLPKKLAETYLPPVNEKAGFWMHLEDMDFNKVWTFKFRFWPN   68 (105)
Q Consensus        16 T~SDv~~~~rl~iPk~~ae~~lP~l~~~~~~~l~~~D~~~g~~W~fr~~~~~~   68 (105)
                      ++.|++.+..|.|-+.-  ..=+..-    -.|.|.|. +|+.|.|-|..|-.
T Consensus        52 ~~~dLG~l~~i~l~n~g--~~~~Wf~----~~V~V~~~-~g~~~~Fpc~rWla   97 (109)
T cd02899          52 RAADVGDINAIILSNTA--LNDPWYC----DYVRIKSE-DGKVFAFNVKRWIG   97 (109)
T ss_pred             CccccCceEEEEEECCC--CCCCcee----eEEEEECC-CCCEEEEEcceeeC
Confidence            47777766666663211  0001110    25677886 68999999999953


No 183
>PF12791 RsgI_N:  Anti-sigma factor N-terminus;  InterPro: IPR024449 The heat shock genes in Bacillus subtilis can be classified into several groups according to their regulation [], and the sigma gene, sigI, of Bacillus subtilis belongs to the group IV heat-shock response genes and has many orthologues in the bacterial phylum Firmicutes []. Regulation of sigma factor I is carried out by RsgI from the same operon. This entry represents the N-terminal cytoplasmic portion of RsgI ('upstream' of the single transmembrane helix) which has been shown to interact directly with Sigma-I [].
Probab=20.45  E-value=57  Score=18.36  Aligned_cols=27  Identities=11%  Similarity=0.153  Sum_probs=17.8

Q ss_pred             ceeec--C-hHHHHhhcCCCCCCEEEEEEc
Q 043432           73 MYIFE--N-TRAFIKRYCLELGDYIMVYKD   99 (105)
Q Consensus        73 ~y~l~--g-W~~fV~~k~L~~GD~i~f~~~   99 (105)
                      ..+||  | ....-+..+.+.||.|.|...
T Consensus         8 aiVlT~dGeF~~ik~~~~~~vG~eI~~~~~   37 (56)
T PF12791_consen    8 AIVLTPDGEFIKIKRKPGMEVGQEIEFDEK   37 (56)
T ss_pred             EEEEcCCCcEEEEeCCCCCcccCEEEEech
Confidence            35666  3 444445556888999998764


No 184
>PRK06788 flagellar motor switch protein; Validated
Probab=20.33  E-value=73  Score=21.54  Aligned_cols=13  Identities=38%  Similarity=0.447  Sum_probs=10.6

Q ss_pred             cCCCCCCEEEEEE
Q 043432           86 YCLELGDYIMVYK   98 (105)
Q Consensus        86 k~L~~GD~i~f~~   98 (105)
                      .+|++||+|.+=+
T Consensus        53 L~L~vGDVI~Ldk   65 (119)
T PRK06788         53 KQLKVGDVLEVEK   65 (119)
T ss_pred             hCCCCCCEEEeCC
Confidence            4799999999843


No 185
>PF13356 DUF4102:  Domain of unknown function (DUF4102); PDB: 3JU0_A 3RMP_A 3JTZ_A 2KJ8_A.
Probab=20.26  E-value=1.6e+02  Score=17.98  Aligned_cols=34  Identities=15%  Similarity=0.346  Sum_probs=19.1

Q ss_pred             CCCEEEEEEECCCCeEEEEEEEEcCCCCCcceeecCh
Q 043432           43 KAGFWMHLEDMDFNKVWTFKFRFWPNNRGRMYIFENT   79 (105)
Q Consensus        43 ~~~~~l~~~D~~~g~~W~fr~~~~~~~~s~~y~l~gW   79 (105)
                      ..|..|.|.-. +.+.|.|+|..-  ++.+...|..|
T Consensus        22 ~~GL~l~v~~~-G~kt~~~r~~~~--gk~~~~~lG~~   55 (89)
T PF13356_consen   22 VPGLYLRVTPS-GSKTFYFRYRIN--GKRRRITLGRY   55 (89)
T ss_dssp             STTEEEEE-TT-S-EEEEEEEEET--TEEEEEEEEEC
T ss_pred             CCCcEEEEEeC-CCeEEEEEEEec--ceEEEeccCCC
Confidence            35777788744 468899888543  55444333325


Done!