BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043434
         (90 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9HUW5|DSBD1_PSEAE Thiol:disulfide interchange protein DsbD 1 OS=Pseudomonas
           aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 /
           LMG 12228) GN=dsbD1 PE=3 SV=1
          Length = 591

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 16  GFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRR 50
           G P +L  A  GD+   + VIG+ID   LA  LRR
Sbjct: 552 GPPAILFFAPGGDEWSDLRVIGEIDAAGLAERLRR 586


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.323    0.140    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,585,658
Number of Sequences: 539616
Number of extensions: 1279118
Number of successful extensions: 3418
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3414
Number of HSP's gapped (non-prelim): 4
length of query: 90
length of database: 191,569,459
effective HSP length: 60
effective length of query: 30
effective length of database: 159,192,499
effective search space: 4775774970
effective search space used: 4775774970
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)