BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043458
         (736 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1DQ3|A Chain A, Crystal Structure Of An Archaeal Intein-Encoded Homing
           Endonuclease Pi-Pfui
          Length = 454

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 15/72 (20%)

Query: 660 EAQLYAANELYNR----GWFYHKEHRLWFIRVPNVEPLVKTNAYERGSYHCFDPNTFETI 715
           E  L    E+Y R    G FY +E+  W I V NV   VK+          FDP +   +
Sbjct: 15  EEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKS----------FDPESKRVV 64

Query: 716 R-KDNFVVHYEM 726
           + K N +  YE+
Sbjct: 65  KGKVNVIWKYEL 76


>pdb|3QI7|A Chain A, Crystal Structure Of A Putative Transcriptional Regulator
           (Yp_001089212.1) From Clostridium Difficile 630 At 1.86
           A Resolution
 pdb|3QI7|B Chain B, Crystal Structure Of A Putative Transcriptional Regulator
           (Yp_001089212.1) From Clostridium Difficile 630 At 1.86
           A Resolution
          Length = 371

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 532 PSQFRLQQMSAVNQSFRNQDMKSIQAAHSTPDPFGLLGLLSVIKMSDPDLTSLA 585
           P  F     SA+N+  +  D K +QA   + D  GLL  L  +K   P++ +++
Sbjct: 65  PENFTSNIDSAINKIVKLADDKEVQAIVVSTDQAGLLPALQKVKEKRPEIITIS 118


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.133    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,879,213
Number of Sequences: 62578
Number of extensions: 796069
Number of successful extensions: 1408
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1407
Number of HSP's gapped (non-prelim): 2
length of query: 736
length of database: 14,973,337
effective HSP length: 106
effective length of query: 630
effective length of database: 8,340,069
effective search space: 5254243470
effective search space used: 5254243470
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)