BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 043463
(149 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3IK2|A Chain A, Crystal Structure Of A Glycoside Hydrolase Family 44
Endoglucanase Produced By Clostridium Acetobutylium Atcc
824
Length = 517
Score = 26.6 bits (57), Expect = 6.3, Method: Composition-based stats.
Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 10/63 (15%)
Query: 27 SEGLKEDVRHIRITNKIDPGVDLTFECKSRDDDFGKKVLHYNTYWEFQFRPNFWGTTRYY 86
SE L +D + ++ KIDP + FG + ++ + +F P++ Y
Sbjct: 199 SEVLDKDTQLAQVVKKIDPAAE----------TFGPALFGFSAFNDFNSSPDWSSVKGNY 248
Query: 87 CWF 89
WF
Sbjct: 249 QWF 251
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.145 0.522
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,214,811
Number of Sequences: 62578
Number of extensions: 224414
Number of successful extensions: 517
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 514
Number of HSP's gapped (non-prelim): 11
length of query: 149
length of database: 14,973,337
effective HSP length: 90
effective length of query: 59
effective length of database: 9,341,317
effective search space: 551137703
effective search space used: 551137703
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 47 (22.7 bits)