BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043463
         (149 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IK2|A Chain A, Crystal Structure Of A Glycoside Hydrolase Family 44
           Endoglucanase Produced By Clostridium Acetobutylium Atcc
           824
          Length = 517

 Score = 26.6 bits (57), Expect = 6.3,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 10/63 (15%)

Query: 27  SEGLKEDVRHIRITNKIDPGVDLTFECKSRDDDFGKKVLHYNTYWEFQFRPNFWGTTRYY 86
           SE L +D +  ++  KIDP  +           FG  +  ++ + +F   P++      Y
Sbjct: 199 SEVLDKDTQLAQVVKKIDPAAE----------TFGPALFGFSAFNDFNSSPDWSSVKGNY 248

Query: 87  CWF 89
            WF
Sbjct: 249 QWF 251


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.145    0.522 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,214,811
Number of Sequences: 62578
Number of extensions: 224414
Number of successful extensions: 517
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 514
Number of HSP's gapped (non-prelim): 11
length of query: 149
length of database: 14,973,337
effective HSP length: 90
effective length of query: 59
effective length of database: 9,341,317
effective search space: 551137703
effective search space used: 551137703
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 47 (22.7 bits)