Citrus Sinensis ID: 043470

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63

MAVVPPTATTPASLYVGDLHPDVTDGELFDAFSEFKSLASVRVCKDSTTGRSTCYGYVNFLSPHDAIRAIEVKNHTQLHGKMLRISWSCRDPDARKSGVANLFVKNLIESIDNVRLQEMFQNFGNIISCKVATSEDGKSKGHGFVQFETEESANAAIENLNGTTVGDKRIYVGRFIKKSDRVLPSPAAKYTNLFMKNLDSDVTEEHLVEKFSKFGKIASLLIARDENGTSRGFGFVNFDNPDDARRALEAMNGSVIGSKVLYAARAQKKAEREQILRHQFEEKRKERILKYKGSNVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPLPVNPKHNRQNRGRMNGNMLPQVGAHYMQQSSQSAASSKDSSNQQKGGQSKYVPNGRIRELNKGSGVSLGTFNSGGVMARKPDMLNGMLAAPSPEQQKQILGERLYPLVEKHKPDLVAKITGMLLEMDNSELLLLLESPESLAVKVEEAVQVLKLSEAKVSTQEAIHPNYLSAEVAVN

ccccccccccccEEEEccccccccHHHHHHHHcccccccEEEEEccccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEccccccccccccccEEEEccccccccHHHHHHHHHccccccEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccccccCEEEEEEcccccccccccccccccEEccccccccccHHHHHHHHcccccEEEEEEEEccccccccCEEEEcccHHHHHHHHHHHcccEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEccccccCEEEEEEcccHHHHHHHHHHHcccccccEEEEEEEEccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc

********TTPASLYVGDLHPDVTDGELFDAFSEFKSLASVRVCKDSTTGRSTCYGYVNFLSPHDAIRAIEVKNHTQLHGKMLRISWSCRDPDARKSGVANLFVKNLIESIDNVRLQEMFQNFGNIISCKVATSEDGKSKGHGFVQFETEESANAAIENLNGTTVGDKRIYVGRFIKKSDRVLPSPAAKYTNLFMKNLDSDVTEEHLVEKFSKFGKIASLLIARDENGTSRGFGFVNFDNPDDARRALEAMNGSVIGSKVLYAA*********************ERILKYKGSNVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVP**********************************************************************************************************QKQILGERLYPLVEKHKPDLVAKITGMLLEMDNSELLLLLESPESLAVKVEEAVQVLKLS****************AEVAV*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAVVPPTATTPASLYVGDLHPDVTDGELFDAFSEFKSLASVRVCKDSTTGRSTCYGYVNFLSPHDAIRAIEVKNHTQLHGKMLRISWSCRDPDARKSGVANLFVKNLIESIDNVRLQEMFQNFGNIISCKVATSEDGKSKGHGFVQFETEESANAAIENLNGTTVGDKRIYVGRFIKKSDRVLPSPAAKYTNLFMKNLDSDVTEEHLVEKFSKFGKIASLLIARDENGTSRGFGFVNFDNPDDARRALEAMNGSVIGSKVLYxxxxxxxxxxxxxxxxxxxxxRKERILKYKGSNVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPLPVNPKHNRQNRGRMNGNMLPQVGAHYMQQSSQSAASSKDSSNQQKGGQSKYVPNGRIRELNKGSGVSLGTFNSGGVMARKPDMLNGMLAAPSPEQQKQILGERLYPLVEKHKPDLVAKITGMLLEMDNSELLLLLESPESLAVKVEEAVQVLKLSEAKVSTQEAIHPNYLSAEVAVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable polyadenylate-binding protein At2g36660	Binds the poly(A) tail of mRNA.	probable	Q9ZQA8
Polyadenylate-binding protein 1-A	Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation.	probable	Q54BM2
Polyadenylate-binding protein, cytoplasmic and nuclear	Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation. In the nucleus, involved in both mRNA cleavage and polyadenylation. Is also required for efficient mRNA export to the cytoplasm. Acts in concert with a poly(A)-specific nuclease (PAN) to affect poly(A) tail shortening, which may occur concomitantly with either nucleocytoplasmic mRNA transport or translational initiation. In the cytoplasm, stimulates translation initiation and regulates mRNA decay through translation termination-coupled poly(A) shortening, probably mediated by PAN.	probable	P31209

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F25, chain A
Confidence level:very confident
Coverage over the Query: 99-180
View the alignment between query and template
View the model in PyMOL

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 186-268,292-370
View the alignment between query and template
View the model in PyMOL

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 6-176
View the alignment between query and template
View the model in PyMOL

Template: 1G9L, chain A
Confidence level:very confident
Coverage over the Query: 535-626
View the alignment between query and template
View the model in PyMOL