Citrus Sinensis ID: 043474


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MDHTLQNTHVKLLAFDLLSLTPTPDPATFSRSGKLLSRAEIVGTITSRDHKPSKFIKFTVDDGTGCVPCVLWLNHLTSLYLPRRDPSTVRLIAGVATDFAAKIKIGLVARVRGRIASYRGDVQITVSDVVIEKDPNMEVLHWLDCLRLARKRYDVVVNKS
cccccHHHHHHHHHHHHHHcccccccccEEEccCEEEEEEEEEEEEEEECccccEEEEEECccccEEEEEEEcccccccccccccccHHHHHccccHHHHHccccccEEEEEEEEcEEccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccc
***TLQNTHVKLLAFDLLSLTPT*DPATFSRSGKLLSRAEIVGTITSRDHKPSKFIKFTVDDGTGCVPCVLWLNHL*********PSTVRLIAGVATDFAAKIKIGLVARVRGRIASYRGDVQITVSDVVIEKDPNMEVLHWLDCLRLARKRYDVVV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHTLQNTHVKLLAFDLLSLTPTPDPATFSRSGKLLSRAEIVGTITSRDHKPSKFIKFTVDDGTGCVPCVLWLNHLTSLYLPRRDPSTVRLIAGVATDFAAKIKIGLVARVRGRIASYRGDVQITVSDVVIEKDPNMEVLHWLDCLRLARKRYDVVVNKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CST complex subunit STN1 Component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves.probableQ9LMK5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KF6, chain A
Confidence level:very confident
Coverage over the Query: 7-78,96-157
View the alignment between query and template
View the model in PyMOL