BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043478
         (145 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat
          Didomain As A Framework For Inhibitor Design.
 pdb|3HHD|B Chain B, Structure Of The Human Fatty Acid Synthase Ks-Mat
          Didomain As A Framework For Inhibitor Design.
 pdb|3HHD|C Chain C, Structure Of The Human Fatty Acid Synthase Ks-Mat
          Didomain As A Framework For Inhibitor Design.
 pdb|3HHD|D Chain D, Structure Of The Human Fatty Acid Synthase Ks-Mat
          Didomain As A Framework For Inhibitor Design
          Length = 965

 Score = 26.2 bits (56), Expect = 6.3,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 7  KELQEGNHMKLSSLDLGIDDDAYYKKTLFAIFGRSNQLND----NLSFLSVEHKSS 58
          + LQE     +  +D+  DDD  +K  L+ +  RS +L D    + SF  V  K +
Sbjct: 19 ENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRFDASFFGVHPKQA 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.383 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,064,136
Number of Sequences: 62578
Number of extensions: 147569
Number of successful extensions: 361
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 361
Number of HSP's gapped (non-prelim): 6
length of query: 145
length of database: 14,973,337
effective HSP length: 89
effective length of query: 56
effective length of database: 9,403,895
effective search space: 526618120
effective search space used: 526618120
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)