BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043493
         (254 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ML5|A Chain A, Crystal Structure Of The C183sC217S MUTANT OF HUMAN CA VII
           IN COMPLEX With Acetazolamide
          Length = 269

 Score = 28.1 bits (61), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 24  KVTESLPCPRCESTSTKFCYYNNYNLSQPRHFCKSCRRYWTQGGTLRNIPV 74
           ++T++L   R + T  +F  +N      P+    + R YWT  G+L   P+
Sbjct: 166 RLTDALYMVRFKGTKAQFSCFN------PKSLLPASRHYWTYPGSLTTPPL 210


>pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of
          C2221 At 2.13a
 pdb|4FWF|A Chain A, Complex Structure Of Lsd2/aof1/kdm1b With H3k4 Mimic
 pdb|4FWJ|A Chain A, Native Structure Of Lsd2/aof1/kdm1b In Spacegroup Of
          I222 At 2.9a
 pdb|4FWJ|B Chain B, Native Structure Of Lsd2/aof1/kdm1b In Spacegroup Of
          I222 At 2.9a
          Length = 796

 Score = 28.1 bits (61), Expect = 5.2,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 5/34 (14%)

Query: 31 CPRCESTSTKFCYYNNY-----NLSQPRHFCKSC 59
          CP C +++++ C  N Y     +LS   HFC  C
Sbjct: 36 CPVCFASASERCAKNGYTSRWYHLSCGEHFCNEC 69


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.134    0.438 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,806,237
Number of Sequences: 62578
Number of extensions: 216555
Number of successful extensions: 324
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 324
Number of HSP's gapped (non-prelim): 7
length of query: 254
length of database: 14,973,337
effective HSP length: 97
effective length of query: 157
effective length of database: 8,903,271
effective search space: 1397813547
effective search space used: 1397813547
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)