Query         043513
Match_columns 406
No_of_seqs    150 out of 984
Neff          5.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:48:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043513.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043513hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0   2E-40 4.4E-45  288.5   7.4  127    8-141     1-129 (129)
  2 PHA00692 hypothetical protein   19.7      45 0.00097   26.4   0.5    9    7-15     36-44  (74)
  3 PRK14390 hypothetical protein;  11.2 1.3E+02  0.0028   23.9   1.1   20    4-23      9-28  (63)
  4 KOG1334 WD40 repeat protein [G  10.9 3.9E+02  0.0085   29.4   4.8   98   20-126   304-435 (559)
  5 PF07960 CBP4:  CBP4;  InterPro  10.3 1.4E+02   0.003   27.0   1.1   14   12-25     26-40  (128)
  6 PRK14373 hypothetical protein;  10.0 1.5E+02  0.0032   24.3   1.1   20    4-23     20-39  (73)
  7 smart00265 BH4 BH4 Bcl-2 homol  10.0 2.3E+02  0.0051   19.0   1.8   18   17-34      4-21  (27)
  8 PF11285 DUF3086:  Protein of u   8.8      40 0.00087   33.8  -3.1   27   46-74    128-154 (283)
  9 PF08338 DUF1731:  Domain of un   8.8 2.2E+02  0.0048   21.0   1.6   16   10-25     31-47  (48)
 10 PRK14382 hypothetical protein;   8.7 1.8E+02  0.0039   23.4   1.1   21    4-24     16-36  (68)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=2e-40  Score=288.45  Aligned_cols=127  Identities=38%  Similarity=0.727  Sum_probs=92.6

Q ss_pred             CCCCCeEcCChHHHHHHHHHHhHcCCCCCCcceeeEeccCCCCCCCcchhhhcCCCCCCCCceEEEEecccccCCCCCcc
Q 043513            8 LPVGCKFLPSEEQLVHYYLFNKISGIPTPFVEYFVKDVDLYDYEEPWDIWKQFGGPNLEDGEDLYFFTNLKKKSINGSRI   87 (406)
Q Consensus         8 LPpGfRF~PTDEELV~~YL~rKi~G~plp~~~~vI~evDVY~~~ePWdLp~~~~~~~~~d~eeWYFFspr~rk~~nG~R~   87 (406)
                      |||||||+|||+|||.+||++|+.|.+++. ..+|.++|||++ +||+|++.+.    .++++||||+++++++.+|+|.
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~-~~~i~~~Diy~~-~P~~L~~~~~----~~~~~~yFF~~~~~~~~~~~r~   74 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPC-EDVIHDVDIYSA-HPWELPAKFK----GGDEEWYFFSPRKKKYPNGGRP   74 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS--CHSEE--GGGS--GGGCHHHSS----S-SSEEEEEEE----------S
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCc-ccceeecccCcc-ChHHhhhhcc----CCCceEEEEEecccccCCcccc
Confidence            899999999999999999999999999887 367999999996 9999995432    2455899999999999999999


Q ss_pred             ceecccceeecccCCeEEEeCCCCcceeeEEeEeeeCCCCC--CCcCeEEEEEEeC
Q 043513           88 NRKVGSGAWQGEDAGELVLSRNSNRPIGSKKIFRYENDNFP--HNRCWIMHEYTLN  141 (406)
Q Consensus        88 ~R~tggG~WKatG~~k~I~~~~~g~vIG~KKtL~Fy~g~sp--~kT~WiMhEY~L~  141 (406)
                      +|++++|+||++|+.+.|.+. +|++||+||+|+||.++.+  .+|+|+||||+|.
T Consensus        75 ~R~~~~G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   75 NRVTGGGYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             -EEETTEEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             cccccceEEeecccccccccc-cceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            999999999999999999985 8899999999999965444  4899999999984


No 2  
>PHA00692 hypothetical protein
Probab=19.72  E-value=45  Score=26.40  Aligned_cols=9  Identities=33%  Similarity=0.526  Sum_probs=7.4

Q ss_pred             CCCCCCeEc
Q 043513            7 ILPVGCKFL   15 (406)
Q Consensus         7 ~LPpGfRF~   15 (406)
                      ..||||||-
T Consensus        36 eyppgfrfg   44 (74)
T PHA00692         36 EYPPGFRFG   44 (74)
T ss_pred             ecCCCcccc
Confidence            469999994


No 3  
>PRK14390 hypothetical protein; Provisional
Probab=11.16  E-value=1.3e+02  Score=23.94  Aligned_cols=20  Identities=25%  Similarity=0.374  Sum_probs=15.3

Q ss_pred             ccCCCCCCCeEcCChHHHHH
Q 043513            4 RSRILPVGCKFLPSEEQLVH   23 (406)
Q Consensus         4 ~~~~LPpGfRF~PTDEELV~   23 (406)
                      ++.-+|+-+||.||=-|=..
T Consensus         9 iSp~~~~~CRf~PTCS~Ya~   28 (63)
T PRK14390          9 FSPFFGPRCRFIPSCSSYGY   28 (63)
T ss_pred             hCCCCCCCCCcCccHHHHHH
Confidence            46678999999999665433


No 4  
>KOG1334 consensus WD40 repeat protein [General function prediction only]
Probab=10.91  E-value=3.9e+02  Score=29.40  Aligned_cols=98  Identities=20%  Similarity=0.310  Sum_probs=53.5

Q ss_pred             HHHHHHHHHhHcCCCC--------CC----cceeeEeccCCCCCCCcchhhhcCCCCCCCCceEEEEecccccC------
Q 043513           20 QLVHYYLFNKISGIPT--------PF----VEYFVKDVDLYDYEEPWDIWKQFGGPNLEDGEDLYFFTNLKKKS------   81 (406)
Q Consensus        20 ELV~~YL~rKi~G~pl--------p~----~~~vI~evDVY~~~ePWdLp~~~~~~~~~d~eeWYFFspr~rk~------   81 (406)
                      |.+.-|=.|++.....        |.    +..+-..+=+|+. .+-+|...+      .++..|||.+-....      
T Consensus       304 qf~RvYD~R~~~~e~~n~~~~~f~p~hl~~d~~v~ITgl~Ysh-~~sElLaSY------nDe~IYLF~~~~~~G~~p~~~  376 (559)
T KOG1334|consen  304 QFARVYDQRRIDKEENNGVLDKFCPHHLVEDDPVNITGLVYSH-DGSELLASY------NDEDIYLFNKSMGDGSEPDPS  376 (559)
T ss_pred             hhhhhhcccchhhccccchhhhcCCccccccCcccceeEEecC-Cccceeeee------cccceEEeccccccCCCCCCC
Confidence            4555577777766521        10    1111222336774 788886543      345589995432221      


Q ss_pred             ----------CCCCccceeccc-ceeecccCCeEEEe-CCCCcc-eeeEEe---EeeeCCC
Q 043513           82 ----------INGSRINRKVGS-GAWQGEDAGELVLS-RNSNRP-IGSKKI---FRYENDN  126 (406)
Q Consensus        82 ----------~nG~R~~R~tgg-G~WKatG~~k~I~~-~~~g~v-IG~KKt---L~Fy~g~  126 (406)
                                =+|.|-+|++++ .+|-.  +..-|.+ .++|.| |+.|++   +.|.+|.
T Consensus       377 s~~~~~~k~vYKGHrN~~TVKgVNFfGP--rsEyVvSGSDCGhIFiW~K~t~eii~~MegD  435 (559)
T KOG1334|consen  377 SPREQYVKRVYKGHRNSRTVKGVNFFGP--RSEYVVSGSDCGHIFIWDKKTGEIIRFMEGD  435 (559)
T ss_pred             cchhhccchhhcccccccccceeeeccC--ccceEEecCccceEEEEecchhHHHHHhhcc
Confidence                      137787888865 78875  2334554 356775 555554   5565553


No 5  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=10.32  E-value=1.4e+02  Score=26.99  Aligned_cols=14  Identities=43%  Similarity=0.850  Sum_probs=10.7

Q ss_pred             CeE-cCChHHHHHHH
Q 043513           12 CKF-LPSEEQLVHYY   25 (406)
Q Consensus        12 fRF-~PTDEELV~~Y   25 (406)
                      |++ .||||||+..|
T Consensus        26 ~~y~tPTeEeL~~r~   40 (128)
T PF07960_consen   26 VKYTTPTEEELFKRY   40 (128)
T ss_pred             heecCCCHHHHHHhc
Confidence            444 59999999765


No 6  
>PRK14373 hypothetical protein; Provisional
Probab=10.02  E-value=1.5e+02  Score=24.25  Aligned_cols=20  Identities=25%  Similarity=0.574  Sum_probs=15.5

Q ss_pred             ccCCCCCCCeEcCChHHHHH
Q 043513            4 RSRILPVGCKFLPSEEQLVH   23 (406)
Q Consensus         4 ~~~~LPpGfRF~PTDEELV~   23 (406)
                      ++.-+|+-+||.||=-|=..
T Consensus        20 iSp~~~~~CRf~PTCS~Ya~   39 (73)
T PRK14373         20 ISPLIPPRCRYTPTCSQYAV   39 (73)
T ss_pred             hCCCCCCCCCcCcCHHHHHH
Confidence            56778999999999665443


No 7  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=10.00  E-value=2.3e+02  Score=18.98  Aligned_cols=18  Identities=28%  Similarity=0.277  Sum_probs=14.5

Q ss_pred             ChHHHHHHHHHHhHcCCC
Q 043513           17 SEEQLVHYYLFNKISGIP   34 (406)
Q Consensus        17 TDEELV~~YL~rKi~G~p   34 (406)
                      .-.|||.+|+.-|+.-.-
T Consensus         4 ~nRelV~~yv~yKLsQrg   21 (27)
T smart00265        4 DNRELVVDYVTYKLSQNG   21 (27)
T ss_pred             chHHHHHHHHHHHHhhcC
Confidence            457999999999996543


No 8  
>PF11285 DUF3086:  Protein of unknown function (DUF3086);  InterPro: IPR021437  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=8.83  E-value=40  Score=33.82  Aligned_cols=27  Identities=33%  Similarity=0.708  Sum_probs=16.9

Q ss_pred             cCCCCCCCcchhhhcCCCCCCCCceEEEE
Q 043513           46 DLYDYEEPWDIWKQFGGPNLEDGEDLYFF   74 (406)
Q Consensus        46 DVY~~~ePWdLp~~~~~~~~~d~eeWYFF   74 (406)
                      |.|+  +||.|-..|.+.....-+.|||=
T Consensus       128 DyYg--~PWqLRRtfe~~hae~v~~WFF~  154 (283)
T PF11285_consen  128 DYYG--PPWQLRRTFEPIHAERVEDWFFN  154 (283)
T ss_pred             CccC--ChHHHHhcccHHHHHHHHHHHhc
Confidence            5786  89999877765433223348553


No 9  
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=8.79  E-value=2.2e+02  Score=21.04  Aligned_cols=16  Identities=25%  Similarity=0.463  Sum_probs=9.0

Q ss_pred             CCCeEc-CChHHHHHHH
Q 043513           10 VGCKFL-PSEEQLVHYY   25 (406)
Q Consensus        10 pGfRF~-PTDEELV~~Y   25 (406)
                      -||+|+ |+=++.+.+.
T Consensus        31 ~GF~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   31 AGFQFRYPTLEEALRDL   47 (48)
T ss_dssp             TT---S-SSHHHHHHH-
T ss_pred             CCCcccCCCHHHHHhcc
Confidence            599995 8888877654


No 10 
>PRK14382 hypothetical protein; Provisional
Probab=8.67  E-value=1.8e+02  Score=23.41  Aligned_cols=21  Identities=24%  Similarity=0.542  Sum_probs=16.2

Q ss_pred             ccCCCCCCCeEcCChHHHHHH
Q 043513            4 RSRILPVGCKFLPSEEQLVHY   24 (406)
Q Consensus         4 ~~~~LPpGfRF~PTDEELV~~   24 (406)
                      ++.-+++-+||.||=-|-...
T Consensus        16 iSp~~~~~CRf~PTCS~Ya~~   36 (68)
T PRK14382         16 ISPLYPSSCRFYPTCSTYAIL   36 (68)
T ss_pred             cCCCCCCCCCCccCHHHHHHH
Confidence            467789999999997665443


Done!