Query         043514
Match_columns 88
No_of_seqs    84 out of 106
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:48:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043514.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043514hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14009 DUF4228:  Domain of un  99.9 1.9E-27 4.1E-32  163.1   6.6   78    4-87      1-84  (181)
  2 cd00307 RuBisCO_small_like Rib  64.3     6.3 0.00014   26.1   2.2   14   35-48     53-66  (84)
  3 PF06483 ChiC:  Chitinase C;  I  60.4      16 0.00034   27.6   3.9   62   20-81     69-143 (180)
  4 PF00101 RuBisCO_small:  Ribulo  58.0       9  0.0002   26.0   2.1   13   36-48     68-80  (99)
  5 cd03527 RuBisCO_small Ribulose  57.9     9.4  0.0002   26.0   2.2   33   16-48     32-81  (99)
  6 PF07593 UnbV_ASPIC:  ASPIC and  57.7     7.4 0.00016   24.0   1.5   27    2-30     36-62  (71)
  7 cd03063 TRX_Fd_FDH_beta TRX-li  47.1      19 0.00041   23.9   2.3   30    4-37     42-71  (92)
  8 CHL00130 rbcS ribulose-1,5-bis  45.0      19 0.00042   26.2   2.2   27   22-48     41-83  (138)
  9 PF15631 Imm-NTF2-2:  NTF2 fold  44.9      29 0.00062   22.2   2.8   19   12-30     47-65  (66)
 10 PF11211 DUF2997:  Protein of u  42.3      22 0.00048   21.1   1.9   14   16-29      3-16  (48)
 11 PF06572 DUF1131:  Protein of u  36.4      11 0.00023   28.2  -0.2   18   64-81    151-168 (171)
 12 COG1504 Uncharacterized conser  35.9      15 0.00033   26.2   0.5   18   16-33     23-40  (121)
 13 PRK10718 RpoE-regulated lipopr  34.9      16 0.00035   27.8   0.5   18   64-81    171-188 (191)
 14 smart00432 MADS MADS domain.    34.7      30 0.00066   21.2   1.7   22    7-30     38-59  (59)
 15 PF06145 Corona_NS1:  Coronavir  31.9      39 0.00085   18.5   1.6   15   17-31     15-29  (29)
 16 cd00265 MADS_MEF2_like MEF2 (m  29.8      58  0.0013   20.6   2.4   27   13-40     42-68  (77)
 17 PF11357 Spy1:  Cell cycle regu  28.4      26 0.00056   25.1   0.7   12   34-45    115-126 (131)
 18 COG4996 Predicted phosphatase   28.3      81  0.0018   23.5   3.2   36   16-51     31-66  (164)
 19 PF13098 Thioredoxin_2:  Thiore  28.1      81  0.0017   19.5   2.9   25   14-38     85-110 (112)
 20 cd02670 Peptidase_C19N A subfa  28.0      49  0.0011   25.2   2.2   12   40-51    181-192 (241)
 21 PLN02289 ribulose-bisphosphate  25.7      59  0.0013   24.5   2.2   17   32-48    134-157 (176)
 22 KOG3542 cAMP-regulated guanine  24.2      59  0.0013   30.2   2.2   25   14-38    333-364 (1283)
 23 TIGR01643 YD_repeat_2x YD repe  23.2 1.1E+02  0.0024   16.2   2.5   16   15-30      8-23  (42)
 24 PF04571 Lipin_N:  lipin, N-ter  23.1      39 0.00085   23.6   0.8   14    8-23     26-39  (110)
 25 PF13174 TPR_6:  Tetratricopept  23.1      53  0.0012   15.8   1.1   11   33-43     23-33  (33)
 26 PF05862 IceA2:  Helicobacter p  22.9      77  0.0017   20.0   2.0   15   15-29     38-52  (59)
 27 COG4451 RbcS Ribulose bisphosp  21.6      65  0.0014   23.2   1.6   17   32-48     65-88  (127)
 28 cd02980 TRX_Fd_family Thioredo  21.4      95  0.0021   18.3   2.2   28    4-37     44-71  (77)
 29 COG3731 SrlB Phosphotransferas  20.4      60  0.0013   23.2   1.3   20   64-83     50-69  (123)
 30 PRK07440 hypothetical protein;  20.4 2.2E+02  0.0048   17.4   4.4   21   19-39      8-28  (70)

No 1  
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=99.94  E-value=1.9e-27  Score=163.09  Aligned_cols=78  Identities=35%  Similarity=0.517  Sum_probs=65.9

Q ss_pred             ccchhhh------hheeeeEEcCCCeeEEEeecccHhHHHhhCCCceEEeeecCcCccCCCCcceEEeeCCCCcccCCcE
Q 043514            4 VGNCQAA------EAATVVIQHPGNKIERIYWSVSANEIMNSNPGHYVALLATSPTLKSENGLPVKQLLRPDDTLLIGRV   77 (88)
Q Consensus         4 MGNCqA~------d~a~vvI~Hp~Gkve~~y~~vsA~eVM~~nPGHyVa~~~~~~~~~~~~~~~~~klL~Pdd~L~~G~~   77 (88)
                      ||||.+.      +..+++|+|+||+|++|++|++|+|||..||||||...-.     ... -+..+.|+|||+|++|++
T Consensus         1 MGn~~~~~~~~~~~~~~vkvv~~~G~v~~~~~pv~a~evm~~~P~h~v~~~~~-----~~~-~~~~~~l~~d~~L~~G~~   74 (181)
T PF14009_consen    1 MGNCVSCCLASSSSAATVKVVHPDGKVEEFKRPVTAAEVMLENPGHFVCDSDS-----FRF-GRRIKPLPPDEELQPGQI   74 (181)
T ss_pred             CCCcccccccccCCCceEEEEcCCCcEEEeCCCcCHHHHHHHCCCCEEecccc-----ccC-CCcccCCCccCeecCCCE
Confidence            9999987      8889999999999999999999999999999999964311     001 222379999999999999


Q ss_pred             EEEEeccccc
Q 043514           78 YRLISFEGNI   87 (88)
Q Consensus        78 YrLI~~~ev~   87 (88)
                      |||+|.+.+.
T Consensus        75 Y~llP~~~~~   84 (181)
T PF14009_consen   75 YFLLPMSRLQ   84 (181)
T ss_pred             EEEEEccccC
Confidence            9999997653


No 2  
>cd00307 RuBisCO_small_like Ribulose bisphosphate carboxylase/oxygenase (Rubisco), small subunit and related proteins. Rubisco is a bifunctional enzyme catalyzes the initial steps of two opposing metabolic pathways: photosynthetic carbon fixation and the competing process of photorespiration. Rubisco Form I, present in plants and green algae, is composed of eight large and eight small subunits. The nearly identical small subunits are encoded by a family of nuclear genes. After translation, the small subunits are translocated across the chloroplast membrane, where an N-terminal signal peptide is cleaved off. While the large subunits contain the catalytic activities, it has been shown that the small subunits are important for catalysis by enhancing the catalytic rate through inducing conformational changes in the large subunits. This superfamily also contains specific proteins from cyanobacteria. CcmM plays a role in a CO2 concentrating mechanism, which cyanobacteria need to to overcome t
Probab=64.30  E-value=6.3  Score=26.05  Aligned_cols=14  Identities=36%  Similarity=0.828  Sum_probs=11.2

Q ss_pred             HHHhhCCCceEEee
Q 043514           35 EIMNSNPGHYVALL   48 (88)
Q Consensus        35 eVM~~nPGHyVa~~   48 (88)
                      +-+++||||||.++
T Consensus        53 ~c~~~~p~~YVRli   66 (84)
T cd00307          53 ACLAEHPGEYVRLI   66 (84)
T ss_pred             HHHHHCCCCeEEEE
Confidence            34478999999876


No 3  
>PF06483 ChiC:  Chitinase C;  InterPro: IPR009470 This ~170 aa region is found at the C-terminal to the catalytic domain (IPR001223 from INTERPRO) found in members of glycoside hydrolase family 18.
Probab=60.36  E-value=16  Score=27.63  Aligned_cols=62  Identities=21%  Similarity=0.310  Sum_probs=46.7

Q ss_pred             CCCeeEEEeecccHhHHHhhCCCceEEeeecCcC--ccCCCC-------cceE----EeeCCCCcccCCcEEEEE
Q 043514           20 PGNKIERIYWSVSANEIMNSNPGHYVALLATSPT--LKSENG-------LPVK----QLLRPDDTLLIGRVYRLI   81 (88)
Q Consensus        20 p~Gkve~~y~~vsA~eVM~~nPGHyVa~~~~~~~--~~~~~~-------~~~~----klL~Pdd~L~~G~~YrLI   81 (88)
                      |+|-.-+|--|.||...|+.-.|--+..+..-..  ..+-+|       +.++    |-|.|+++..+.-+|+|=
T Consensus        69 PGGt~~~FD~ptSa~~~~kdqSG~g~~vi~sght~~g~NiGGL~gdfHrvs~tlp~wqslapG~s~~~~~~YyLP  143 (180)
T PF06483_consen   69 PGGTEFEFDYPTSAPDNAKDQSGFGLKVISSGHTAAGNNIGGLKGDFHRVSFTLPAWQSLAPGASVELDMVYYLP  143 (180)
T ss_pred             CCccEEEEccccCCccccccccCCcEEEEecCCcccCCcccccCCceEEEEEECCCccccCCCCEEEEeEEEEec
Confidence            8899999999999999999999988875532222  111122       3333    789999999999999983


No 4  
>PF00101 RuBisCO_small:  Ribulose bisphosphate carboxylase, small chain;  InterPro: IPR000894 RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) is a bifunctional enzyme that catalyses both the carboxylation and oxygenation of ribulose-1,5-bisphosphate (RuBP) [], thus fixing carbon dioxide as the first step of the Calvin cycle. RuBisCO is the major protein in the stroma of chloroplasts, and in higher plants exists as a complex of 8 large and 8 small subunits. The function of the small subunit is unknown []. While the large subunit is coded for by a single gene, the small subunit is coded for by several different genes, which are distributed in a tissue specific manner. They are transcriptionally regulated by light receptor phytochrome [], which results in RuBisCO being more abundant during the day when it is required. The RuBisCo small subunit consists of a central four-stranded beta-sheet, with two helices packed against it [].; PDB: 1BWV_W 1IWA_P 3AXM_X 1WDD_S 3AXK_T 1IR2_K 1RBL_N 1UZH_J 1RSC_P 1UW9_C ....
Probab=57.95  E-value=9  Score=25.95  Aligned_cols=13  Identities=38%  Similarity=0.892  Sum_probs=10.8

Q ss_pred             HHhhCCCceEEee
Q 043514           36 IMNSNPGHYVALL   48 (88)
Q Consensus        36 VM~~nPGHyVa~~   48 (88)
                      -+++||||||.++
T Consensus        68 c~~~~p~~yVRli   80 (99)
T PF00101_consen   68 CLAEHPGEYVRLI   80 (99)
T ss_dssp             HHHHSTTSEEEEE
T ss_pred             HHHhCCCceEEEE
Confidence            3478999999886


No 5  
>cd03527 RuBisCO_small Ribulose bisphosphate carboxylase/oxygenase (Rubisco), small subunit. Rubisco is a bifunctional enzyme catalyzes the initial steps of two opposing metabolic pathways: photosynthetic carbon fixation and the competing process of photorespiration. Rubisco Form I, present in plants and green algae, is composed of eight large and eight small subunits. The nearly identical small subunits are encoded by a family of nuclear genes. After translation, the small subunits are translocated across the chloroplast membrane, where an N-terminal signal peptide is cleaved off. While the large subunits contain the catalytic activities, it has been shown that the small subunits are important for catalysis by enhancing the catalytic rate through inducing conformational changes in the large subunits.
Probab=57.93  E-value=9.4  Score=25.99  Aligned_cols=33  Identities=18%  Similarity=0.674  Sum_probs=21.6

Q ss_pred             eEEcCC-CeeEEEeecc---------cHhHHH-------hhCCCceEEee
Q 043514           16 VIQHPG-NKIERIYWSV---------SANEIM-------NSNPGHYVALL   48 (88)
Q Consensus        16 vI~Hp~-Gkve~~y~~v---------sA~eVM-------~~nPGHyVa~~   48 (88)
                      -|.|.+ ++=.--||..         ++++||       ++||||||.++
T Consensus        32 ~lE~ad~~~~~~~yW~mwklP~f~~~d~~~Vl~ei~~C~~~~p~~YVRli   81 (99)
T cd03527          32 CLEFTEPEHYDNRYWTMWKLPMFGCTDPAQVLREIEACRKAYPDHYVRVV   81 (99)
T ss_pred             EEEcccCCCCCCCEEeeccCCCCCCCCHHHHHHHHHHHHHHCCCCeEEEE
Confidence            355544 3344446663         567777       68999999876


No 6  
>PF07593 UnbV_ASPIC:  ASPIC and UnbV;  InterPro: IPR011519 This conserved sequence is found associated with IPR001440 from INTERPRO in several paralogous proteins in Rhodopirellula baltica. It is also found associated with IPR000413 from INTERPRO in several eukaryotic integrin-like proteins (e.g. human ASPIC Q9NQ78 from SWISSPROT) and in several other bacterial proteins (e.g. Q84HN1 from SWISSPROT) [].
Probab=57.74  E-value=7.4  Score=23.96  Aligned_cols=27  Identities=11%  Similarity=0.377  Sum_probs=20.3

Q ss_pred             ccccchhhhhheeeeEEcCCCeeEEEeec
Q 043514            2 LKVGNCQAAEAATVVIQHPGNKIERIYWS   30 (88)
Q Consensus         2 ~~MGNCqA~d~a~vvI~Hp~Gkve~~y~~   30 (88)
                      |..|.|..+|.+  +|.=|||+.+++.-+
T Consensus        36 FGLG~~~~v~~v--~V~WP~G~~~~~~~~   62 (71)
T PF07593_consen   36 FGLGDATSVDSV--EVRWPDGKVQTLENV   62 (71)
T ss_pred             EECCCCCCEEEE--EEECCCCCEEEEEcc
Confidence            556776666655  688899999998765


No 7  
>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c
Probab=47.11  E-value=19  Score=23.90  Aligned_cols=30  Identities=20%  Similarity=0.346  Sum_probs=21.5

Q ss_pred             ccchhhhhheeeeEEcCCCeeEEEeecccHhHHH
Q 043514            4 VGNCQAAEAATVVIQHPGNKIERIYWSVSANEIM   37 (88)
Q Consensus         4 MGNCqA~d~a~vvI~Hp~Gkve~~y~~vsA~eVM   37 (88)
                      ||-|..---  |.|+.|+|+  -+|..|++.++=
T Consensus        42 ~G~C~~ePl--V~V~~p~g~--v~Y~~V~~edv~   71 (92)
T cd03063          42 RGMYWLEPL--VEVETPGGR--VAYGPVTPADVA   71 (92)
T ss_pred             ceecCCCCE--EEEEeCCCc--EEEEeCCHHHHH
Confidence            677765433  357779988  699999987653


No 8  
>CHL00130 rbcS ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit; Reviewed
Probab=45.01  E-value=19  Score=26.16  Aligned_cols=27  Identities=19%  Similarity=0.564  Sum_probs=21.3

Q ss_pred             CeeEEEeecc---------cHhHHH-------hhCCCceEEee
Q 043514           22 NKIERIYWSV---------SANEIM-------NSNPGHYVALL   48 (88)
Q Consensus        22 Gkve~~y~~v---------sA~eVM-------~~nPGHyVa~~   48 (88)
                      ++....||..         .+++||       ++||+|||.++
T Consensus        41 ~~~~~~YW~MWkLPMFg~tD~~~Vl~Ei~~CrkayP~~yIRl~   83 (138)
T CHL00130         41 PHPRNSYWELWGLPLFDVKDPAAVMFEINECRKQKPNGYIKVN   83 (138)
T ss_pred             CCcCccEEeeeCCccCCCCCHHHHHHHHHHHHHHCCCcEEEEE
Confidence            5666678875         788888       68999999765


No 9  
>PF15631 Imm-NTF2-2:  NTF2 fold immunity protein
Probab=44.85  E-value=29  Score=22.18  Aligned_cols=19  Identities=11%  Similarity=0.156  Sum_probs=16.3

Q ss_pred             heeeeEEcCCCeeEEEeec
Q 043514           12 AATVVIQHPGNKIERIYWS   30 (88)
Q Consensus        12 ~a~vvI~Hp~Gkve~~y~~   30 (88)
                      ++.+.|+.-||||.++++.
T Consensus        47 v~~I~I~K~dgkVl~v~H~   65 (66)
T PF15631_consen   47 VFYIEIRKKDGKVLNVTHT   65 (66)
T ss_pred             eEEEEEEccCCeEEEEEec
Confidence            5678899999999999864


No 10 
>PF11211 DUF2997:  Protein of unknown function (DUF2997);  InterPro: IPR021375  This family of proteins has no known function. 
Probab=42.26  E-value=22  Score=21.09  Aligned_cols=14  Identities=14%  Similarity=0.126  Sum_probs=10.1

Q ss_pred             eEEcCCCeeEEEee
Q 043514           16 VIQHPGNKIERIYW   29 (88)
Q Consensus        16 vI~Hp~Gkve~~y~   29 (88)
                      .+.+|||+|++=--
T Consensus         3 ~~I~~dG~V~~~v~   16 (48)
T PF11211_consen    3 FTIYPDGRVEEEVE   16 (48)
T ss_pred             EEECCCcEEEEEEE
Confidence            35699999987443


No 11 
>PF06572 DUF1131:  Protein of unknown function (DUF1131);  InterPro: IPR010938 This entry consists of several hypothetical bacterial proteins of unknown function.; PDB: 2QZB_B.
Probab=36.41  E-value=11  Score=28.25  Aligned_cols=18  Identities=44%  Similarity=0.615  Sum_probs=12.6

Q ss_pred             EeeCCCCcccCCcEEEEE
Q 043514           64 QLLRPDDTLLIGRVYRLI   81 (88)
Q Consensus        64 klL~Pdd~L~~G~~YrLI   81 (88)
                      -||+|||+|.-.++.++|
T Consensus       151 glmPpdd~Lk~wkvskIi  168 (171)
T PF06572_consen  151 GLMPPDDTLKNWKVSKII  168 (171)
T ss_dssp             TS---HHHHTT-EEEEEE
T ss_pred             CCCCChHHHhhceeeEEE
Confidence            489999999999999987


No 12 
>COG1504 Uncharacterized conserved protein [Function unknown]
Probab=35.89  E-value=15  Score=26.15  Aligned_cols=18  Identities=28%  Similarity=0.423  Sum_probs=14.9

Q ss_pred             eEEcCCCeeEEEeecccH
Q 043514           16 VIQHPGNKIERIYWSVSA   33 (88)
Q Consensus        16 vI~Hp~Gkve~~y~~vsA   33 (88)
                      .+++|||+|++..-++|-
T Consensus        23 Ivi~~dG~v~rr~K~lsk   40 (121)
T COG1504          23 IVIRPDGKVERREKELSK   40 (121)
T ss_pred             EEEecCCceehhhhhhhh
Confidence            378999999998877763


No 13 
>PRK10718 RpoE-regulated lipoprotein; Provisional
Probab=34.89  E-value=16  Score=27.78  Aligned_cols=18  Identities=39%  Similarity=0.482  Sum_probs=16.7

Q ss_pred             EeeCCCCcccCCcEEEEE
Q 043514           64 QLLRPDDTLLIGRVYRLI   81 (88)
Q Consensus        64 klL~Pdd~L~~G~~YrLI   81 (88)
                      -|++|||+|.-++++.+|
T Consensus       171 glmPpdd~Lk~w~vskII  188 (191)
T PRK10718        171 GLMPSDDTLKNWKVSKII  188 (191)
T ss_pred             CCCCcHHHHhhcEeeEEE
Confidence            599999999999999987


No 14 
>smart00432 MADS MADS domain.
Probab=34.72  E-value=30  Score=21.18  Aligned_cols=22  Identities=23%  Similarity=0.468  Sum_probs=15.8

Q ss_pred             hhhhhheeeeEEcCCCeeEEEeec
Q 043514            7 CQAAEAATVVIQHPGNKIERIYWS   30 (88)
Q Consensus         7 CqA~d~a~vvI~Hp~Gkve~~y~~   30 (88)
                      |++ | ++++|.-|+|++-.+.+|
T Consensus        38 c~~-~-v~~iv~sp~g~~~~~~~p   59 (59)
T smart00432       38 CDA-E-VALIVFSPTGKLYEFASP   59 (59)
T ss_pred             cCC-e-EEEEEECCCCCeeeccCC
Confidence            664 3 456889999998776554


No 15 
>PF06145 Corona_NS1:  Coronavirus nonstructural protein NS1;  InterPro: IPR009314 One of the members of this family is a 4.9 kDa proteins, encoded by Bovine coronavirus NS1 [].
Probab=31.86  E-value=39  Score=18.49  Aligned_cols=15  Identities=33%  Similarity=0.494  Sum_probs=12.6

Q ss_pred             EEcCCCeeEEEeecc
Q 043514           17 IQHPGNKIERIYWSV   31 (88)
Q Consensus        17 I~Hp~Gkve~~y~~v   31 (88)
                      |.||..+|..+-.|+
T Consensus        15 ilhp~nhv~liir~i   29 (29)
T PF06145_consen   15 ILHPFNHVNLIIRPI   29 (29)
T ss_pred             ccCcccceeEEEecC
Confidence            789999999887764


No 16 
>cd00265 MADS_MEF2_like MEF2 (myocyte enhancer factor 2)-like/Type II subfamily of MADS ( MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators. Binds DNA and exists as hetero and homo-dimers. Differs from SRF-like/Type I subgroup mainly in position of the alpha helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=29.81  E-value=58  Score=20.58  Aligned_cols=27  Identities=15%  Similarity=0.215  Sum_probs=19.9

Q ss_pred             eeeeEEcCCCeeEEEeecccHhHHHhhC
Q 043514           13 ATVVIQHPGNKIERIYWSVSANEIMNSN   40 (88)
Q Consensus        13 a~vvI~Hp~Gkve~~y~~vsA~eVM~~n   40 (88)
                      ++++|..|+|++-.+.+| +..+|+..|
T Consensus        42 v~lvv~sp~gk~~~f~s~-s~~~vl~ry   68 (77)
T cd00265          42 VALIIFSSSGKLYEFSSP-SMEKIIERY   68 (77)
T ss_pred             eeEEEEcCCCceEEecCC-CHHHHHHHH
Confidence            345788999999887665 458888754


No 17 
>PF11357 Spy1:  Cell cycle regulatory protein;  InterPro: IPR020984  Speedy (Spy1) is a cell cycle regulatory protein which activates CDK2, the major kinase that allows progression through G1/S phase and further replication events. Spy1 expression overcomes a p27-induced cell cycle arrest to allow for DNA synthesis, so cell cycle progression occurs due to an interaction between Spy1 and p27 []. Spy1 is also known as Ringo protein A. 
Probab=28.41  E-value=26  Score=25.15  Aligned_cols=12  Identities=42%  Similarity=0.772  Sum_probs=11.2

Q ss_pred             hHHHhhCCCceE
Q 043514           34 NEIMNSNPGHYV   45 (88)
Q Consensus        34 ~eVM~~nPGHyV   45 (88)
                      .|||+.+|.|.|
T Consensus       115 EEi~a~~P~hwv  126 (131)
T PF11357_consen  115 EEIQAYDPEHWV  126 (131)
T ss_pred             HHHHHhCCcchh
Confidence            699999999987


No 18 
>COG4996 Predicted phosphatase [General function prediction only]
Probab=28.31  E-value=81  Score=23.48  Aligned_cols=36  Identities=14%  Similarity=0.159  Sum_probs=31.8

Q ss_pred             eEEcCCCeeEEEeecccHhHHHhhCCCceEEeeecC
Q 043514           16 VIQHPGNKIERIYWSVSANEIMNSNPGHYVALLATS   51 (88)
Q Consensus        16 vI~Hp~Gkve~~y~~vsA~eVM~~nPGHyVa~~~~~   51 (88)
                      .||-..|++-+++.-+.+--.=++|.||.++...+-
T Consensus        31 ~i~Ds~G~ev~L~~~v~~~l~warnsG~i~~~~sWN   66 (164)
T COG4996          31 TIEDSKGREVHLFPDVKETLKWARNSGYILGLASWN   66 (164)
T ss_pred             ceecCCCeEEEEcHHHHHHHHHHHhCCcEEEEeecC
Confidence            488899999999999999888899999999877543


No 19 
>PF13098 Thioredoxin_2:  Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A ....
Probab=28.08  E-value=81  Score=19.50  Aligned_cols=25  Identities=28%  Similarity=0.364  Sum_probs=17.4

Q ss_pred             eeeEEcCCCe-eEEEeecccHhHHHh
Q 043514           14 TVVIQHPGNK-IERIYWSVSANEIMN   38 (88)
Q Consensus        14 ~vvI~Hp~Gk-ve~~y~~vsA~eVM~   38 (88)
                      ++++...+|+ |.++.+.+++.|+.+
T Consensus        85 t~~~~d~~G~~v~~~~G~~~~~~l~~  110 (112)
T PF13098_consen   85 TIVFLDKDGKIVYRIPGYLSPEELLK  110 (112)
T ss_dssp             EEEECTTTSCEEEEEESS--HHHHHH
T ss_pred             EEEEEcCCCCEEEEecCCCCHHHHHh
Confidence            3466667788 668999999988875


No 20 
>cd02670 Peptidase_C19N A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=27.98  E-value=49  Score=25.15  Aligned_cols=12  Identities=42%  Similarity=0.803  Sum_probs=9.8

Q ss_pred             CCCceEEeeecC
Q 043514           40 NPGHYVALLATS   51 (88)
Q Consensus        40 nPGHyVa~~~~~   51 (88)
                      +-|||+|.+...
T Consensus       181 ~sGHYva~vr~~  192 (241)
T cd02670         181 ETGHYVAFVRYG  192 (241)
T ss_pred             CCcCeEEEEECC
Confidence            899999988543


No 21 
>PLN02289 ribulose-bisphosphate carboxylase small chain
Probab=25.73  E-value=59  Score=24.55  Aligned_cols=17  Identities=6%  Similarity=0.585  Sum_probs=14.3

Q ss_pred             cHhHHH-------hhCCCceEEee
Q 043514           32 SANEIM-------NSNPGHYVALL   48 (88)
Q Consensus        32 sA~eVM-------~~nPGHyVa~~   48 (88)
                      .+++||       ++||+|||.++
T Consensus       134 D~~~Vl~Ei~eC~kayP~~yIRii  157 (176)
T PLN02289        134 DSAQVLKELEEAKKAYPNAFIRII  157 (176)
T ss_pred             CHHHHHHHHHHHHHHCCcceEEEE
Confidence            678888       68999999865


No 22 
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms]
Probab=24.20  E-value=59  Score=30.17  Aligned_cols=25  Identities=20%  Similarity=0.263  Sum_probs=18.9

Q ss_pred             eeeEEcCCCeeEEEee-------cccHhHHHh
Q 043514           14 TVVIQHPGNKIERIYW-------SVSANEIMN   38 (88)
Q Consensus        14 ~vvI~Hp~Gkve~~y~-------~vsA~eVM~   38 (88)
                      +|.|+||+||.|+|.-       |..+-|.|.
T Consensus       333 ~VEv~~PdGk~e~l~mGnSFG~~PT~dkqym~  364 (1283)
T KOG3542|consen  333 CVEVVKPDGKREELKMGNSFGAEPTPDKQYMI  364 (1283)
T ss_pred             eEEEecCCCceEEeecccccCCCCCcchhhhh
Confidence            6789999999999974       455556554


No 23 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=23.24  E-value=1.1e+02  Score=16.20  Aligned_cols=16  Identities=6%  Similarity=0.048  Sum_probs=12.9

Q ss_pred             eeEEcCCCeeEEEeec
Q 043514           15 VVIQHPGNKIERIYWS   30 (88)
Q Consensus        15 vvI~Hp~Gkve~~y~~   30 (88)
                      +.+..|+|++.+|.+-
T Consensus         8 ~~~~~p~G~~~~~~YD   23 (42)
T TIGR01643         8 TGSTDADGTTTRYTYD   23 (42)
T ss_pred             EEEECCCCCEEEEEEC
Confidence            4578899999998874


No 24 
>PF04571 Lipin_N:  lipin, N-terminal conserved region;  InterPro: IPR007651 Mutations in the lipin gene lead to fatty liver dystrophy in mice. The protein has been shown to be phosphorylated by the TOR Ser/Thr protein kinases in response to insulin stimulation. This entry represents a conserved domain found at the N terminus of the member proteins [, ].
Probab=23.14  E-value=39  Score=23.61  Aligned_cols=14  Identities=21%  Similarity=0.482  Sum_probs=11.4

Q ss_pred             hhhhheeeeEEcCCCe
Q 043514            8 QAAEAATVVIQHPGNK   23 (88)
Q Consensus         8 qA~d~a~vvI~Hp~Gk   23 (88)
                      +|+|.+  +|+||||.
T Consensus        26 GAiDVI--VV~q~DGs   39 (110)
T PF04571_consen   26 GAIDVI--VVEQPDGS   39 (110)
T ss_pred             CceeEE--EEecCCCC
Confidence            578876  79999995


No 25 
>PF13174 TPR_6:  Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A.
Probab=23.11  E-value=53  Score=15.78  Aligned_cols=11  Identities=9%  Similarity=0.329  Sum_probs=7.9

Q ss_pred             HhHHHhhCCCc
Q 043514           33 ANEIMNSNPGH   43 (88)
Q Consensus        33 A~eVM~~nPGH   43 (88)
                      ..++++.||+|
T Consensus        23 ~~~~~~~~P~s   33 (33)
T PF13174_consen   23 FQRLIKRYPDS   33 (33)
T ss_dssp             HHHHHHHSTTS
T ss_pred             HHHHHHHCcCC
Confidence            36778888875


No 26 
>PF05862 IceA2:  Helicobacter pylori IceA2 protein;  InterPro: IPR008655 This family consists of several Helicobacter pylori specific IceA2 proteins. The function of this family is unknown.
Probab=22.90  E-value=77  Score=20.05  Aligned_cols=15  Identities=20%  Similarity=0.133  Sum_probs=11.1

Q ss_pred             eeEEcCCCeeEEEee
Q 043514           15 VVIQHPGNKIERIYW   29 (88)
Q Consensus        15 vvI~Hp~Gkve~~y~   29 (88)
                      |-+.-.+||||||.-
T Consensus        38 VA~~ta~GkveeY~n   52 (59)
T PF05862_consen   38 VAAVTANGKVEEYKN   52 (59)
T ss_pred             EEEEecCCceeeeec
Confidence            456668899999863


No 27 
>COG4451 RbcS Ribulose bisphosphate carboxylase small subunit [Energy production and conversion]
Probab=21.59  E-value=65  Score=23.18  Aligned_cols=17  Identities=35%  Similarity=0.919  Sum_probs=13.4

Q ss_pred             cHhHHH-------hhCCCceEEee
Q 043514           32 SANEIM-------NSNPGHYVALL   48 (88)
Q Consensus        32 sA~eVM-------~~nPGHyVa~~   48 (88)
                      +|.|||       ++|||+||.++
T Consensus        65 ~~~evlaele~Cr~dhp~eYIRli   88 (127)
T COG4451          65 TAGEVLAELEACRADHPGEYIRLI   88 (127)
T ss_pred             chHHHHHHHHHHHHhCCCCeEEEE
Confidence            566666       57999999876


No 28 
>cd02980 TRX_Fd_family Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd) family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like Fds) and proteins containing domains similar to TRX-like Fd including formate dehydrogenases, NAD-reducing hydrogenases and the subunit E of NADH:ubiquinone oxidoreductase (NuoE). TRX-like Fds are soluble low-potential electron carriers containing a single [2Fe-2S] cluster. The exact role of TRX-like Fd is still unclear. It has been suggested that it may be involved in nitrogen fixation. Its homologous domains in large redox enzymes (such as Nuo and hydrogenases) function as electron carriers.
Probab=21.44  E-value=95  Score=18.30  Aligned_cols=28  Identities=21%  Similarity=0.438  Sum_probs=17.1

Q ss_pred             ccchhhhhheeeeEEcCCCeeEEEeecccHhHHH
Q 043514            4 VGNCQAAEAATVVIQHPGNKIERIYWSVSANEIM   37 (88)
Q Consensus         4 MGNCqA~d~a~vvI~Hp~Gkve~~y~~vsA~eVM   37 (88)
                      ||+|...-.+   ++.|+|   .+|..+++.++.
T Consensus        44 lg~C~~~P~v---~i~~~~---~~y~~v~~~~~~   71 (77)
T cd02980          44 LGACGLAPVV---VVYPDG---VWYGRVTPEDVE   71 (77)
T ss_pred             cCcccCCCEE---EEeCCC---eEEccCCHHHHH
Confidence            7888554333   344655   478888776553


No 29 
>COG3731 SrlB Phosphotransferase system sorbitol-specific component IIA [Carbohydrate transport and metabolism]
Probab=20.43  E-value=60  Score=23.23  Aligned_cols=20  Identities=30%  Similarity=0.433  Sum_probs=16.5

Q ss_pred             EeeCCCCcccCCcEEEEEec
Q 043514           64 QLLRPDDTLLIGRVYRLISF   83 (88)
Q Consensus        64 klL~Pdd~L~~G~~YrLI~~   83 (88)
                      .-|.|+|.|.+|+.-+.|++
T Consensus        50 ~~l~~G~~l~lg~~~y~Ita   69 (123)
T COG3731          50 EALQPGDRLTLGGHCYPITA   69 (123)
T ss_pred             ccCCCCCEEEECCceEEEEE
Confidence            45779999999988888875


No 30 
>PRK07440 hypothetical protein; Provisional
Probab=20.42  E-value=2.2e+02  Score=17.44  Aligned_cols=21  Identities=5%  Similarity=0.072  Sum_probs=18.5

Q ss_pred             cCCCeeEEEeecccHhHHHhh
Q 043514           19 HPGNKIERIYWSVSANEIMNS   39 (88)
Q Consensus        19 Hp~Gkve~~y~~vsA~eVM~~   39 (88)
                      .-||+..++..+.|.++++++
T Consensus         8 ~vNG~~~~~~~~~tl~~lL~~   28 (70)
T PRK07440          8 QVNGETRTCSSGTSLPDLLQQ   28 (70)
T ss_pred             EECCEEEEcCCCCCHHHHHHH
Confidence            459999999999999999974


Done!