Query         043519
Match_columns 130
No_of_seqs    195 out of 1138
Neff          7.8 
Searched_HMMs 46136
Date          Fri Mar 29 05:52:16 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043519.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043519hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR02227 sigpep_I_bact signal 100.0 3.3E-38 7.1E-43  225.2  13.6  117    1-124    30-163 (163)
  2 PRK10861 signal peptidase I; P 100.0 8.4E-33 1.8E-37  214.9  13.1  117    1-124    92-305 (324)
  3 KOG0171 Mitochondrial inner me 100.0 5.6E-33 1.2E-37  195.1   7.0  112    1-129    43-164 (176)
  4 PRK13838 conjugal transfer pil  99.9 1.7E-26 3.8E-31  166.6  11.6  112    6-118    34-170 (176)
  5 TIGR02771 TraF_Ti conjugative   99.9 3.5E-25 7.6E-30  159.2  10.3   98   21-118    45-167 (171)
  6 KOG1568 Mitochondrial inner me  99.9 1.8E-25   4E-30  157.0   8.5  100    1-127    41-155 (174)
  7 PF10502 Peptidase_S26:  Signal  99.9   2E-26 4.3E-31  160.5   0.5   99   22-120    21-137 (138)
  8 PRK13884 conjugal transfer pep  99.9 3.8E-24 8.3E-29  154.7  11.1   98   21-118    49-174 (178)
  9 COG4959 TraF Type IV secretory  99.8 2.7E-19 5.8E-24  124.9   4.6   95   23-117    54-166 (173)
 10 TIGR02754 sod_Ni_protease nick  99.8 3.1E-18 6.8E-23  110.8   9.2   81    1-117     8-89  (90)
 11 cd06530 S26_SPase_I The S26 Ty  99.7 4.5E-16 9.9E-21   99.4   7.9   75    1-116    10-85  (85)
 12 TIGR02228 sigpep_I_arch signal  99.3 1.7E-11 3.6E-16   87.3   9.0   79    1-117    41-119 (158)
 13 COG0681 LepB Signal peptidase   99.3 6.3E-11 1.4E-15   83.6   9.8  104    1-116    41-144 (166)
 14 PF00717 Peptidase_S24:  Peptid  99.2 2.6E-11 5.7E-16   74.3   5.6   52    1-64      7-58  (70)
 15 cd06462 Peptidase_S24_S26 The   98.5 1.5E-06 3.1E-11   54.3   7.5   52    1-64     10-62  (84)
 16 cd06529 S24_LexA-like Peptidas  98.4 1.3E-06 2.9E-11   54.4   6.7   50    1-64     10-59  (81)
 17 COG2932 Predicted transcriptio  97.9   4E-05 8.7E-10   56.6   6.2   50    1-63    133-182 (214)
 18 PRK10276 DNA polymerase V subu  97.0  0.0025 5.3E-08   44.2   5.6   41    1-55     61-102 (139)
 19 KOG3342 Signal peptidase I [In  96.9 0.00067 1.5E-08   48.0   2.2   45    1-55     58-102 (180)
 20 PRK12423 LexA repressor; Provi  96.9  0.0058 1.3E-07   44.9   7.1   48    1-63    124-172 (202)
 21 PRK00215 LexA repressor; Valid  96.8  0.0069 1.5E-07   44.3   7.0   47    1-62    128-175 (205)
 22 TIGR00498 lexA SOS regulatory   96.7    0.01 2.2E-07   43.2   7.2   47    1-62    121-168 (199)
 23 COG0681 LepB Signal peptidase   95.5   0.023   5E-07   39.6   4.2   29   45-73    137-165 (166)
 24 COG1974 LexA SOS-response tran  89.1     1.8   4E-05   32.0   6.3   46    3-62    125-170 (201)
 25 COG1097 RRP4 RNA-binding prote  86.3     1.5 3.2E-05   33.3   4.5   61    1-74    109-194 (239)
 26 COG0361 InfA Translation initi  83.0     1.4   3E-05   27.6   2.5   12   23-34     47-58  (75)
 27 TIGR00008 infA translation ini  81.8     1.5 3.2E-05   26.9   2.3   12   23-34     45-56  (68)
 28 PF05257 CHAP:  CHAP domain;  I  80.7     5.6 0.00012   26.4   5.1   38   20-64     60-98  (124)
 29 PF06890 Phage_Mu_Gp45:  Bacter  78.0      16 0.00034   26.1   6.9   39   16-63     68-109 (162)
 30 PF11101 DUF2884:  Protein of u  73.4     5.2 0.00011   30.0   3.7   25   51-75     17-42  (229)
 31 cd05793 S1_IF1A S1_IF1A: Trans  71.2     3.7 7.9E-05   25.6   2.0   12   23-34     39-50  (77)
 32 PRK12442 translation initiatio  70.2       5 0.00011   25.8   2.5   12   23-34     47-58  (87)
 33 smart00652 eIF1a eukaryotic tr  70.1       4 8.6E-05   25.9   2.0   12   23-34     44-55  (83)
 34 PF10000 ACT_3:  ACT domain;  I  69.8     2.5 5.3E-05   26.1   1.0   15    1-15     14-28  (72)
 35 PF01176 eIF-1a:  Translation i  68.8     3.4 7.3E-05   24.8   1.4   14   22-35     41-54  (65)
 36 cd04456 S1_IF1A_like S1_IF1A_l  67.5     5.3 0.00012   25.0   2.2   12   23-34     39-50  (78)
 37 PRK04012 translation initiatio  67.4     4.8  0.0001   26.5   2.1   12   23-34     60-71  (100)
 38 TIGR02594 conserved hypothetic  66.2      25 0.00055   23.9   5.6   14   21-34     72-85  (129)
 39 PF14085 DUF4265:  Domain of un  65.4      36 0.00077   22.7   6.1   46    8-62     11-57  (117)
 40 PF04319 NifZ:  NifZ domain;  I  65.3      13 0.00028   23.2   3.5   30    1-30      1-33  (75)
 41 smart00002 PLP Myelin proteoli  63.7       2 4.4E-05   25.6  -0.2   20   97-116    22-41  (60)
 42 COG4079 Uncharacterized protei  63.6      19 0.00041   27.7   4.8   31   44-74    248-282 (293)
 43 COG3602 Uncharacterized protei  63.3       5 0.00011   27.3   1.5   15    1-15     14-28  (134)
 44 cd03695 CysN_NodQ_II CysN_NodQ  62.3      24 0.00052   21.7   4.5   33   21-62     25-65  (81)
 45 PRK09919 anti-adapter protein   59.4      11 0.00024   25.4   2.7   22   54-75     39-60  (114)
 46 PF02836 Glyco_hydro_2_C:  Glyc  53.6      14 0.00029   28.4   2.7   15   60-74      1-15  (298)
 47 cd03698 eRF3_II_like eRF3_II_l  53.4      39 0.00084   20.7   4.4   33   21-62     25-65  (83)
 48 cd04089 eRF3_II eRF3_II: domai  52.7      40 0.00087   20.6   4.4   33   21-62     24-64  (82)
 49 TIGR00523 eIF-1A eukaryotic/ar  51.5      17 0.00037   23.8   2.5   10   23-32     58-67  (99)
 50 COG5131 URM1 Ubiquitin-like pr  51.3      20 0.00043   23.2   2.8   31    4-34     57-92  (96)
 51 PRK10626 hypothetical protein;  51.3      20 0.00043   27.3   3.2   24   51-75     40-64  (239)
 52 PF01479 S4:  S4 domain;  Inter  49.1     6.7 0.00014   21.5   0.3   15   62-76     23-37  (48)
 53 KOG4146 Ubiquitin-like protein  48.7      24 0.00052   23.0   2.8   31    4-34     62-97  (101)
 54 PF09285 Elong-fact-P_C:  Elong  47.2      58  0.0013   19.1   4.2   25    4-34     25-49  (56)
 55 PTZ00329 eukaryotic translatio  46.3      17 0.00037   25.8   2.1   11   23-33     71-81  (155)
 56 PLN00208 translation initiatio  45.9      18 0.00038   25.5   2.1   11   23-33     71-81  (145)
 57 cd00604 IPT_CGTD IPT domain (d  45.7      31 0.00068   21.5   3.0   23   52-74      9-38  (81)
 58 cd05792 S1_eIF1AD_like S1_eIF1  44.9      18 0.00039   22.7   1.8   27    7-34     21-50  (78)
 59 PF15057 DUF4537:  Domain of un  44.5      16 0.00035   24.8   1.7   12    2-13     53-64  (124)
 60 PF11012 DUF2850:  Protein of u  44.4      23 0.00049   22.3   2.2   25   57-81     16-40  (79)
 61 COG4013 Uncharacterized protei  44.0      28  0.0006   22.3   2.5   12   55-66     36-47  (91)
 62 PF06394 Pepsin-I3:  Pepsin inh  43.1      20 0.00044   22.4   1.8   15   61-75     24-38  (76)
 63 PF13144 SAF_2:  SAF-like        41.8 1.1E+02  0.0024   21.8   5.9   52    4-64    122-177 (196)
 64 cd04714 BAH_BAHCC1 BAH, or Bro  40.4      46   0.001   22.2   3.4   39   23-72      4-42  (121)
 65 PF01426 BAH:  BAH domain;  Int  38.3      44 0.00094   21.5   3.0   26   23-55      3-28  (119)
 66 COG0179 MhpD 2-keto-4-pentenoa  38.1      43 0.00093   25.8   3.3   16   20-35    222-237 (266)
 67 TIGR03170 flgA_cterm flagella   37.6      90  0.0019   20.4   4.5   12   23-34     66-77  (122)
 68 cd03696 selB_II selB_II: this   35.1 1.1E+02  0.0023   18.6   4.5   33   21-62     25-65  (83)
 69 KOG4030 Uncharacterized conser  34.9      48   0.001   23.8   2.9   24   52-78    130-153 (197)
 70 cd03693 EF1_alpha_II EF1_alpha  34.3 1.2E+02  0.0025   18.9   4.6   33   21-62     29-69  (91)
 71 COG0103 RpsI Ribosomal protein  33.6      51  0.0011   22.7   2.8   29   44-78     11-39  (130)
 72 PF00278 Orn_DAP_Arg_deC:  Pyri  32.9      72  0.0016   20.4   3.4   31    3-35     65-95  (116)
 73 KOG1816 Ubiquitin fusion-degra  32.8 2.4E+02  0.0053   22.3   6.6   40   22-70    145-184 (308)
 74 PRK15095 FKBP-type peptidyl-pr  31.6 1.8E+02   0.004   20.3   5.7   17   47-63    108-124 (156)
 75 cd06555 ASCH_PF0470_like ASC-1  30.8 1.1E+02  0.0024   20.3   4.0   14   21-34     30-43  (109)
 76 PF11320 DUF3122:  Protein of u  30.7 1.9E+02   0.004   20.1   5.5   46    7-58     10-55  (134)
 77 cd04466 S1_YloQ_GTPase S1_YloQ  30.7      93   0.002   17.9   3.4   13   22-34     37-49  (68)
 78 smart00439 BAH Bromo adjacent   30.2 1.1E+02  0.0025   19.4   4.1   26   23-55      2-27  (120)
 79 cd05790 S1_Rrp40 S1_Rrp40: Rrp  30.2      45 0.00097   21.2   1.9   14    1-14     46-59  (86)
 80 PF08194 DIM:  DIM protein;  In  29.4      41  0.0009   17.9   1.4   12   63-74     22-33  (36)
 81 TIGR02219 phage_NlpC_fam putat  29.1      39 0.00085   22.9   1.7   13   21-33     75-87  (134)
 82 COG1126 GlnQ ABC-type polar am  28.8      14 0.00029   28.1  -0.7   43   22-75     24-67  (240)
 83 PF01455 HupF_HypC:  HupF/HypC   28.3      52  0.0011   19.9   1.9    9    5-13     38-46  (68)
 84 PF15428 Imm14:  Immunity prote  28.1   1E+02  0.0022   20.4   3.6   22   24-54      1-22  (129)
 85 PRK04163 exosome complex RNA-b  27.3      84  0.0018   23.6   3.3   15    1-15    108-122 (235)
 86 cd04709 BAH_MTA BAH, or Bromo   27.3   1E+02  0.0022   22.0   3.6   25   23-55      4-28  (164)
 87 TIGR02988 YaaA_near_RecF S4 do  27.1      30 0.00064   19.9   0.7   14   62-75     31-44  (59)
 88 TIGR00061 L21 ribosomal protei  27.0      88  0.0019   20.5   3.0   22    6-32     14-35  (101)
 89 COG4133 CcmA ABC-type transpor  27.0      12 0.00027   27.7  -1.2   58    4-75      9-67  (209)
 90 PRK00276 infA translation init  26.3      66  0.0014   19.4   2.2   11   23-33     47-57  (72)
 91 TIGR02390 RNA_pol_rpoA1 DNA-di  26.1      89  0.0019   28.2   3.7   37   22-63    407-443 (868)
 92 PRK02268 hypothetical protein;  25.8      84  0.0018   21.9   2.8   30   21-55     34-63  (141)
 93 cd04717 BAH_polybromo BAH, or   25.7 1.1E+02  0.0023   20.2   3.3   26   23-55      4-29  (121)
 94 cd04712 BAH_DCM_I BAH, or Brom  25.6 2.2E+02  0.0048   19.3   7.7   14   22-35      5-18  (130)
 95 KOG1535 Predicted fumarylaceto  25.4      94   0.002   23.3   3.1   29   21-63    175-203 (217)
 96 PRK05573 rplU 50S ribosomal pr  25.4   1E+02  0.0022   20.2   3.1   10    7-16     16-25  (103)
 97 PLN02856 fumarylacetoacetase    25.3   2E+02  0.0043   23.9   5.3   29    4-33    346-374 (424)
 98 PF11302 DUF3104:  Protein of u  24.9 1.8E+02  0.0039   18.1   4.3   34   22-57      5-38  (75)
 99 COG4127 Uncharacterized conser  24.9      70  0.0015   25.2   2.5   26   21-54     71-96  (318)
100 PF13987 YedD:  YedD-like prote  24.5      87  0.0019   20.8   2.5   22   50-71     47-68  (111)
101 cd03694 GTPBP_II Domain II of   24.4 1.8E+02  0.0039   17.9   4.4   37   21-62     25-69  (87)
102 PF00829 Ribosomal_L21p:  Ribos  23.7      82  0.0018   20.3   2.3   22    6-32     15-36  (96)
103 PF14345 GDYXXLXY:  GDYXXLXY pr  23.6 1.1E+02  0.0023   21.0   3.1   33    4-36     16-48  (144)
104 PF01878 EVE:  EVE domain;  Int  23.4 1.1E+02  0.0024   20.6   3.1   15   21-35     38-52  (143)
105 PF10030 DUF2272:  Uncharacteri  23.4 2.3E+02  0.0049   20.6   4.8   46   21-66     92-145 (183)
106 smart00841 Elong-fact-P_C Elon  23.2 1.3E+02  0.0028   17.6   2.9   12   23-34     38-49  (56)
107 PF14415 DUF4424:  Domain of un  23.1      76  0.0016   24.3   2.4   19   17-35      6-27  (253)
108 COG4043 Preprotein translocase  22.7      63  0.0014   21.4   1.6   13   20-32     31-43  (111)
109 PF05949 DUF881:  Bacterial pro  22.5   1E+02  0.0023   21.4   2.8   23   58-80     72-94  (149)
110 cd04710 BAH_fungalPHD BAH, or   22.3 1.6E+02  0.0035   20.2   3.7   27   22-55     11-37  (135)
111 cd03697 EFTU_II EFTU_II: Elong  22.3   2E+02  0.0043   17.6   5.6   14   21-34     25-38  (87)
112 PF00380 Ribosomal_S9:  Ribosom  22.1      71  0.0015   21.6   1.9   26   47-78      5-30  (121)
113 PF11132 SplA:  Transcriptional  21.9      76  0.0016   19.7   1.8   13    1-13      1-14  (75)
114 smart00216 VWD von Willebrand   21.8 2.6E+02  0.0057   18.8   4.9   32   48-79     63-97  (162)
115 PF01079 Hint:  Hint module;  I  21.7 1.4E+02  0.0031   22.2   3.6   15   52-66     69-83  (217)
116 TIGR00074 hypC_hupF hydrogenas  21.3      73  0.0016   19.8   1.7   12   22-33     35-46  (76)
117 PF05382 Amidase_5:  Bacterioph  21.2      61  0.0013   22.7   1.4   14   21-34     74-87  (145)
118 PF00877 NLPC_P60:  NlpC/P60 fa  21.1      60  0.0013   20.6   1.3   13   21-33     50-62  (105)
119 PF01052 SpoA:  Surface present  20.9 1.2E+02  0.0026   18.1   2.6   13   22-34     28-40  (77)
120 COG3250 LacZ Beta-galactosidas  20.6      94   0.002   27.9   2.8   16   59-74    285-300 (808)
121 smart00663 RPOLA_N RNA polymer  20.4 3.1E+02  0.0067   21.5   5.3   37   22-63    198-234 (295)
122 PRK10413 hydrogenase 2 accesso  20.3      79  0.0017   19.9   1.7   12    3-14     41-52  (82)
123 PF06097 DUF945:  Bacterial pro  20.3 1.1E+02  0.0024   24.6   2.9   21   56-76    433-457 (460)
124 CHL00010 infA translation init  20.2 1.1E+02  0.0023   18.9   2.3   11   23-33     47-57  (78)
125 PF13759 2OG-FeII_Oxy_5:  Putat  20.1      69  0.0015   20.3   1.5   13   22-34     69-81  (101)

No 1  
>TIGR02227 sigpep_I_bact signal peptidase I, bacterial type. A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes.
Probab=100.00  E-value=3.3e-38  Score=225.24  Aligned_cols=117  Identities=24%  Similarity=0.329  Sum_probs=103.8

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccc
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFIL   80 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~   80 (130)
                      |+|||++||+|+++|+.|....+++||+|+|+.|.       ..++.++|||+|+|||+|+++++++||||+.++++|..
T Consensus        30 M~Ptl~~Gd~vlv~k~~~~~~~~~rGDiVvf~~~~-------~~~~~~iKRVig~pGd~v~i~~~~l~vNg~~~~~~~~~  102 (163)
T TIGR02227        30 MEPTLKEGDRILVNKFAYGTSDPKRGDIVVFKDPD-------DNKNIYVKRVIGLPGDKVEFRDGKLYINGKKIDEPYLK  102 (163)
T ss_pred             cccchhCCCEEEEEEeEcCCCCCCCCcEEEEecCC-------CCCceeEEEEEecCCCEEEEECCEEEECCEECcccccc
Confidence            99999999999999998888899999999999875       35679999999999999999999999999999998765


Q ss_pred             cCCC--------CCCCCEEeCCCC---------CCCCCCccccccCCCeeeEEEEEEeeCC
Q 043519           81 EAPF--------YNMTPITVLENS---------NSYDLLVCLDELADHIPSSLDFKYQHHG  124 (130)
Q Consensus        81 ~~~~--------~~~~~~~vp~g~---------~S~DSR~~G~V~~~~I~Gkv~~~~~P~~  124 (130)
                      +...        ....+++||+||         +|+||||||+|++++|+|||++++||++
T Consensus       103 ~~~~~~~~~~~~~~~~~~~vp~g~~fvlGDnr~~S~DSR~~G~V~~~~I~Gk~~~~~~p~~  163 (163)
T TIGR02227       103 PNGSLDTSGFNTTDFKPVTVPPGHYFVLGDNRDNSLDSRYFGFVPIDDIIGKVSFVFYPFD  163 (163)
T ss_pred             cccccccccccccccCceEECCCCEEEECCCCCCCcccCCcCcCCHHHeEEEEEEEECCCC
Confidence            3211        123467889998         8999999999999999999999999985


No 2  
>PRK10861 signal peptidase I; Provisional
Probab=100.00  E-value=8.4e-33  Score=214.92  Aligned_cols=117  Identities=18%  Similarity=0.164  Sum_probs=96.4

Q ss_pred             CccccccCCEEEEEccccCC------------CCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEe--CCE
Q 043519            1 MLRAYVVTSLRRKGSVTYYF------------REPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEAC--EGK   66 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~------------~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~--~~~   66 (130)
                      |+|||..||+|+|+|++|.+            +.|+|||||+|+.|.       +++..+||||||+|||+|+++  +++
T Consensus        92 M~PTL~~GD~IlVnK~~yg~~~p~~~~~~~~~~~p~RGDIVVF~~P~-------~~~~~yIKRVIGlPGD~I~~~~~~~~  164 (324)
T PRK10861         92 MMPTLLIGDFILVEKFAYGIKDPITQTTLIETGHPKRGDIVVFKYPE-------DPKLDYIKRVVGLPGDKVTYDPVSKE  164 (324)
T ss_pred             CcCcccCCCEEEEEEeecCccCccccccccccCCCCCCCEEEEecCC-------CCCCcEEEEeeecCCcEEEEEeCCCE
Confidence            99999999999999999863            579999999999987       457889999999999999997  899


Q ss_pred             EEECCEEccccc-----------------cc---------------------------------c-----------CCC-
Q 043519           67 LIVNGVVRNKDF-----------------IL---------------------------------E-----------APF-   84 (130)
Q Consensus        67 l~vng~~~~~~~-----------------~~---------------------------------~-----------~~~-   84 (130)
                      |||||+.+...+                 ..                                 +           .+. 
T Consensus       165 l~iNg~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~~~~h~i~~~~~~  244 (324)
T PRK10861        165 VTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFQVPLNETKENGIRLSERKETLGDVTHRILTVPGA  244 (324)
T ss_pred             EEEcCccccccccccccccccccccccccccccccccccccccccccccccccccccccceeEEEecCCccceeeecCCc
Confidence            999997421100                 00                                 0           000 


Q ss_pred             ------------CCCCCEEeCCCC---------CCCCCCccccccCCCeeeEEEEEEeeCC
Q 043519           85 ------------YNMTPITVLENS---------NSYDLLVCLDELADHIPSSLDFKYQHHG  124 (130)
Q Consensus        85 ------------~~~~~~~vp~g~---------~S~DSR~~G~V~~~~I~Gkv~~~~~P~~  124 (130)
                                  .++.+++||+|+         +|+||||||+||.++|+|+|..++|+++
T Consensus       245 ~~~~~~~~~~~~~~~~~~~vp~g~yf~mgdnr~~S~DSRy~G~Vp~~~i~G~a~~i~~s~d  305 (324)
T PRK10861        245 QDQVGMYYQQPGQPLATWVVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGKATAIWMSFE  305 (324)
T ss_pred             ccccccccccCCCcCceEEECCCeEEEeCCCCCCCcccCcccccCHHHcEEEEEEEEEEcC
Confidence                        013567999998         8999999999999999999999999986


No 3  
>KOG0171 consensus Mitochondrial inner membrane protease, subunit IMP1 [Posttranslational modification, protein turnover, chaperones]
Probab=99.98  E-value=5.6e-33  Score=195.11  Aligned_cols=112  Identities=34%  Similarity=0.383  Sum_probs=98.0

Q ss_pred             Ccccccc-CCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEcccccc
Q 043519            1 MLRAYVV-TSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFI   79 (130)
Q Consensus         1 M~Ptl~~-gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~   79 (130)
                      |+|||++ ||+|++.|++++++.+++||+|++..|.       ...+.+||||+|++||-|++.++.+.+|+..  |.+.
T Consensus        43 M~PTl~~~gd~l~aEkls~~f~~~~~gDIVi~~sP~-------~~~~~~cKRIva~eGD~v~v~~~~~~~n~~~--e~~~  113 (176)
T KOG0171|consen   43 MEPTLHDGGDVLLAEKLSYRFRKPQVGDIVIAKSPP-------DPKEHICKRIVAMEGDLVEVHDGPLVVNDLV--EKFS  113 (176)
T ss_pred             cCceecCCCcEEehhhhhHhhcCCCCCCEEEEeCCC-------CchhhhhheeeccCCceEEEecCCcccchhh--hhcc
Confidence            9998886 5666669999999999999999999998       4678899999999999999999988888664  3332


Q ss_pred             ccCCCCCCCCEEeCCCC---------CCCCCCccccccCCCeeeEEEEEEeeCCCCCcC
Q 043519           80 LEAPFYNMTPITVLENS---------NSYDLLVCLDELADHIPSSLDFKYQHHGNPSIA  129 (130)
Q Consensus        80 ~~~~~~~~~~~~vp~g~---------~S~DSR~~G~V~~~~I~Gkv~~~~~P~~~~g~~  129 (130)
                              .+++||+||         +|+|||+|||||.+.|+||+++++||.+++++.
T Consensus       114 --------~~i~VP~GhVfv~GDN~~nS~DSr~yGplP~glI~gRvv~r~Wp~s~~~~~  164 (176)
T KOG0171|consen  114 --------TPIRVPEGHVFVEGDNRNNSLDSRNYGPLPMGLIQGRVVFRIWPPSRVSGL  164 (176)
T ss_pred             --------ceeeccCceEEEecCCCCCcccccccCCCchhheeeeEEEEecCchhccee
Confidence                    367888888         999999999999999999999999999998764


No 4  
>PRK13838 conjugal transfer pilin processing protease TraF; Provisional
Probab=99.94  E-value=1.7e-26  Score=166.59  Aligned_cols=112  Identities=16%  Similarity=0.041  Sum_probs=86.9

Q ss_pred             ccCCEEEEEccccCCCCCCCCcEEEEecCCccc-----cccc-C------CCceEEEEEEEeCCCEEEEeCCEEEECCEE
Q 043519            6 VVTSLRRKGSVTYYFREPFANDILIFKSPPLLQ-----EVGY-T------DDGVYIKGIVAKEGDVVEACEGKLIVNGVV   73 (130)
Q Consensus         6 ~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~-----~~~~-~------~~~~~vKRVig~pGD~v~~~~~~l~vng~~   73 (130)
                      .+.+.+.+.++.+..+.++|||+|+|+.|...+     +++| .      ....++|||+|+|||+|++++ +++|||+.
T Consensus        34 T~S~pig~y~~~~~~~~~~rGDiVvf~~P~~~~~~~a~~r~yl~~g~~p~~~~~~iKRViglpGD~V~i~~-~v~iNg~~  112 (176)
T PRK13838         34 TPSEPLGLWRIEALDRPVAVGDLVFICPPETAAFREARERGYLRRGLCPGGFAPLIKTVAALAGQRVEIGG-SVSIDGRP  112 (176)
T ss_pred             CCCCEEEEEEEeccCCCCCCCcEEEEECCchhhhhhhhhcccccccccccCCCceEEEEEEeCCcEEEECC-EEEECCEE
Confidence            457778888887767889999999999886531     1222 1      124699999999999999985 89999999


Q ss_pred             ccccccccCCC--C---CCCCEEeCCCC--------CCCCCCccccccCCCeeeEEEE
Q 043519           74 RNKDFILEAPF--Y---NMTPITVLENS--------NSYDLLVCLDELADHIPSSLDF  118 (130)
Q Consensus        74 ~~~~~~~~~~~--~---~~~~~~vp~g~--------~S~DSR~~G~V~~~~I~Gkv~~  118 (130)
                      +.++|......  .   .+...+||+|+        +|+||||||+|++++|+|+|.-
T Consensus       113 ~~~~~~~~~~~~g~~l~~~~~~~vp~g~~fvlgd~~~S~DSRy~G~V~~~~I~G~a~p  170 (176)
T PRK13838        113 LPSSSVRRRDGEGRPLTPFPGGVVPPGHLFLHSSFAGSYDSRYFGPVPASGLLGLARP  170 (176)
T ss_pred             ccccccccccccCCcCCCCCccCcCCCeEEEECCCCCCCcccccCcccHHHeEEEEEE
Confidence            99987653221  1   12235678887        8999999999999999999963


No 5  
>TIGR02771 TraF_Ti conjugative transfer signal peptidase TraF. This protein is found in apparent operons encoding elements of conjugative transfer systems. This family is homologous to a broader family of signal (leader) peptidases such as lepB. This family is present in both Ti-type and I-type conjugative systems.
Probab=99.92  E-value=3.5e-25  Score=159.20  Aligned_cols=98  Identities=17%  Similarity=0.160  Sum_probs=74.5

Q ss_pred             CCCCCCcEEEEecCCccc-----cccc-CCC------ceEEEEEEEeCCCEEEEeCCEEEECCEEccccccccCC--C--
Q 043519           21 REPFANDILIFKSPPLLQ-----EVGY-TDD------GVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFILEAP--F--   84 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~-----~~~~-~~~------~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~~~~--~--   84 (130)
                      +.++|||+|+|+.|....     .++| +.+      ..++|||+|+|||+|+++++.++|||+.+.+.+.....  +  
T Consensus        45 ~~~~rGDiVvf~~p~~~~~~~~~~rg~l~~g~~p~~~~~~vKRViglpGD~V~i~~~~v~INg~~~~~~~~~~~~~~g~~  124 (171)
T TIGR02771        45 KPVERGDYVVFCPPDNPQFEEARERGYLREGLCPGGFGPLLKRVLGLPGDRVTVRADVVAINGQLLPYSKPLATDSSGRP  124 (171)
T ss_pred             CCCCCCcEEEEeCCCchhhhchhhcCcccccccCcCccceEEEEEEeCCCEEEEECCEEEECCEEcccccccccccCCCc
Confidence            479999999999886421     1222 122      38999999999999999999999999998876533211  1  


Q ss_pred             -CCCCCEEeCCCC--------CCCCCCccccccCCCeeeEEEE
Q 043519           85 -YNMTPITVLENS--------NSYDLLVCLDELADHIPSSLDF  118 (130)
Q Consensus        85 -~~~~~~~vp~g~--------~S~DSR~~G~V~~~~I~Gkv~~  118 (130)
                       ....+.+||+|.        +|+||||||+|++++|+|||.-
T Consensus       125 l~~~~~~~vp~gyf~lgdn~~~S~DSRy~G~V~~~~IiGk~~p  167 (171)
T TIGR02771       125 LPPFPEGVIPPGFFVVHDTSPTSFDSRYFGPISREQVIGRVKP  167 (171)
T ss_pred             cccCCCcEECCCEEEECCCCCCCCcccccceecHHHeEEEEEE
Confidence             112356666666        8999999999999999999964


No 6  
>KOG1568 consensus Mitochondrial inner membrane protease, subunit IMP2 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport]
Probab=99.92  E-value=1.8e-25  Score=156.95  Aligned_cols=100  Identities=22%  Similarity=0.152  Sum_probs=85.2

Q ss_pred             CccccccC------CEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEc
Q 043519            1 MLRAYVVT------SLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVR   74 (130)
Q Consensus         1 M~Ptl~~g------d~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~   74 (130)
                      |.|||+++      |+||++|+.-.-+.+.|||+|+|.+|.       ++++.+||||+|++||++.-.+.         
T Consensus        41 mqPtlnP~~~~~~~d~Vll~k~~v~n~~~~rGDiVvl~sP~-------~p~~~~iKRv~alegd~~~t~~~---------  104 (174)
T KOG1568|consen   41 MQPTLNPTMNTNEKDTVLLRKWNVKNRKVSRGDIVVLKSPN-------DPDKVIIKRVAALEGDIMVTEDE---------  104 (174)
T ss_pred             CCCccCCCcccccccEEEEEeeccccceeccCCEEEEeCCC-------ChhheeeeeeecccccEeccCCC---------
Confidence            88999874      999999987555678999999999998       57899999999999999977321         


Q ss_pred             cccccccCCCCCCCCEEeCCCC---------CCCCCCccccccCCCeeeEEEEEEeeCCCCC
Q 043519           75 NKDFILEAPFYNMTPITVLENS---------NSYDLLVCLDELADHIPSSLDFKYQHHGNPS  127 (130)
Q Consensus        75 ~~~~~~~~~~~~~~~~~vp~g~---------~S~DSR~~G~V~~~~I~Gkv~~~~~P~~~~g  127 (130)
                                 ....+.||+||         .|+|||.||||+...|.|+|++++||+.|++
T Consensus       105 -----------k~~~v~vpkghcWVegDn~~hs~DSntFGPVS~gli~grai~ilwpP~R~~  155 (174)
T KOG1568|consen  105 -----------KEEPVVVPKGHCWVEGDNQKHSYDSNTFGPVSTGLIVGRAIYILWPPVRWQ  155 (174)
T ss_pred             -----------CCCceecCCCcEEEecCCcccccccCccCCcchhheeeeEEEEEcChHHhh
Confidence                       12345566666         9999999999999999999999999999875


No 7  
>PF10502 Peptidase_S26:  Signal peptidase, peptidase S26 ;  InterPro: IPR019533 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].  This entry represents a conserved region found in the S26A family of serine endopeptidases, which function in the processing of newly-synthesised secreted proteins. Peptidase S26 removes the hydrophobic, N-terminal signal peptides as proteins are translocated across membranes. ; PDB: 3S04_B 1KN9_C 1B12_D 3IIQ_B 1T7D_A.
Probab=99.92  E-value=2e-26  Score=160.55  Aligned_cols=99  Identities=23%  Similarity=0.258  Sum_probs=23.0

Q ss_pred             CCCCCcEEEEecCCccc----cccc-CCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccccCCCCC----CCCEEe
Q 043519           22 EPFANDILIFKSPPLLQ----EVGY-TDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFILEAPFYN----MTPITV   92 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~----~~~~-~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~~~~~~~----~~~~~v   92 (130)
                      .++|||+|+|+.|....    +++| ..+..++|||+|+|||+|+++++.++|||+.+.+.+..+..+..    ..+.+|
T Consensus        21 ~~~rGd~V~f~~p~~~~~~~~~~gy~~~~~~~iKrV~a~pGD~V~v~~~~v~iNG~~~~~~~~~d~~g~~l~~~~~~~~v  100 (138)
T PF10502_consen   21 KIERGDLVVFCPPAEVAFFAAERGYLPEGQPLIKRVAAVPGDTVEVTDGGVYINGRPVGEPLATDSDGRPLPQFSGSGTV  100 (138)
T ss_dssp             --------------------------------------------------------------------S-T----TEEE-
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCceEe
Confidence            37999999999997532    3444 45679999999999999999999999999988876654332221    135778


Q ss_pred             CCCC---------CCCCCCccccccCCCeeeEEEEEE
Q 043519           93 LENS---------NSYDLLVCLDELADHIPSSLDFKY  120 (130)
Q Consensus        93 p~g~---------~S~DSR~~G~V~~~~I~Gkv~~~~  120 (130)
                      |+|+         +|+||||||+|++++|+|+|...+
T Consensus       101 p~g~~~v~gd~~~~S~DSRy~G~V~~~~I~g~~~pl~  137 (138)
T PF10502_consen  101 PEGEYFVLGDNRPNSFDSRYFGPVPRSQIIGKARPLW  137 (138)
T ss_dssp             -TTEEEEE-SBTTS--SHHHH--EEGGGEEEEEEEEE
T ss_pred             CCCEEEEecCCCCCccccCEecccCHHHEEEEEEEEE
Confidence            8877         999999999999999999997543


No 8  
>PRK13884 conjugal transfer peptidase TraF; Provisional
Probab=99.91  E-value=3.8e-24  Score=154.72  Aligned_cols=98  Identities=20%  Similarity=0.233  Sum_probs=74.8

Q ss_pred             CCCCCCcEEEEecCCcc-----ccccc------CC-CceEEEEEEEeCCCEEEEeCCEEEECCEEccccc--cccCC---
Q 043519           21 REPFANDILIFKSPPLL-----QEVGY------TD-DGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDF--ILEAP---   83 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~-----~~~~~------~~-~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~--~~~~~---   83 (130)
                      ..+++||+|+|++|+..     .+++|      +. ...++|||+|+|||+|+++++.++|||+.+.+..  ..+..   
T Consensus        49 ~~~~~Gd~V~f~~p~~~~~~~a~~rgyl~~g~~p~~~~~liKRVva~pGD~V~~~~~~l~VNG~~v~~~~~~~~d~~g~~  128 (178)
T PRK13884         49 APVEKGAYVLFCPPQRGVFDDAKERGYIGAGFCPGGYGYMMKRVLAAKGDAVSVTDDGVRVNGELLPLSKPILADGAGRP  128 (178)
T ss_pred             CCCCCCCEEEEeCCchHHHHHHHhCCccccCcCCCCCCceEEEEEeeCCcEEEEECCEEEECCEEccccccccccccCCc
Confidence            36899999999988742     23343      11 2489999999999999999999999999986543  22211   


Q ss_pred             --CCCCCCEEeCCCC---------CCCCCCccccccCCCeeeEEEE
Q 043519           84 --FYNMTPITVLENS---------NSYDLLVCLDELADHIPSSLDF  118 (130)
Q Consensus        84 --~~~~~~~~vp~g~---------~S~DSR~~G~V~~~~I~Gkv~~  118 (130)
                        .+....++||+|+         +|+||||||+|++++|+|++.-
T Consensus       129 l~~~~~~~~~lp~g~~fvlgd~~~~S~DSRYfG~V~~~~I~G~~~P  174 (178)
T PRK13884        129 LPRYQANSYTLGESELLLMSDVSATSFDGRYFGPINRSQIKTVIRP  174 (178)
T ss_pred             ccccCCCceEECCCEEEEECCCCCCCCcccccCcccHHHEEEEEEE
Confidence              1223345788887         8999999999999999999853


No 9  
>COG4959 TraF Type IV secretory pathway, protease TraF [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=99.77  E-value=2.7e-19  Score=124.89  Aligned_cols=95  Identities=14%  Similarity=0.086  Sum_probs=74.6

Q ss_pred             CCCCcEEEEecCCcc----ccccc-CCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccccCCCCCC----CCEEeC
Q 043519           23 PFANDILIFKSPPLL----QEVGY-TDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFILEAPFYNM----TPITVL   93 (130)
Q Consensus        23 ~~rGDiVvf~~p~~~----~~~~~-~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~~~~~~~~----~~~~vp   93 (130)
                      +.+||+|++++|...    .++|| +....++|||.|+|||+|++..+.+-|||+.+......+..+..+    ++-.+.
T Consensus        54 vt~g~lV~v~pP~~~a~~aA~RGYLp~~~pllK~i~Alpgq~Vci~~~~I~I~G~~v~~sl~~D~~GR~lp~~~gcR~l~  133 (173)
T COG4959          54 VTKGDLVLVCPPQRAAFLAAQRGYLPPYIPLLKRILALPGQHVCITSQGIAIDGKPVAASLPVDRVGRALPRWQGCRYLA  133 (173)
T ss_pred             cccCCEEEECCCchHhHhHhhcCccccccHHHHHHhcCCCCcEEEecceEEECCEEeeeeccccccCCcCCcccCCceec
Confidence            499999999999863    34777 668899999999999999999999999999987654444333221    111233


Q ss_pred             CCC---------CCCCCCccccccCCCeeeEEE
Q 043519           94 ENS---------NSYDLLVCLDELADHIPSSLD  117 (130)
Q Consensus        94 ~g~---------~S~DSR~~G~V~~~~I~Gkv~  117 (130)
                      +++         .||||||||+||.++|+|.+.
T Consensus       134 ~~el~lL~~~~~~SfDsRYfGpipas~vig~aR  166 (173)
T COG4959         134 PSELLLLTDRSSTSFDSRYFGPIPASQVIGVAR  166 (173)
T ss_pred             CCeEEEEeccCCcccccceecccCHHHcceeee
Confidence            333         899999999999999999985


No 10 
>TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease. Members of this protein family are apparent proteases encoded adjacent to the genes for a nickel-type superoxide dismutase. This family belongs to the same larger family (see Pfam model pfam00717) as signal peptidase I, an unusual serine protease suggested to have a Ser/Lys catalytic dyad.
Probab=99.77  E-value=3.1e-18  Score=110.76  Aligned_cols=81  Identities=15%  Similarity=0.053  Sum_probs=65.9

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccc
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFIL   80 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~   80 (130)
                      |+|||++||+|+++++......+++||+|+|+.|.       .++..++||+++++++.+.+                  
T Consensus         8 M~P~l~~GD~vlv~~~~~~~~~~~~Gdivv~~~~~-------~~~~~~vkRv~~~~~~~~~l------------------   62 (90)
T TIGR02754         8 MSPTLPPGDRIIVVPWLKIFRVPPIGNVVVVRHPL-------QPYGLIIKRLAAVDDNGLFL------------------   62 (90)
T ss_pred             ccCccCCCCEEEEEEccccCCCCCCCeEEEEecCC-------CCcceEEEEeeEEcCCeEEE------------------
Confidence            99999999999999865444556789999999875       24689999999997654433                  


Q ss_pred             cCCCCCCCCEEeCCCC-CCCCCCccccccCCCeeeEEE
Q 043519           81 EAPFYNMTPITVLENS-NSYDLLVCLDELADHIPSSLD  117 (130)
Q Consensus        81 ~~~~~~~~~~~vp~g~-~S~DSR~~G~V~~~~I~Gkv~  117 (130)
                                 ..+|. .|.|||++|+|+..+|+|+|+
T Consensus        63 -----------~~dN~~~~~d~~~~g~v~~~~I~G~v~   89 (90)
T TIGR02754        63 -----------LGDNPKASTDSRQLGPVPRSLLLGKVL   89 (90)
T ss_pred             -----------eCCCCCCCCcccccCCCcHHHEEEEEE
Confidence                       23333 689999999999999999985


No 11 
>cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are translocated across biological membranes. The bacterial signal peptidase I, which is the most intensively studied, has two N-terminal transmembrane segments inserted in the plasma membrane and a hydrophilic, C-terminal catalytic region that is located in the periplasmic space. Although the bacterial signal peptidase I is monomeric, signal peptidases of eukaryotic cells commonly function as oligomeric complexes containing two divergent copies of the catalytic monomer. These are the IMP1 and IMP2 signal peptidases of the mitochondrial inner membrane that remove leader peptides from nuclear- and mitochondrial-encoded proteins. Also, two components of the endoplasmic reticulum signal peptidase in mammals (18-kDa and 21-kDa
Probab=99.66  E-value=4.5e-16  Score=99.39  Aligned_cols=75  Identities=27%  Similarity=0.305  Sum_probs=62.8

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccc
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFIL   80 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~   80 (130)
                      |+||++.||+|++++....+..+++||+|+|+.+.       ..+..++|||++                          
T Consensus        10 M~P~i~~gd~v~v~~~~~~~~~~~~GDiv~~~~~~-------~~~~~~vkRv~~--------------------------   56 (85)
T cd06530          10 MEPTLQPGDLVLVNKLSYGFREPKRGDVVVFKSPG-------DPGKPIIKRVIG--------------------------   56 (85)
T ss_pred             CcCcccCCCEEEEEEeecccCCCCCCCEEEEeCCC-------CCCCEEEEEEEE--------------------------
Confidence            99999999999999876544579999999999975       236899999999                          


Q ss_pred             cCCCCCCCCEEeCCCC-CCCCCCccccccCCCeeeEE
Q 043519           81 EAPFYNMTPITVLENS-NSYDLLVCLDELADHIPSSL  116 (130)
Q Consensus        81 ~~~~~~~~~~~vp~g~-~S~DSR~~G~V~~~~I~Gkv  116 (130)
                              .++.+++. +|.|||+||+++.++|+|++
T Consensus        57 --------~~~~gDn~~ns~d~~~~g~~~~~~i~G~~   85 (85)
T cd06530          57 --------YFVLGDNRNNSLDSRYWGPVPEDDIVGKV   85 (85)
T ss_pred             --------EEEeeCCCCCCCccCCcCCCcHHHeEEeC
Confidence                    12345554 89999999999999999985


No 12 
>TIGR02228 sigpep_I_arch signal peptidase I, archaeal type. This model represents signal peptidase I from most archaea, a subunit of the eukaryotic endoplasmic reticulum signal peptidase I complex, and an apparent signal peptidase I from a small number of bacteria. It is related to but does not overlap in hits with TIGR02227, the bacterial and mitochondrial signal peptidase I.
Probab=99.31  E-value=1.7e-11  Score=87.26  Aligned_cols=79  Identities=14%  Similarity=0.104  Sum_probs=58.5

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccc
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFIL   80 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~   80 (130)
                      |+|||++||++++++..  ..++++||+|+|+.|.        ..+.++|||+++.++     ++      +.   .   
T Consensus        41 M~Ptl~~GD~vlv~~~~--~~~~~~GDIVvf~~~~--------~~~~iihRVi~v~~~-----~g------~~---~---   93 (158)
T TIGR02228        41 MEPTFNTGDLILVTGAD--PNDIQVGDVITYKSPG--------FNTPVTHRVIEINNS-----GG------EL---G---   93 (158)
T ss_pred             CcCCccCCCEEEEEecc--cCCCCCCCEEEEEECC--------CCccEEEEEEEEECC-----CC------cE---E---
Confidence            99999999999999854  3589999999999875        237899999998643     11      10   0   


Q ss_pred             cCCCCCCCCEEeCCCCCCCCCCccccccCCCeeeEEE
Q 043519           81 EAPFYNMTPITVLENSNSYDLLVCLDELADHIPSSLD  117 (130)
Q Consensus        81 ~~~~~~~~~~~vp~g~~S~DSR~~G~V~~~~I~Gkv~  117 (130)
                              -++-+++..+.|   .++|+.++|+|++.
T Consensus        94 --------~~tkGDnN~~~D---~~~v~~~~IiG~v~  119 (158)
T TIGR02228        94 --------FITKGDNNPAPD---GEPVPSENVIGKYL  119 (158)
T ss_pred             --------EEEEecCCCCCC---cccCCHHHEEEEEE
Confidence                    112233334445   68999999999997


No 13 
>COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion]
Probab=99.26  E-value=6.3e-11  Score=83.59  Aligned_cols=104  Identities=18%  Similarity=0.115  Sum_probs=72.5

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCEEccccccc
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDFIL   80 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~~~   80 (130)
                      |+|||+.||+|+++|++|....+..++++.+  |.       .....++||+++++||++.++++.+++ +..+.+.+..
T Consensus        41 M~Ptl~~GD~v~v~k~~~~~~~~~~~~~~~~--~~-------~~~~~~~kr~~~~~GD~i~~~~~~~~~-~~~~~~~~~~  110 (166)
T COG0681          41 MEPTLNVGDRVLVKKFSYGFGKLKVPDIIVL--PA-------VVEGDLIKRVIGLRGDIVVFKDDRLYV-VPIIPRVYGL  110 (166)
T ss_pred             cccccccCCEEEEEeccccccCCccceeeec--CC-------CCCcceEEEeccCCCCEEEEECCEEEe-ecccCcchhh
Confidence            9999999999999999999888999999832  22       357899999999999999999999998 3333332211


Q ss_pred             cCCCCCCCCEEeCCCCCCCCCCccccccCCCeeeEE
Q 043519           81 EAPFYNMTPITVLENSNSYDLLVCLDELADHIPSSL  116 (130)
Q Consensus        81 ~~~~~~~~~~~vp~g~~S~DSR~~G~V~~~~I~Gkv  116 (130)
                      ...  ............+.+++.++.......+.++
T Consensus       111 ~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (166)
T COG0681         111 VEK--DNGKHLVDVIVNANSSRVFGIITKKDYIKRV  144 (166)
T ss_pred             hhc--ccccccccccccccCccccccccccccccce
Confidence            100  0000011111166777777776666666666


No 14 
>PF00717 Peptidase_S24:  Peptidase S24-like peptidase classification. ;  InterPro: IPR019759 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].; PDB: 1KCA_H 3BDN_A 1F39_A 1JHH_A 1JHE_B 3JSP_A 1JHF_B 1JHC_A 3JSO_B 1B12_D ....
Probab=99.22  E-value=2.6e-11  Score=74.31  Aligned_cols=52  Identities=23%  Similarity=0.346  Sum_probs=42.3

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeC
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACE   64 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~   64 (130)
                      |+|+|++||+|++++..    .++.||+|+|..+.        ....++||+++.+|+.+.+..
T Consensus         7 M~P~i~~Gd~v~v~~~~----~~~~gdivv~~~~~--------~~~~~iKrv~~~~~~~~~~~~   58 (70)
T PF00717_consen    7 MEPTIKDGDIVLVDPSS----EPKDGDIVVVKIDG--------DEELYIKRVVGEPGGIILISS   58 (70)
T ss_dssp             TGGTSSTTEEEEEEETS-------TTSEEEEEETT--------EESEEEEEEEEETTEEEEE-S
T ss_pred             cccCeeCCCEEEEEEcC----CCccCeEEEEEECC--------ceeeEEEEEEEeCCCEEEEec
Confidence            99999999999999764    78999999999864        124999999999999999864


No 15 
>cd06462 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The S26 type I signal peptidase (SPase) family also includes mitochondrial inner membrane protease (IMP)-like members. SPases are essential membrane-bound proteases which function to cleave away the amino-terminal signal peptide from the translocated pre-protein, thus playing a crucial role in the tr
Probab=98.45  E-value=1.5e-06  Score=54.34  Aligned_cols=52  Identities=19%  Similarity=0.217  Sum_probs=42.9

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCC-CEEEEeC
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEG-DVVEACE   64 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pG-D~v~~~~   64 (130)
                      |+|++.+||+|++++..   ..++.||++++..+         .+..++||+...++ +.+.+..
T Consensus        10 M~P~i~~gd~v~i~~~~---~~~~~G~iv~~~~~---------~~~~~ikrl~~~~~~~~~~l~~   62 (84)
T cd06462          10 MEPTIPDGDLVLVDKSS---YEPKRGDIVVFRLP---------GGELTVKRVIGLPGEGHYFLLG   62 (84)
T ss_pred             ccCcccCCCEEEEEecC---CCCcCCEEEEEEcC---------CCcEEEEEEEEECCCCEEEEEC
Confidence            99999999999999753   14899999999985         24899999999997 6665543


No 16 
>cd06529 S24_LexA-like Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains:  an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the
Probab=98.42  E-value=1.3e-06  Score=54.43  Aligned_cols=50  Identities=14%  Similarity=0.137  Sum_probs=42.7

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeC
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACE   64 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~   64 (130)
                      |+|++++||.|++++..    .++.||++++..+          +..++||+...+++.+.+..
T Consensus        10 M~p~i~~gd~lii~~~~----~~~~g~i~~~~~~----------~~~~ikr~~~~~~~~~~L~s   59 (81)
T cd06529          10 MEPTIPDGDLVLVDPSD----TPRDGDIVVARLD----------GELTVKRLQRRGGGRLRLIS   59 (81)
T ss_pred             cCCccCCCCEEEEcCCC----CCCCCCEEEEEEC----------CEEEEEEEEECCCCcEEEEe
Confidence            99999999999998753    4899999999984          37899999999977776653


No 17 
>COG2932 Predicted transcriptional regulator [Transcription]
Probab=97.88  E-value=4e-05  Score=56.64  Aligned_cols=50  Identities=12%  Similarity=0.146  Sum_probs=41.6

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEe
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEAC   63 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~   63 (130)
                      |+|++++||.++|+.-.    +..+||.|++..-         .+..+|||+.-.+|-.+.+.
T Consensus       133 MeP~~~~Gd~ilVd~~~----~~~~gd~v~v~~~---------g~~~~VK~l~~~~~~~~~l~  182 (214)
T COG2932         133 MEPTYEDGDTLLVDPGV----NTRRGDRVYVETD---------GGELYVKKLQREPGGLLRLV  182 (214)
T ss_pred             ccccccCCCEEEECCCC----ceeeCCEEEEEEe---------CCeEEEEEEEEecCCeEEEE
Confidence            99999999999998643    5678997777653         46899999999999988664


No 18 
>PRK10276 DNA polymerase V subunit UmuD; Provisional
Probab=96.96  E-value=0.0025  Score=44.16  Aligned_cols=41  Identities=20%  Similarity=0.159  Sum_probs=32.9

Q ss_pred             Cc-cccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519            1 ML-RAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus         1 M~-Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      |. |+|..||+|++++-.    .++.||+|++..          .+...+||+.-.
T Consensus        61 M~~~~I~~GD~liVd~~~----~~~~Gdivv~~~----------~g~~~vKrl~~~  102 (139)
T PRK10276         61 MIDAGISDGDLLIVDSAI----TASHGDIVIAAV----------DGEFTVKKLQLR  102 (139)
T ss_pred             CCCCCCCCCCEEEEECCC----CCCCCCEEEEEE----------CCEEEEEEEEEC
Confidence            86 689999999998642    578999999875          356889998753


No 19 
>KOG3342 consensus Signal peptidase I [Intracellular trafficking, secretion, and vesicular transport]
Probab=96.89  E-value=0.00067  Score=47.95  Aligned_cols=45  Identities=16%  Similarity=0.109  Sum_probs=34.8

Q ss_pred             CccccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519            1 MLRAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      |+|..+.||.++.....  -...+.||+|+|+.+.        ...+.+-||+-+
T Consensus        58 MePaF~RGDlLfL~N~~--~~p~~vGdivVf~veg--------R~IPiVHRviK~  102 (180)
T KOG3342|consen   58 MEPAFHRGDLLFLTNRN--EDPIRVGDIVVFKVEG--------REIPIVHRVIKQ  102 (180)
T ss_pred             cCcccccccEEEEecCC--CCcceeccEEEEEECC--------ccCchhHHHHHH
Confidence            99999999999986422  2346899999999975        456777777754


No 20 
>PRK12423 LexA repressor; Provisional
Probab=96.86  E-value=0.0058  Score=44.89  Aligned_cols=48  Identities=21%  Similarity=0.223  Sum_probs=36.8

Q ss_pred             Cc-cccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEe
Q 043519            1 ML-RAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEAC   63 (130)
Q Consensus         1 M~-Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~   63 (130)
                      |. |+|.+||+|+|++-    ..++.||+|++..          .+...+||+.-. ++.+.+.
T Consensus       124 M~~~~i~~Gd~viv~~~----~~~~~Gdivv~~~----------~~~~~vKrl~~~-~~~~~L~  172 (202)
T PRK12423        124 MIDDGILDGDLVGVHRS----PEARDGQIVVARL----------DGEVTIKRLERS-GDRIRLL  172 (202)
T ss_pred             CCCCCcCCCCEEEEeCC----CcCCCCCEEEEEE----------CCEEEEEEEEEe-CCEEEEE
Confidence            86 79999999999863    3678999999986          356899998755 3445443


No 21 
>PRK00215 LexA repressor; Validated
Probab=96.77  E-value=0.0069  Score=44.26  Aligned_cols=47  Identities=13%  Similarity=0.113  Sum_probs=36.0

Q ss_pred             Cc-cccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEE
Q 043519            1 ML-RAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEA   62 (130)
Q Consensus         1 M~-Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~   62 (130)
                      |. |++.+||+|+|++-    ..++.||+|++...          +..++||+.-. ++.+.+
T Consensus       128 M~~~~i~~Gd~v~v~~~----~~~~~G~ivv~~~~----------~~~~vKrl~~~-~~~~~L  175 (205)
T PRK00215        128 MIDAGILDGDLVIVRKQ----QTARNGQIVVALID----------DEATVKRFRRE-GGHIRL  175 (205)
T ss_pred             CCCCCcCCCCEEEEeCC----CCCCCCCEEEEEEC----------CEEEEEEEEEe-CCEEEE
Confidence            84 79999999999863    25789999999873          47899999865 334444


No 22 
>TIGR00498 lexA SOS regulatory protein LexA. LexA acts as a homodimer to repress a number of genes involved in the response to DNA damage (SOS response), including itself and RecA. RecA, in the presence of single-stranded DNA, acts as a co-protease to activate a latent autolytic protease activity (EC 3.4.21.88) of LexA, where the active site Ser is part of LexA. The autolytic cleavage site is an Ala-Gly bond in LexA (at position 84-85 in E. coli LexA; this sequence is replaced by Gly-Gly in Synechocystis). The cleavage leads to derepression of the SOS regulon and eventually to DNA repair. LexA in Bacillus subtilis is called DinR. LexA is much less broadly distributed than RecA.
Probab=96.67  E-value=0.01  Score=43.17  Aligned_cols=47  Identities=21%  Similarity=0.183  Sum_probs=36.3

Q ss_pred             Cc-cccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEE
Q 043519            1 ML-RAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEA   62 (130)
Q Consensus         1 M~-Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~   62 (130)
                      |. |++.+||+|++++.    ..++.||+|++..          .+...+||+.-. |+.+.+
T Consensus       121 M~~~~i~~Gd~v~v~~~----~~~~~G~ivvv~~----------~~~~~vKrl~~~-~~~i~L  168 (199)
T TIGR00498       121 MVDAGICDGDLLIVRSQ----KDARNGEIVAAMI----------DGEVTVKRFYKD-GTKVEL  168 (199)
T ss_pred             CCCCCCCCCCEEEEecC----CCCCCCCEEEEEE----------CCEEEEEEEEEE-CCEEEE
Confidence            75 68999999999864    3688999999987          357899998754 444444


No 23 
>COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion]
Probab=95.54  E-value=0.023  Score=39.62  Aligned_cols=29  Identities=28%  Similarity=0.415  Sum_probs=24.2

Q ss_pred             CceEEEEEEEeCCCEEEEeCCEEEECCEE
Q 043519           45 DGVYIKGIVAKEGDVVEACEGKLIVNGVV   73 (130)
Q Consensus        45 ~~~~vKRVig~pGD~v~~~~~~l~vng~~   73 (130)
                      ...++||++++|||.+...+..+++||++
T Consensus       137 ~~~~~~~~~~~~gd~~~~~~~~~~~~g~~  165 (166)
T COG0681         137 KKDYIKRVIGLPGDNILYTDDDLPINGKP  165 (166)
T ss_pred             ccccccceEEeeccceeeccCceeecCCC
Confidence            46799999999999999986448888764


No 24 
>COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms]
Probab=89.08  E-value=1.8  Score=31.97  Aligned_cols=46  Identities=11%  Similarity=0.119  Sum_probs=31.7

Q ss_pred             cccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEE
Q 043519            3 RAYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEA   62 (130)
Q Consensus         3 Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~   62 (130)
                      +.+.+||+|+|++-    .....||+|+....         ..+.-+||..-- |+.+.+
T Consensus       125 ~gi~dGDlvvV~~~----~~a~~GdiVvA~i~---------g~e~TvKrl~~~-g~~i~L  170 (201)
T COG1974         125 AGILDGDLVVVDPT----EDAENGDIVVALID---------GEEATVKRLYRD-GNQILL  170 (201)
T ss_pred             CcCCCCCEEEEcCC----CCCCCCCEEEEEcC---------CCcEEEEEEEEe-CCEEEE
Confidence            55678999999863    36788999998874         355788887643 444433


No 25 
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis]
Probab=86.29  E-value=1.5  Score=33.29  Aligned_cols=61  Identities=15%  Similarity=0.193  Sum_probs=38.4

Q ss_pred             CccccccCCEEEEEcccc-------------CCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEE-------
Q 043519            1 MLRAYVVTSLRRKGSVTY-------------YFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVV-------   60 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~-------------~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v-------   60 (130)
                      |.|.|+.||.|++.-...             .++.++.|-+|-..+..             +-|+++--|--+       
T Consensus       109 ~r~~l~vGD~v~AkV~~vd~~~~~~L~~k~~~~GkL~~G~iv~i~p~k-------------VpRvig~~~sm~~~l~~~~  175 (239)
T COG1097         109 LRPFLNVGDLVYAKVVDVDRDGEVELTLKDEGLGKLKNGQIVKIPPSK-------------VPRVIGKKGSMLNMLKEKT  175 (239)
T ss_pred             cccccccCCEEEEEEEEccCCCceEEEeecCCCccccCCEEEEEchhh-------------cceEecCCCcHHHHhhhhc
Confidence            789999999998763221             23567777777776532             333443333222       


Q ss_pred             -----EEeCCEEEECCEEc
Q 043519           61 -----EACEGKLIVNGVVR   74 (130)
Q Consensus        61 -----~~~~~~l~vng~~~   74 (130)
                           .=.||.+||+++..
T Consensus       176 ~~~I~VG~NG~IWV~~~~~  194 (239)
T COG1097         176 GCEIIVGQNGRIWVDGENE  194 (239)
T ss_pred             CeEEEEecCCEEEecCCCc
Confidence                 22589999999865


No 26 
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=82.98  E-value=1.4  Score=27.57  Aligned_cols=12  Identities=8%  Similarity=0.338  Sum_probs=6.5

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +..||+|++...
T Consensus        47 I~~GD~V~Ve~~   58 (75)
T COG0361          47 ILPGDVVLVELS   58 (75)
T ss_pred             eCCCCEEEEEec
Confidence            345666665553


No 27 
>TIGR00008 infA translation initiation factor IF-1. This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Probab=81.79  E-value=1.5  Score=26.90  Aligned_cols=12  Identities=8%  Similarity=0.058  Sum_probs=7.3

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +..||.|.+...
T Consensus        45 I~~GD~V~Ve~s   56 (68)
T TIGR00008        45 ILPGDKVKVELS   56 (68)
T ss_pred             ECCCCEEEEEEC
Confidence            456666666654


No 28 
>PF05257 CHAP:  CHAP domain;  InterPro: IPR007921 The CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain is a region between 110 and 140 amino acids that is found in proteins from bacteria, bacteriophages, archaea and eukaryotes of the Trypanosomidae family. Many of these proteins are uncharacterised, but it has been proposed that they may function mainly in peptidoglycan hydrolysis. The CHAP domain is found in a wide range of protein architectures; it is commonly associated with bacterial type SH3 domains and with several families of amidase domains. It has been suggested that CHAP domain containing proteins utilise a catalytic cysteine residue in a nucleophilic-attack mechanism [, ]. The CHAP domain contains two invariant residues, a cysteine and a histidine. These residues form part of the putative active site of CHAP domain containing proteins. Secondary structure predictions show that the CHAP domain belongs to the alpha + beta structural class, with the N-terminal half largely containing predicted alpha helices and the C-terminal half principally composed of predicted beta strands [, ]. Some proteins known to contain a CHAP domain are listed below:   Bacterial and trypanosomal glutathionylspermidine amidases.  A variety of bacterial autolysins.  A Nocardia aerocolonigenes putative esterase.  Streptococcus pneumoniae choline-binding protein D.  Methanosarcina mazei protein MM2478, a putative chloride channel.  Several phage-encoded peptidoglycan hydrolases.  Cysteine peptidases belonging to MEROPS peptidase family C51 (D-alanyl-glycyl endopeptidase, clan CA).  ; PDB: 2LRJ_A 2VPM_B 2VOB_B 2VPS_A 2K3A_A 2IO9_A 2IO8_A 2IOB_A 2IOA_B 2IO7_B ....
Probab=80.67  E-value=5.6  Score=26.40  Aligned_cols=38  Identities=16%  Similarity=0.198  Sum_probs=23.6

Q ss_pred             CCCCCCCcEEEEecCCcccccccCCCceEEEEEEEe-CCCEEEEeC
Q 043519           20 FREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK-EGDVVEACE   64 (130)
Q Consensus        20 ~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~-pGD~v~~~~   64 (130)
                      ...|+.||||+|....       ...--.+--|.++ .+++|.+.+
T Consensus        60 ~~~P~~Gdivv~~~~~-------~~~~GHVaIV~~v~~~~~i~v~e   98 (124)
T PF05257_consen   60 GSTPQPGDIVVWDSGS-------GGGYGHVAIVESVNDGGTITVIE   98 (124)
T ss_dssp             CS---TTEEEEEEECT-------TTTT-EEEEEEEE-TTSEEEEEE
T ss_pred             CcccccceEEEeccCC-------CCCCCeEEEEEEECCCCEEEEEE
Confidence            3579999999996221       1333466678888 888988754


No 29 
>PF06890 Phage_Mu_Gp45:  Bacteriophage Mu Gp45 protein;  InterPro: IPR014462 This entry is represented by the Bacteriophage Mu, Gp45. The characteristics of the protein distribution suggest prophage matches.
Probab=78.01  E-value=16  Score=26.13  Aligned_cols=39  Identities=10%  Similarity=0.183  Sum_probs=28.6

Q ss_pred             cccCCCCCCCCcEEEEecCCcccccccCCCceEEEE---EEEeCCCEEEEe
Q 043519           16 VTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKG---IVAKEGDVVEAC   63 (130)
Q Consensus        16 ~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKR---Vig~pGD~v~~~   63 (130)
                      -.|+.+.++.|++++|..-         ....++||   +|.+.++++++.
T Consensus        68 ~~yR~~~L~~GEvalY~~~---------G~~I~L~~~G~ii~~~~~~~~v~  109 (162)
T PF06890_consen   68 RRYRPKGLKPGEVALYDDE---------GQKIHLKRDGRIIEVTCKTVTVN  109 (162)
T ss_pred             ccccccCCCCCcEEEEcCC---------CCEEEEEecceEEeccCceEEEe
Confidence            3466677899999999863         34566665   777788888775


No 30 
>PF11101 DUF2884:  Protein of unknown function (DUF2884);  InterPro: IPR021307  Some members in this bacterial family of proteins are annotated as YggN which currently has no known function. 
Probab=73.37  E-value=5.2  Score=30.01  Aligned_cols=25  Identities=24%  Similarity=0.472  Sum_probs=20.8

Q ss_pred             EEEEeCCCEEEE-eCCEEEECCEEcc
Q 043519           51 GIVAKEGDVVEA-CEGKLIVNGVVRN   75 (130)
Q Consensus        51 RVig~pGD~v~~-~~~~l~vng~~~~   75 (130)
                      +|++..|+.+.| .+|.|||||+.+.
T Consensus        17 ~v~~~~~~~~~I~~~g~L~i~G~~v~   42 (229)
T PF11101_consen   17 EVVQASGEKLRIDPDGNLFINGKKVS   42 (229)
T ss_pred             EEEeCCCceEEEcCCCcEEECCEEcc
Confidence            367788889999 6799999999864


No 31 
>cd05793 S1_IF1A S1_IF1A: Translation initiation factor IF1A, also referred to as eIF1A in eukaryotes and aIF1A in archaea, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=71.18  E-value=3.7  Score=25.65  Aligned_cols=12  Identities=17%  Similarity=0.088  Sum_probs=8.3

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +.+||+|++...
T Consensus        39 I~~GD~V~Ve~~   50 (77)
T cd05793          39 INEGDIVLVAPW   50 (77)
T ss_pred             EcCCCEEEEEec
Confidence            577777777654


No 32 
>PRK12442 translation initiation factor IF-1; Reviewed
Probab=70.20  E-value=5  Score=25.76  Aligned_cols=12  Identities=17%  Similarity=0.202  Sum_probs=5.9

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +..||.|.+...
T Consensus        47 Il~GD~V~VE~s   58 (87)
T PRK12442         47 ILAGDRVTLELS   58 (87)
T ss_pred             ecCCCEEEEEEC
Confidence            344555555543


No 33 
>smart00652 eIF1a eukaryotic translation initiation factor 1A.
Probab=70.05  E-value=4  Score=25.85  Aligned_cols=12  Identities=17%  Similarity=0.094  Sum_probs=8.5

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +++||+|++...
T Consensus        44 I~~GD~VlVe~~   55 (83)
T smart00652       44 IRRGDIVLVDPW   55 (83)
T ss_pred             EcCCCEEEEEec
Confidence            577888777653


No 34 
>PF10000 ACT_3:  ACT domain;  InterPro: IPR018717 This domain has no known function.; PDB: 1ZVP_C.
Probab=69.82  E-value=2.5  Score=26.12  Aligned_cols=15  Identities=7%  Similarity=-0.301  Sum_probs=10.9

Q ss_pred             CccccccCCEEEEEc
Q 043519            1 MLRAYVVTSLRRKGS   15 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k   15 (130)
                      |.|.|++|++|++.-
T Consensus        14 m~P~L~~~~yVF~t~   28 (72)
T PF10000_consen   14 MSPELNPGEYVFCTV   28 (72)
T ss_dssp             -EEEE-SS-EEEEEE
T ss_pred             CCcEeCCCCEEEEEe
Confidence            899999999999974


No 35 
>PF01176 eIF-1a:  Translation initiation factor 1A / IF-1;  InterPro: IPR006196  The S1 domain of around 70 amino acids, originally identified in ribosomal protein S1, is found in a large number of RNA-associated proteins. It has been shown that S1 proteins bind RNA through their S1 domains with some degree of sequence specificity. This type of S1 domain is found in translation initiation factor 1.  The solution structure of one S1 RNA-binding domain from Escherichia coli polynucleotide phosphorylase has been determined []. It displays some similarity with the cold shock domain (CSD) (IPR002059 from INTERPRO). Both the S1 and the CSD domain consist of an antiparallel beta barrel of the same topology with 5 beta strands. This fold is also shared by many other proteins of unrelated function and is known as the OB fold. However, the S1 and CSD fold can be distinguished from the other OB folds by the presence of a short 3(10) helix at the end of strand 3. This unique feature is likely to form a part of the DNA/RNA-binding site.  This entry is specific for bacterial, chloroplastic and eukaryotic IF-1 type S1 domains.; GO: 0003723 RNA binding, 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1JT8_A 3I4O_A 1AH9_A 1ZO1_W 1D7Q_A 2OQK_A 2DGY_A 1HR0_W.
Probab=68.75  E-value=3.4  Score=24.76  Aligned_cols=14  Identities=14%  Similarity=0.231  Sum_probs=8.7

Q ss_pred             CCCCCcEEEEecCC
Q 043519           22 EPFANDILIFKSPP   35 (130)
Q Consensus        22 ~~~rGDiVvf~~p~   35 (130)
                      .+++||+|++...+
T Consensus        41 wI~~GD~V~V~~~~   54 (65)
T PF01176_consen   41 WIKRGDFVLVEPSP   54 (65)
T ss_dssp             ---TTEEEEEEEST
T ss_pred             ecCCCCEEEEEecc
Confidence            47889999888643


No 36 
>cd04456 S1_IF1A_like S1_IF1A_like: Translation initiation factor IF1A-like, S1-like RNA-binding domain. IF1A is also referred to as eIF1A in eukaryotes and aIF1A in archaea. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=67.53  E-value=5.3  Score=24.99  Aligned_cols=12  Identities=25%  Similarity=0.169  Sum_probs=8.4

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +++||+|++...
T Consensus        39 I~~GD~VlV~~~   50 (78)
T cd04456          39 IKRGDFLIVDPI   50 (78)
T ss_pred             EcCCCEEEEEec
Confidence            577777777654


No 37 
>PRK04012 translation initiation factor IF-1A; Provisional
Probab=67.43  E-value=4.8  Score=26.46  Aligned_cols=12  Identities=17%  Similarity=0.094  Sum_probs=8.1

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +.+||+|++...
T Consensus        60 I~~GD~VlVe~~   71 (100)
T PRK04012         60 IREGDVVIVAPW   71 (100)
T ss_pred             ecCCCEEEEEec
Confidence            567777777653


No 38 
>TIGR02594 conserved hypothetical protein TIGR02594. Members of this protein family known so far are restricted to the bacteria, and for the most to the proteobacteria. The function is unknown.
Probab=66.20  E-value=25  Score=23.94  Aligned_cols=14  Identities=14%  Similarity=0.116  Sum_probs=11.6

Q ss_pred             CCCCCCcEEEEecC
Q 043519           21 REPFANDILIFKSP   34 (130)
Q Consensus        21 ~~~~rGDiVvf~~p   34 (130)
                      .+|+.||+|+|+..
T Consensus        72 ~~p~~GDiv~f~~~   85 (129)
T TIGR02594        72 SKPAYGCIAVKRRG   85 (129)
T ss_pred             CCCCccEEEEEECC
Confidence            46899999999753


No 39 
>PF14085 DUF4265:  Domain of unknown function (DUF4265)
Probab=65.38  E-value=36  Score=22.71  Aligned_cols=46  Identities=9%  Similarity=0.255  Sum_probs=29.1

Q ss_pred             CCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCC-EEEE
Q 043519            8 TSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGD-VVEA   62 (130)
Q Consensus         8 gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD-~v~~   62 (130)
                      .|...+.........+..||+|.+....         +.+.+.+++--.|. |+++
T Consensus        11 ~~~y~l~n~Pf~a~glA~gDvV~~~~~~---------g~~~~~~~v~~sGnsTiRv   57 (117)
T PF14085_consen   11 DDTYRLDNIPFFAYGLALGDVVRAEPDD---------GELWFQKVVESSGNSTIRV   57 (117)
T ss_pred             CCEEEEEecccccCCCCCCCEEEEEeCC---------CeEEEEEEEecCCCEEEEE
Confidence            3444454455555689999999999853         55555555554554 5554


No 40 
>PF04319 NifZ:  NifZ domain;  InterPro: IPR007415 NifZ is a short protein is found in the nif (nitrogen fixation) operon. It is required for the maturation of the nitrogenase MoFe protein. In the absence of NifZ, only one of the two P-clusters of the MoFe protein is matured to the ultimate [8Fe-7S] structure. The other P-cluster site in the protein contains a [4Fe-4S] cluster pair, suggesting that NifZ is specifically required for the formation of the second P-cluster [, , ].; GO: 0009399 nitrogen fixation
Probab=65.32  E-value=13  Score=23.24  Aligned_cols=30  Identities=10%  Similarity=-0.051  Sum_probs=21.3

Q ss_pred             CccccccCCEEEEEccccCCCC---CCCCcEEE
Q 043519            1 MLRAYVVTSLRRKGSVTYYFRE---PFANDILI   30 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k~~~~~~~---~~rGDiVv   30 (130)
                      |+|.++.||.|.+.+..+...+   ...|++++
T Consensus         1 ~~p~f~~G~~V~a~~~irNDGt~Pg~~~g~lLv   33 (75)
T PF04319_consen    1 MPPRFEWGDKVRARKDIRNDGTFPGKEIGELLV   33 (75)
T ss_pred             CCCccCCCCEEEEEEEeEcCCCCCCCCCCCEEE
Confidence            8999999999999876544332   34555555


No 41 
>smart00002 PLP Myelin proteolipid protein (PLP or lipophilin).
Probab=63.72  E-value=2  Score=25.65  Aligned_cols=20  Identities=10%  Similarity=-0.152  Sum_probs=17.2

Q ss_pred             CCCCCCccccccCCCeeeEE
Q 043519           97 NSYDLLVCLDELADHIPSSL  116 (130)
Q Consensus        97 ~S~DSR~~G~V~~~~I~Gkv  116 (130)
                      -+.|-|.||.+|-.+.-||+
T Consensus        22 lC~D~RQyGilpwna~pgK~   41 (60)
T smart00002       22 LCVDARQYGILPWNAFPGKV   41 (60)
T ss_pred             EEeechhcceeecCCCCCch
Confidence            47899999999988888876


No 42 
>COG4079 Uncharacterized protein conserved in archaea [Function unknown]
Probab=63.62  E-value=19  Score=27.71  Aligned_cols=31  Identities=16%  Similarity=0.235  Sum_probs=24.9

Q ss_pred             CCceEEEEEEE----eCCCEEEEeCCEEEECCEEc
Q 043519           44 DDGVYIKGIVA----KEGDVVEACEGKLIVNGVVR   74 (130)
Q Consensus        44 ~~~~~vKRVig----~pGD~v~~~~~~l~vng~~~   74 (130)
                      ++...+++|-+    .|||.|.++||.+.|+|+.+
T Consensus       248 Pg~~v~m~v~~~g~~~pGd~vvv~dg~mki~G~d~  282 (293)
T COG4079         248 PGEEVVMAVEGNGEVEPGDRVVVKDGVMKIDGKDL  282 (293)
T ss_pred             CCceEEEEEccCCccCCCCEEEEecCceEeccccc
Confidence            45666777665    48999999999999999864


No 43 
>COG3602 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.29  E-value=5  Score=27.26  Aligned_cols=15  Identities=7%  Similarity=-0.212  Sum_probs=13.6

Q ss_pred             CccccccCCEEEEEc
Q 043519            1 MLRAYVVTSLRRKGS   15 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k   15 (130)
                      |.|.|.+||+|++.-
T Consensus        14 mtPeL~~G~yVfcT~   28 (134)
T COG3602          14 MTPELLDGDYVFCTV   28 (134)
T ss_pred             cCccccCCceEEEEe
Confidence            899999999999864


No 44 
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu. Escherichia coli ATPS consists of CysN and a smaller subunit CysD and CysN. ATPS produces adenosine-5'-phosphosulfate (APS) from ATP and sulfate, coupled with GTP hydrolysis. In the subsequent reaction APS is phosphorylated by an APS kinase (CysC), to produce 3'-phosphoadenosine-5'-phosphosulfate (PAPS) for use in amino acid (aa) biosynthesis. The Rhizobiaceae group (alpha-proteobacteria) appears to carry out the same chemistry for the sufation of a nodulation factor. In Rhizobium meliloti, a the hererodimeric complex comprised of NodP and NodQ appears to possess both ATPS and APS kinase activities. The N and C termini of NodQ correspond to CysN and CysC, respectively.   Other eubacteria, Archaea, and eukaryotes use a different ATP sulfurylase, which sho
Probab=62.31  E-value=24  Score=21.73  Aligned_cols=33  Identities=18%  Similarity=0.155  Sum_probs=24.0

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEE--------EeCCCEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIV--------AKEGDVVEA   62 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi--------g~pGD~v~~   62 (130)
                      ..++.||-|.+.+..         ...-||.+-        |.|||.|.+
T Consensus        25 G~v~~Gd~v~~~P~~---------~~~~V~si~~~~~~~~~a~aGd~v~l   65 (81)
T cd03695          25 GSIRVGDEVVVLPSG---------KTSRVKSIETFDGELDEAGAGESVTL   65 (81)
T ss_pred             ceEECCCEEEEcCCC---------CeEEEEEEEECCcEeCEEcCCCEEEE
Confidence            468899999988643         345566665        888988877


No 45 
>PRK09919 anti-adapter protein IraM; Provisional
Probab=59.42  E-value=11  Score=25.43  Aligned_cols=22  Identities=9%  Similarity=0.241  Sum_probs=19.4

Q ss_pred             EeCCCEEEEeCCEEEECCEEcc
Q 043519           54 AKEGDVVEACEGKLIVNGVVRN   75 (130)
Q Consensus        54 g~pGD~v~~~~~~l~vng~~~~   75 (130)
                      =.|||.+...+..+.||+++..
T Consensus        39 L~pG~~i~~~~~gvliNdk~~p   60 (114)
T PRK09919         39 LPPGSIITPVKSGVLLNDKPYP   60 (114)
T ss_pred             eCCCCEEEEcCCeEEECCcEeE
Confidence            4699999999999999999754


No 46 
>PF02836 Glyco_hydro_2_C:  Glycosyl hydrolases family 2, TIM barrel domain;  InterPro: IPR006103 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 2 GH2 from CAZY comprises enzymes with several known activities; beta-galactosidase (3.2.1.23 from EC); beta-mannosidase (3.2.1.25 from EC); beta-glucuronidase (3.2.1.31 from EC). These enzymes contain a conserved glutamic acid residue which has been shown [], in Escherichia coli lacZ (P00722 from SWISSPROT), to be the general acid/base catalyst in the active site of the enzyme. Beta-galactosidase from E. coli has a TIM-barrel-like core surrounded by four other largely beta domains [].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3CMG_A 3FN9_C 1YQ2_A 3K4D_B 3LPG_B 3LPF_A 3K4A_B 3K46_B 3GM8_A 3DEC_A ....
Probab=53.63  E-value=14  Score=28.36  Aligned_cols=15  Identities=33%  Similarity=0.448  Sum_probs=13.5

Q ss_pred             EEEeCCEEEECCEEc
Q 043519           60 VEACEGKLIVNGVVR   74 (130)
Q Consensus        60 v~~~~~~l~vng~~~   74 (130)
                      |+++++.+++||+++
T Consensus         1 vev~~~~~~lNGk~~   15 (298)
T PF02836_consen    1 VEVKDGGFYLNGKPI   15 (298)
T ss_dssp             EEEETTEEEETTEEE
T ss_pred             CEEECCEEEECCEEE
Confidence            689999999999975


No 47 
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  
Probab=53.41  E-value=39  Score=20.72  Aligned_cols=33  Identities=24%  Similarity=0.280  Sum_probs=22.8

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEE--------EeCCCEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIV--------AKEGDVVEA   62 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi--------g~pGD~v~~   62 (130)
                      +.++.||-|.+.+..         ...-||.+-        |.+||.|.+
T Consensus        25 G~i~~Gd~v~i~P~~---------~~~~V~si~~~~~~~~~a~aGd~v~~   65 (83)
T cd03698          25 GSIQKGDTLLVMPSK---------ESVEVKSIYVDDEEVDYAVAGENVRL   65 (83)
T ss_pred             eEEeCCCEEEEeCCC---------cEEEEEEEEECCeECCEECCCCEEEE
Confidence            467888888887642         345566655        788888876


No 48 
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-li
Probab=52.68  E-value=40  Score=20.62  Aligned_cols=33  Identities=21%  Similarity=0.187  Sum_probs=22.9

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEE--------EeCCCEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIV--------AKEGDVVEA   62 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi--------g~pGD~v~~   62 (130)
                      ..++.||-|.+.+..         ...-||.+-        |.+||.+.+
T Consensus        24 G~i~~G~~v~i~P~~---------~~~~V~si~~~~~~~~~a~aGd~v~l   64 (82)
T cd04089          24 GTIKKGDKLLVMPNK---------TQVEVLSIYNEDVEVRYARPGENVRL   64 (82)
T ss_pred             eEEecCCEEEEeCCC---------cEEEEEEEEECCEECCEECCCCEEEE
Confidence            467889988887642         345566665        777887776


No 49 
>TIGR00523 eIF-1A eukaryotic/archaeal initiation factor 1A. Recommended nomenclature: eIF-1A for eukaryotes, aIF-1A for Archaea. Also called eIF-4C
Probab=51.45  E-value=17  Score=23.82  Aligned_cols=10  Identities=30%  Similarity=0.385  Sum_probs=7.4

Q ss_pred             CCCCcEEEEe
Q 043519           23 PFANDILIFK   32 (130)
Q Consensus        23 ~~rGDiVvf~   32 (130)
                      +.+||+|++.
T Consensus        58 I~~GD~VlVs   67 (99)
T TIGR00523        58 IREGDVVIVK   67 (99)
T ss_pred             ecCCCEEEEE
Confidence            6778888873


No 50 
>COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=51.32  E-value=20  Score=23.21  Aligned_cols=31  Identities=13%  Similarity=0.098  Sum_probs=22.2

Q ss_pred             ccccCCEEEEEccccCC-----CCCCCCcEEEEecC
Q 043519            4 AYVVTSLRRKGSVTYYF-----REPFANDILIFKSP   34 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~-----~~~~rGDiVvf~~p   34 (130)
                      +|.+|=.++++...+..     ..++.||+|+|-+.
T Consensus        57 ~lrpGiI~LINd~DWeLleke~y~ledgDiIvfist   92 (96)
T COG5131          57 ELRPGIICLINDMDWELLEKERYPLEDGDIIVFIST   92 (96)
T ss_pred             CCcccEEEEEcCccHhhhhcccccCCCCCEEEEEec
Confidence            57788888888755432     34688999999764


No 51 
>PRK10626 hypothetical protein; Provisional
Probab=51.32  E-value=20  Score=27.30  Aligned_cols=24  Identities=21%  Similarity=0.447  Sum_probs=18.1

Q ss_pred             EEEEeCCCEEEEe-CCEEEECCEEcc
Q 043519           51 GIVAKEGDVVEAC-EGKLIVNGVVRN   75 (130)
Q Consensus        51 RVig~pGD~v~~~-~~~l~vng~~~~   75 (130)
                      .|++..|+ +.|. +|.|||||+.+.
T Consensus        40 ~V~~~sg~-l~I~~dg~L~inGk~v~   64 (239)
T PRK10626         40 QVVGASGN-LVISPDGNVMRNGKQLS   64 (239)
T ss_pred             EEEecCCc-eEEcCCCCEEECCEEec
Confidence            36777887 6665 579999999864


No 52 
>PF01479 S4:  S4 domain;  InterPro: IPR002942 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4, eukaryotic ribosomal S9, two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number of uncharacterised, small proteins that may be involved in translation regulation []. The S4 domain probably mediates binding to RNA.; GO: 0003723 RNA binding; PDB: 3BBU_A 1DM9_B 2K6P_A 3U5G_E 3U5C_E 3IZB_D 2XZM_D 2XZN_D 3O30_E 3O2Z_E ....
Probab=49.13  E-value=6.7  Score=21.49  Aligned_cols=15  Identities=33%  Similarity=0.488  Sum_probs=12.3

Q ss_pred             EeCCEEEECCEEccc
Q 043519           62 ACEGKLIVNGVVRNK   76 (130)
Q Consensus        62 ~~~~~l~vng~~~~~   76 (130)
                      +++|.++|||+.+..
T Consensus        23 I~~g~V~VNg~~v~~   37 (48)
T PF01479_consen   23 IKQGRVKVNGKVVKD   37 (48)
T ss_dssp             HHTTTEEETTEEESS
T ss_pred             cCCCEEEECCEEEcC
Confidence            357899999999863


No 53 
>KOG4146 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=48.72  E-value=24  Score=23.01  Aligned_cols=31  Identities=10%  Similarity=0.034  Sum_probs=21.3

Q ss_pred             ccccCCEEEEEccccCC-----CCCCCCcEEEEecC
Q 043519            4 AYVVTSLRRKGSVTYYF-----REPFANDILIFKSP   34 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~-----~~~~rGDiVvf~~p   34 (130)
                      ++.+|=.++++...+..     ..++.||.|+|-+.
T Consensus        62 svrpGii~lINd~DWEllekedy~ledgD~ivfiST   97 (101)
T KOG4146|consen   62 SVRPGIIVLINDMDWELLEKEDYPLEDGDHIVFIST   97 (101)
T ss_pred             cCcCcEEEEEeccchhhhcccccCcccCCEEEEEEe
Confidence            56677788887655321     35788999988764


No 54 
>PF09285 Elong-fact-P_C:  Elongation factor P, C-terminal;  InterPro: IPR015365 These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology []. ; GO: 0043043 peptide biosynthetic process, 0005737 cytoplasm; PDB: 1YBY_A 3OYY_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H.
Probab=47.18  E-value=58  Score=19.06  Aligned_cols=25  Identities=4%  Similarity=-0.156  Sum_probs=14.3

Q ss_pred             ccccCCEEEEEccccCCCCCCCCcEEEEecC
Q 043519            4 AYVVTSLRRKGSVTYYFREPFANDILIFKSP   34 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p   34 (130)
                      +|..|-.|.|..+      ++.||.|.++..
T Consensus        25 ~letG~~i~VP~F------I~~Gd~I~VdT~   49 (56)
T PF09285_consen   25 TLETGAEIQVPLF------IEEGDKIKVDTR   49 (56)
T ss_dssp             EETTS-EEEEETT--------TT-EEEEETT
T ss_pred             EEcCCCEEEccce------ecCCCEEEEECC
Confidence            3556666666543      678999999874


No 55 
>PTZ00329 eukaryotic translation initiation factor 1A; Provisional
Probab=46.26  E-value=17  Score=25.82  Aligned_cols=11  Identities=18%  Similarity=0.193  Sum_probs=5.2

Q ss_pred             CCCCcEEEEec
Q 043519           23 PFANDILIFKS   33 (130)
Q Consensus        23 ~~rGDiVvf~~   33 (130)
                      +.+||+|++..
T Consensus        71 I~~GD~VlVel   81 (155)
T PTZ00329         71 INIGDIILVSL   81 (155)
T ss_pred             ecCCCEEEEec
Confidence            34455555443


No 56 
>PLN00208 translation initiation factor (eIF); Provisional
Probab=45.93  E-value=18  Score=25.50  Aligned_cols=11  Identities=27%  Similarity=0.277  Sum_probs=5.5

Q ss_pred             CCCCcEEEEec
Q 043519           23 PFANDILIFKS   33 (130)
Q Consensus        23 ~~rGDiVvf~~   33 (130)
                      +.+||+|++..
T Consensus        71 I~~GD~VlVel   81 (145)
T PLN00208         71 IAAGDIILVGL   81 (145)
T ss_pred             ecCCCEEEEEc
Confidence            44555555543


No 57 
>cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes. These enzymes are involved in the enzymatic hydrolysis of alpha-1,4 linkages of starch polymers and belong to the glycosyl hydrolase family 13. Most consist of three domains (A,B,C) but CGTase is more complex and has two additional domains (D,E). The function of the IPT/D domain is unknown.
Probab=45.71  E-value=31  Score=21.49  Aligned_cols=23  Identities=22%  Similarity=0.478  Sum_probs=18.2

Q ss_pred             EEEeCCCEEEEe-------CCEEEECCEEc
Q 043519           52 IVAKEGDVVEAC-------EGKLIVNGVVR   74 (130)
Q Consensus        52 Vig~pGD~v~~~-------~~~l~vng~~~   74 (130)
                      -.|.||++|.|.       .+.+++++...
T Consensus         9 ~~g~pG~~VtI~G~gFg~~~~~V~~g~~~a   38 (81)
T cd00604           9 VMGKPGNTVTISGEGFGSTGGTVYFGGTAA   38 (81)
T ss_pred             CCCCCCCEEEEEEECCCCCccEEEECCEEE
Confidence            457899999996       57899988764


No 58 
>cd05792 S1_eIF1AD_like S1_eIF1AD_like: eukaryotic translation initiation factor 1A domain containing protein (eIF1AD)-like, S1-like RNA-binding domain. eIF1AD is also known as MGC11102 protein. Little is known about the function of eIF1AD. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins, including translation initiation factor IF1A (also referred to as eIF1A in eukaryotes). eIF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors.
Probab=44.94  E-value=18  Score=22.68  Aligned_cols=27  Identities=15%  Similarity=0.031  Sum_probs=16.8

Q ss_pred             cCCEEEEEccccCCCC---CCCCcEEEEecC
Q 043519            7 VTSLRRKGSVTYYFRE---PFANDILIFKSP   34 (130)
Q Consensus         7 ~gd~vlv~k~~~~~~~---~~rGDiVvf~~p   34 (130)
                      +|...++.- .-+|+.   +++||+|++.+-
T Consensus        21 dG~~~l~~i-P~KfRk~iWIkrGd~VlV~p~   50 (78)
T cd05792          21 NGSRYLVSM-PTKFRKNIWIKRGDFVLVEPI   50 (78)
T ss_pred             CCCEEEEEe-chhhcccEEEEeCCEEEEEec
Confidence            566666652 223333   689999999764


No 59 
>PF15057 DUF4537:  Domain of unknown function (DUF4537)
Probab=44.46  E-value=16  Score=24.75  Aligned_cols=12  Identities=8%  Similarity=-0.161  Sum_probs=6.0

Q ss_pred             ccccccCCEEEE
Q 043519            2 LRAYVVTSLRRK   13 (130)
Q Consensus         2 ~Ptl~~gd~vlv   13 (130)
                      .+.|+.||.||+
T Consensus        53 ~~~L~~GD~VLA   64 (124)
T PF15057_consen   53 RHSLQVGDKVLA   64 (124)
T ss_pred             cCcCCCCCEEEE
Confidence            444555555554


No 60 
>PF11012 DUF2850:  Protein of unknown function (DUF2850);  InterPro: IPR021271  This family of proteins with unknown function appear to be restricted to Vibrionaceae. 
Probab=44.38  E-value=23  Score=22.32  Aligned_cols=25  Identities=16%  Similarity=0.262  Sum_probs=19.2

Q ss_pred             CCEEEEeCCEEEECCEEcccccccc
Q 043519           57 GDVVEACEGKLIVNGVVRNKDFILE   81 (130)
Q Consensus        57 GD~v~~~~~~l~vng~~~~~~~~~~   81 (130)
                      =|++++....+++||+.++..|..+
T Consensus        16 ~e~~~l~~~GV~~ngrlV~T~F~fD   40 (79)
T PF11012_consen   16 AEEFTLNESGVFRNGRLVATSFEFD   40 (79)
T ss_pred             ccEEEECCCcEEECCCEEeeEEEEC
Confidence            4677788888899998888776554


No 61 
>COG4013 Uncharacterized protein conserved in archaea [Function unknown]
Probab=44.01  E-value=28  Score=22.28  Aligned_cols=12  Identities=33%  Similarity=0.393  Sum_probs=6.3

Q ss_pred             eCCCEEEEeCCE
Q 043519           55 KEGDVVEACEGK   66 (130)
Q Consensus        55 ~pGD~v~~~~~~   66 (130)
                      +||..|..++|.
T Consensus        36 IpG~vv~~n~g~   47 (91)
T COG4013          36 IPGRVVHYNDGL   47 (91)
T ss_pred             eccEEEEeeccE
Confidence            455555555554


No 62 
>PF06394 Pepsin-I3:  Pepsin inhibitor-3-like repeated domain;  InterPro: IPR010480 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The members of this group of proteins belong to MEROPS inhibitor family I33, clan IR; the nematode aspartyl protease inhibitors or Aspins. They are restricted to parasitic nematode species. Structural features common to the nematode Aspins include the presence of a signal peptide sequence and the conservation of all four cysteine residues in the mature protein. The Y[V.A]RDLT sequence motif has been suggested as being of crucial functional importance in several filarial nematode inhibitors [], this sequence is not conserved in Tco-API-1 from Trichostrongylus colubriformis (Black scour worm) and it has been demonstrated that Tco-API-1, is not an Aspin as it does not inhibit porcine pepsin []. Related inhibitors from Onchocerca volvulus, Ov33 [] and Ascaris suum (Pig roundworm), PI-3 [] inhibit the in vitro activity of aspartyl proteases such as pepsin and cathepsin E (MEROPS peptidase family A1).  Aspin may facilitate the safe passage of the eggs of Ascaris through the host stomach without digestion by pepsin [, ]. The other parasitic nematodes known to express homologous proteins do not pass through the stomach of their hosts []. Several proteins in the family are potent allergens in mammals. The three-dimensional structures of pepsin inhibitor-3 (PI-3) from A. suum and of the complex between PI-3 and porcine pepsin at 1. 75 A and 2.45 A resolution, respectively, have revealed the mechanism of aspartic protease inhibition. PI-3 has a new fold consisting of two identical domains, each comprising an antiparallel beta-sheet flanked by an alpha-helix. In the enzyme-inhibitor complex, the N-terminal beta-strand of PI-3 pairs with one strand of the 'active site flap' (residues 70-82) of pepsin, thus forming an eight-stranded beta-sheet that spans the two proteins. PI-3 has a novel mode of inhibition, using its N-terminal residues to occupy and therefore block the first three binding pockets in pepsin for substrate residues C-terminal to the scissile bond (S1'-S3') [].; PDB: 1F32_A 1F34_B.
Probab=43.12  E-value=20  Score=22.38  Aligned_cols=15  Identities=33%  Similarity=0.319  Sum_probs=12.0

Q ss_pred             EEeCCEEEECCEEcc
Q 043519           61 EACEGKLIVNGVVRN   75 (130)
Q Consensus        61 ~~~~~~l~vng~~~~   75 (130)
                      .+.+++|||||..+.
T Consensus        24 ~V~~nklyvng~~~R   38 (76)
T PF06394_consen   24 VVQNNKLYVNGKYAR   38 (76)
T ss_dssp             EEETTEEEETTCEEE
T ss_pred             EEECCEEEECCEeec
Confidence            457899999998753


No 63 
>PF13144 SAF_2:  SAF-like
Probab=41.81  E-value=1.1e+02  Score=21.78  Aligned_cols=52  Identities=8%  Similarity=-0.116  Sum_probs=27.1

Q ss_pred             ccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEE----EeCCCEEEEeC
Q 043519            4 AYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIV----AKEGDVVEACE   64 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi----g~pGD~v~~~~   64 (130)
                      +|..|+.+.-+.+. ...-+++||.|....-.        .+-.+--...    |--||+|.++|
T Consensus       122 ~i~~G~~i~~~~l~-~~~~V~~G~~V~v~~~~--------g~i~i~~~g~Al~~G~~G~~I~V~N  177 (196)
T PF13144_consen  122 NIRAGQPITPSDLE-PPPLVKRGDIVTVIARS--------GGISISTEGKALEDGALGDTIRVKN  177 (196)
T ss_pred             EcCCCCEeeecccc-cceecCCCCEEEEEEEe--------CCEEEEEEEEEccCCCCCCEEEEEE
Confidence            34556666555442 12346778877776532        2222222222    34577777765


No 64 
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins. BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=40.39  E-value=46  Score=22.22  Aligned_cols=39  Identities=28%  Similarity=0.316  Sum_probs=26.2

Q ss_pred             CCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEECCE
Q 043519           23 PFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVNGV   72 (130)
Q Consensus        23 ~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vng~   72 (130)
                      ++.||.|.++++.       .....+|-||.-+=    +-.+|..++++.
T Consensus         4 ~~vGD~V~v~~~~-------~~~~pyIgrI~~i~----e~~~g~~~~~v~   42 (121)
T cd04714           4 IRVGDCVLFKSPG-------RPSLPYVARIESLW----EDPEGNMVVRVK   42 (121)
T ss_pred             EEcCCEEEEeCCC-------CCCCCEEEEEEEEE----EcCCCCEEEEEE
Confidence            4679999999875       23668899996651    113355666655


No 65 
>PF01426 BAH:  BAH domain;  InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation. The BAH domain appears to act as a protein-protein interaction module specialised in gene silencing, as suggested for example by its interaction within yeast Orc1p with the silent information regulator Sir1p. The BAH module might therefore play an important role by linking DNA methylation, replication and transcriptional regulation [].; GO: 0003677 DNA binding; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 3SWR_A 3PTA_A 1M4Z_A 1ZBX_A ....
Probab=38.31  E-value=44  Score=21.47  Aligned_cols=26  Identities=15%  Similarity=0.148  Sum_probs=19.3

Q ss_pred             CCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519           23 PFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus        23 ~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      ++.||.|.+.++.       .....+|.||..+
T Consensus         3 ~~vGD~V~v~~~~-------~~~~~~v~~I~~i   28 (119)
T PF01426_consen    3 YKVGDFVYVKPDD-------PPEPPYVARIEEI   28 (119)
T ss_dssp             EETTSEEEEECTS-------TTSEEEEEEEEEE
T ss_pred             EeCCCEEEEeCCC-------CCCCCEEEEEEEE
Confidence            3568888888765       3567888888877


No 66 
>COG0179 MhpD 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=38.12  E-value=43  Score=25.83  Aligned_cols=16  Identities=19%  Similarity=0.403  Sum_probs=10.5

Q ss_pred             CCCCCCCcEEEEecCC
Q 043519           20 FREPFANDILIFKSPP   35 (130)
Q Consensus        20 ~~~~~rGDiVvf~~p~   35 (130)
                      +.+++.||||.==.|.
T Consensus       222 ~~tL~pGDvI~TGTP~  237 (266)
T COG0179         222 FMTLEPGDVILTGTPS  237 (266)
T ss_pred             CcccCCCCEEEeCCCC
Confidence            3467777777766654


No 67 
>TIGR03170 flgA_cterm flagella basal body P-ring formation protein FlgA. This model describes a conserved C-terminal region of the flagellar basal body P-ring formation protein FlgA. This sequence region contains a SAF domain, now described by Pfam model pfam08666.
Probab=37.58  E-value=90  Score=20.44  Aligned_cols=12  Identities=8%  Similarity=-0.047  Sum_probs=7.2

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      +++||.|.....
T Consensus        66 V~~G~~V~i~~~   77 (122)
T TIGR03170        66 VKRGDTVTVIAR   77 (122)
T ss_pred             EcCCCEEEEEEe
Confidence            466666666553


No 68 
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu. SelB may function by replacing EF-Tu. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation.
Probab=35.13  E-value=1.1e+02  Score=18.62  Aligned_cols=33  Identities=21%  Similarity=0.180  Sum_probs=21.2

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEE--------EeCCCEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIV--------AKEGDVVEA   62 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi--------g~pGD~v~~   62 (130)
                      ..++.||-|.+.+..         ...-||.+-        |.|||.|.+
T Consensus        25 G~i~~g~~v~~~p~~---------~~~~V~sI~~~~~~~~~a~aGd~v~i   65 (83)
T cd03696          25 GSVKVGDKVEILPLG---------EETRVRSIQVHGKDVEEAKAGDRVAL   65 (83)
T ss_pred             cEEeCCCEEEECCCC---------ceEEEEEEEECCcCcCEEcCCCEEEE
Confidence            457788888877642         234445444        677888776


No 69 
>KOG4030 consensus Uncharacterized conserved protein, contains SPRY domain [Function unknown]
Probab=34.87  E-value=48  Score=23.85  Aligned_cols=24  Identities=29%  Similarity=0.300  Sum_probs=15.5

Q ss_pred             EEEeCCCEEEEeCCEEEECCEEccccc
Q 043519           52 IVAKEGDVVEACEGKLIVNGVVRNKDF   78 (130)
Q Consensus        52 Vig~pGD~v~~~~~~l~vng~~~~~~~   78 (130)
                      |+|+.=|.|+.   .+|+||+.+..++
T Consensus       130 vVGvayDHVEL---nfY~NGKn~e~p~  153 (197)
T KOG4030|consen  130 VVGVAYDHVEL---NFYVNGKNVEDPI  153 (197)
T ss_pred             EEEEEeeeEEE---EEEEcCceecccc
Confidence            44444445544   5899999876654


No 70 
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages. EF-1A is very abundant in the cytosol, where it is involved in the GTP-dependent binding of aminoacyl-tRNAs to the A site of the ribosomes in the second step of translation from mRNAs to proteins. Both domain II of EF1A and domain IV of IF2/eIF5B have been implicated in recognition of the 3'-ends of tRNA. More than 61% of eukaryotic elongation factor 1A (eEF-1A) in cells is estimated to be associated with actin cytoskeleton. The binding of eEF1A to actin is a noncanonical function that may link two distinct cellular processes, cytoskeleton organization and gene expression.
Probab=34.32  E-value=1.2e+02  Score=18.91  Aligned_cols=33  Identities=18%  Similarity=0.066  Sum_probs=22.4

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEE--------EeCCCEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIV--------AKEGDVVEA   62 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi--------g~pGD~v~~   62 (130)
                      +.++.||-|.+-+..         ...-||.|-        |.+||.|.+
T Consensus        29 G~i~~gd~v~i~P~~---------~~~~V~sI~~~~~~~~~a~aG~~v~i   69 (91)
T cd03693          29 GVLKPGMVVTFAPAG---------VTGEVKSVEMHHEPLEEALPGDNVGF   69 (91)
T ss_pred             ceeecCCEEEECCCC---------cEEEEEEEEECCcCcCEECCCCEEEE
Confidence            467889988887642         334555554        778888876


No 71 
>COG0103 RpsI Ribosomal protein S9 [Translation, ribosomal structure and biogenesis]
Probab=33.56  E-value=51  Score=22.75  Aligned_cols=29  Identities=24%  Similarity=0.299  Sum_probs=23.9

Q ss_pred             CCceEEEEEEEeCCCEEEEeCCEEEECCEEccccc
Q 043519           44 DDGVYIKGIVAKEGDVVEACEGKLIVNGVVRNKDF   78 (130)
Q Consensus        44 ~~~~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~   78 (130)
                      ..+.-+-||.-.||      .|++.|||+++++-|
T Consensus        11 kRK~AvArv~l~~g------~G~i~vNg~~~e~yf   39 (130)
T COG0103          11 KRKSAVARVRLVPG------KGKITVNGRPLELYF   39 (130)
T ss_pred             cccceEEEEEEEcC------CcEEEECCcCHHHhc
Confidence            46788899998888      689999999987644


No 72 
>PF00278 Orn_DAP_Arg_deC:  Pyridoxal-dependent decarboxylase, C-terminal sheet domain;  InterPro: IPR022643 These enzymes are collectively known as group IV decarboxylases []. Pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates can be classified into two different families on the basis of sequence similarities [, ]. Members of this family while most probably evolutionary related, do not share extensive regions of sequence similarities. The proteins contain a conserved lysine residue which is known, in mouse ODC [], to be the site of attachment of the pyridoxal-phosphate group. The proteins also contain a stretch of three consecutive glycine residues and has been proposed to be part of a substrate- binding region []. This entry represents the C-terminal region of the Orn/DAP/Arg decarboxylases.; GO: 0003824 catalytic activity; PDB: 1TWI_B 1TUF_A 3MT1_A 3N2B_C 2O0T_A 1HKW_A 1HKV_A 3VAB_A 3N2O_A 7ODC_A ....
Probab=32.89  E-value=72  Score=20.43  Aligned_cols=31  Identities=13%  Similarity=0.083  Sum_probs=19.5

Q ss_pred             cccccCCEEEEEccccCCCCCCCCcEEEEecCC
Q 043519            3 RAYVVTSLRRKGSVTYYFREPFANDILIFKSPP   35 (130)
Q Consensus         3 Ptl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~   35 (130)
                      ||-..+|++.-....  ..+++.||+++|..-.
T Consensus        65 ptC~~~D~i~~~~~l--P~~l~~GD~l~f~~~G   95 (116)
T PF00278_consen   65 PTCDSGDVIARDVML--PKELEVGDWLVFENMG   95 (116)
T ss_dssp             SSSSTTSEEEEEEEE--ESTTTTT-EEEESS-S
T ss_pred             CCcCCCceEeeeccC--CCCCCCCCEEEEecCc
Confidence            566678887643221  1278999999998754


No 73 
>KOG1816 consensus Ubiquitin fusion-degradation protein [Posttranslational modification, protein turnover, chaperones]
Probab=32.82  E-value=2.4e+02  Score=22.28  Aligned_cols=40  Identities=18%  Similarity=0.228  Sum_probs=27.1

Q ss_pred             CCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEeCCEEEEC
Q 043519           22 EPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEACEGKLIVN   70 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~~~~l~vn   70 (130)
                      .+..||++....         +...+.++=+-..|...|.|.+--+-|+
T Consensus       145 cLT~gDvi~i~Y---------n~k~y~i~V~e~kPa~aVsIiEtD~~VD  184 (308)
T KOG1816|consen  145 CLTTGDVILINY---------NEKTYELKVVETKPANAVSIIETDLNVD  184 (308)
T ss_pred             ccccCCEEEEec---------CCeEEEEEEEEecCCceeEEEEcceeec
Confidence            355666666655         3456778888889988888865544444


No 74 
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional
Probab=31.57  E-value=1.8e+02  Score=20.29  Aligned_cols=17  Identities=18%  Similarity=0.040  Sum_probs=9.1

Q ss_pred             eEEEEEEEeCCCEEEEe
Q 043519           47 VYIKGIVAKEGDVVEAC   63 (130)
Q Consensus        47 ~~vKRVig~pGD~v~~~   63 (130)
                      .+.-||+.+-+++|.+.
T Consensus       108 ~~~~~V~~i~~~~v~vD  124 (156)
T PRK15095        108 EMPGVIREINGDSITVD  124 (156)
T ss_pred             EEEEEEEEEcCCEEEEE
Confidence            34445555555555554


No 75 
>cd06555 ASCH_PF0470_like ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=30.83  E-value=1.1e+02  Score=20.32  Aligned_cols=14  Identities=14%  Similarity=0.287  Sum_probs=11.5

Q ss_pred             CCCCCCcEEEEecC
Q 043519           21 REPFANDILIFKSP   34 (130)
Q Consensus        21 ~~~~rGDiVvf~~p   34 (130)
                      +.++.||.++|..-
T Consensus        30 ~~ikvGD~I~f~~~   43 (109)
T cd06555          30 QQIKVGDKILFNDL   43 (109)
T ss_pred             hcCCCCCEEEEEEc
Confidence            36899999999864


No 76 
>PF11320 DUF3122:  Protein of unknown function (DUF3122);  InterPro: IPR021469  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=30.75  E-value=1.9e+02  Score=20.10  Aligned_cols=46  Identities=9%  Similarity=-0.003  Sum_probs=31.8

Q ss_pred             cCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCC
Q 043519            7 VTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGD   58 (130)
Q Consensus         7 ~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD   58 (130)
                      +|..+.=++-+.+...-+.=.+|+|+....      +....+.=|+||-||.
T Consensus        10 pgq~~yrS~qsLrD~~g~sWQvV~fkr~~~------~~~~~i~LRLVGfPG~   55 (134)
T PF11320_consen   10 PGQVLYRSRQSLRDQDGNSWQVVLFKRIKP------GQVKPINLRLVGFPGS   55 (134)
T ss_pred             CCcEEEEeeeeecCCCCCceEEEEEEecCC------CCCCceEEEEeeCCCc
Confidence            455555555544444556778899987652      2467899999999997


No 77 
>cd04466 S1_YloQ_GTPase S1_YloQ_GTPase: YloQ GTase family (also known as YjeQ and CpgA), S1-like RNA-binding domain. Proteins in the YloQ GTase family bind the ribosome and have GTPase activity. The precise role of this family is unknown. The protein structure is composed of three domains: an N-terminal S1 domain, a central GTPase domain, and a C-terminal zinc finger domain. This N-terminal S1 domain binds ssRNA. The central GTPase domain contains nucleotide-binding signature motifs: G1 (walker A), G3 (walker B) and G4 motifs. Experiments show that the bacterial YloQ and YjeQ proteins have low intrinsic GTPase activity. The C-terminal zinc-finger domain has structural similarity to a portion of the DNA-repair protein Rad51. This suggests a possible role for this GTPase as a regulator of translation, perhaps as a translation initiation factor. This family is classified based on the N-terminal S1 domain.
Probab=30.74  E-value=93  Score=17.86  Aligned_cols=13  Identities=23%  Similarity=0.381  Sum_probs=9.0

Q ss_pred             CCCCCcEEEEecC
Q 043519           22 EPFANDILIFKSP   34 (130)
Q Consensus        22 ~~~rGDiVvf~~p   34 (130)
                      .|..||.|.+..+
T Consensus        37 ~~~VGD~V~~~~~   49 (68)
T cd04466          37 PPAVGDRVEFEPE   49 (68)
T ss_pred             CCCCCcEEEEEEC
Confidence            3677888887653


No 78 
>smart00439 BAH Bromo adjacent homology domain.
Probab=30.25  E-value=1.1e+02  Score=19.40  Aligned_cols=26  Identities=19%  Similarity=0.262  Sum_probs=15.4

Q ss_pred             CCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519           23 PFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus        23 ~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      ++.||.|.+.++.       .....++-||..+
T Consensus         2 ~~vgd~V~v~~~~-------~~~~~~i~~I~~i   27 (120)
T smart00439        2 IRVGDFVLVEPDD-------ADEPYYIGRIEEI   27 (120)
T ss_pred             cccCCEEEEeCCC-------CCCCCEEEEEEEE
Confidence            4567777777654       1234566666554


No 79 
>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=30.25  E-value=45  Score=21.21  Aligned_cols=14  Identities=14%  Similarity=-0.145  Sum_probs=10.8

Q ss_pred             CccccccCCEEEEE
Q 043519            1 MLRAYVVTSLRRKG   14 (130)
Q Consensus         1 M~Ptl~~gd~vlv~   14 (130)
                      |.|.|+.||.|++.
T Consensus        46 ~rp~L~~GDlV~Ar   59 (86)
T cd05790          46 NRPNLNVGDLVYAR   59 (86)
T ss_pred             ccccCCCCCEEEEE
Confidence            46788888888775


No 80 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=29.39  E-value=41  Score=17.93  Aligned_cols=12  Identities=33%  Similarity=0.601  Sum_probs=9.4

Q ss_pred             eCCEEEECCEEc
Q 043519           63 CEGKLIVNGVVR   74 (130)
Q Consensus        63 ~~~~l~vng~~~   74 (130)
                      +.|+|+|||+-+
T Consensus        22 ~pG~ViING~C~   33 (36)
T PF08194_consen   22 TPGNVIINGKCI   33 (36)
T ss_pred             CCCeEEECceee
Confidence            468899999854


No 81 
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=29.10  E-value=39  Score=22.91  Aligned_cols=13  Identities=23%  Similarity=0.498  Sum_probs=11.1

Q ss_pred             CCCCCCcEEEEec
Q 043519           21 REPFANDILIFKS   33 (130)
Q Consensus        21 ~~~~rGDiVvf~~   33 (130)
                      .++++||+|.|..
T Consensus        75 ~~~qpGDlvff~~   87 (134)
T TIGR02219        75 DAAQPGDVLVFRW   87 (134)
T ss_pred             hcCCCCCEEEEee
Confidence            3689999999985


No 82 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=28.79  E-value=14  Score=28.12  Aligned_cols=43  Identities=14%  Similarity=0.203  Sum_probs=30.1

Q ss_pred             CCCCCcEEEEecCCcccccccCCCceEEEEEE-EeCCCEEEEeCCEEEECCEEcc
Q 043519           22 EPFANDILIFKSPPLLQEVGYTDDGVYIKGIV-AKEGDVVEACEGKLIVNGVVRN   75 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi-g~pGD~v~~~~~~l~vng~~~~   75 (130)
                      ++++|++|++.-|.       ..++.-+=|++ ++.    .++.|.++|+|+.+.
T Consensus        24 ~v~~Gevv~iiGpS-------GSGKSTlLRclN~LE----~~~~G~I~i~g~~~~   67 (240)
T COG1126          24 SVEKGEVVVIIGPS-------GSGKSTLLRCLNGLE----EPDSGSITVDGEDVG   67 (240)
T ss_pred             eEcCCCEEEEECCC-------CCCHHHHHHHHHCCc----CCCCceEEECCEecc
Confidence            57899999999886       34554444443 443    467899999997653


No 83 
>PF01455 HupF_HypC:  HupF/HypC family;  InterPro: IPR001109 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesised as a precursor devoid of the metalloenzyme active site. This precursor then undergoes a complex post-translational maturation process that requires a number of accessory proteins. The hydrogenase expression/formation proteins (HupF/HypC) form a family of small proteins that are hydrogenase precursor-specific chaperones required for this maturation process []. They are believed to keep the hydrogenase precursor in a conformation accessible for metal incorporation [, ].; PDB: 3D3R_A 2Z1C_C 2OT2_A.
Probab=28.27  E-value=52  Score=19.90  Aligned_cols=9  Identities=11%  Similarity=-0.215  Sum_probs=3.6

Q ss_pred             cccCCEEEE
Q 043519            5 YVVTSLRRK   13 (130)
Q Consensus         5 l~~gd~vlv   13 (130)
                      .+.||+|++
T Consensus        38 v~~Gd~VLV   46 (68)
T PF01455_consen   38 VKVGDYVLV   46 (68)
T ss_dssp             B-TT-EEEE
T ss_pred             CCCCCEEEE
Confidence            445555554


No 84 
>PF15428 Imm14:  Immunity protein 14
Probab=28.08  E-value=1e+02  Score=20.39  Aligned_cols=22  Identities=14%  Similarity=0.135  Sum_probs=16.8

Q ss_pred             CCCcEEEEecCCcccccccCCCceEEEEEEE
Q 043519           24 FANDILIFKSPPLLQEVGYTDDGVYIKGIVA   54 (130)
Q Consensus        24 ~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig   54 (130)
                      +.|||..+..+         .+.+...||++
T Consensus         1 K~GDIF~ipL~---------~~~y~~G~Vi~   22 (129)
T PF15428_consen    1 KPGDIFCIPLD---------DGKYGFGRVIG   22 (129)
T ss_pred             CCceEEEEEcC---------CCCEEEEEEEe
Confidence            46898888875         46788888884


No 85 
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional
Probab=27.32  E-value=84  Score=23.56  Aligned_cols=15  Identities=0%  Similarity=-0.144  Sum_probs=10.4

Q ss_pred             CccccccCCEEEEEc
Q 043519            1 MLRAYVVTSLRRKGS   15 (130)
Q Consensus         1 M~Ptl~~gd~vlv~k   15 (130)
                      |.+.|+.||.|.+.-
T Consensus       108 ~~~~~~~GDlV~akV  122 (235)
T PRK04163        108 LRKYLDIGDYIIAKV  122 (235)
T ss_pred             hHhhCCCCCEEEEEE
Confidence            456677788887653


No 86 
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The Metastasis-associated protein MTA1 is part of the NURD (nucleosome remodeling and deacetylating) complex and plays a role in cellular transformation and metastasis. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=27.28  E-value=1e+02  Score=21.97  Aligned_cols=25  Identities=24%  Similarity=0.336  Sum_probs=19.1

Q ss_pred             CCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519           23 PFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus        23 ~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      ++.||-|.|.++.        ...++|.||.-+
T Consensus         4 yrvGD~Vy~~~~~--------~~Py~I~rI~e~   28 (164)
T cd04709           4 YRVGDYVYFESSP--------NNPYLIRRIEEL   28 (164)
T ss_pred             EecCCEEEEECCC--------CCCCEEEEEEEE
Confidence            4679999999864        334789999876


No 87 
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage.
Probab=27.12  E-value=30  Score=19.87  Aligned_cols=14  Identities=36%  Similarity=0.574  Sum_probs=11.5

Q ss_pred             EeCCEEEECCEEcc
Q 043519           62 ACEGKLIVNGVVRN   75 (130)
Q Consensus        62 ~~~~~l~vng~~~~   75 (130)
                      +++|.++|||+.+.
T Consensus        31 i~~G~V~VNg~~~~   44 (59)
T TIGR02988        31 LQENEVLVNGELEN   44 (59)
T ss_pred             HHcCCEEECCEEcc
Confidence            36899999999873


No 88 
>TIGR00061 L21 ribosomal protein L21. Eubacterial and chloroplast.
Probab=26.98  E-value=88  Score=20.49  Aligned_cols=22  Identities=14%  Similarity=0.080  Sum_probs=11.4

Q ss_pred             ccCCEEEEEccccCCCCCCCCcEEEEe
Q 043519            6 VVTSLRRKGSVTYYFREPFANDILIFK   32 (130)
Q Consensus         6 ~~gd~vlv~k~~~~~~~~~rGDiVvf~   32 (130)
                      ..||.+.++++.     .+.||-|.|.
T Consensus        14 ~~Gd~i~Ve~l~-----~~~G~~i~l~   35 (101)
T TIGR00061        14 EEGQTVRIEKLD-----AAPGDTVEFD   35 (101)
T ss_pred             eCCCEEEEcccC-----CCCCCEEEEE
Confidence            356666666542     2345555544


No 89 
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]
Probab=26.95  E-value=12  Score=27.73  Aligned_cols=58  Identities=10%  Similarity=0.082  Sum_probs=39.9

Q ss_pred             ccccCCEEEEEccccCCCCCCCCcEEEEecCCcccccccCCCceEEEEEE-EeCCCEEEEeCCEEEECCEEcc
Q 043519            4 AYVVTSLRRKGSVTYYFREPFANDILIFKSPPLLQEVGYTDDGVYIKGIV-AKEGDVVEACEGKLIVNGVVRN   75 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi-g~pGD~v~~~~~~l~vng~~~~   75 (130)
                      +.+.|++.+...+++   .+..|+++++.-|.       ..++.-+=|++ |+    .+-..|+|+.||+.+.
T Consensus         9 ~~~R~e~~lf~~L~f---~l~~Ge~~~i~G~N-------G~GKTtLLRilaGL----l~p~~G~v~~~~~~i~   67 (209)
T COG4133           9 SCERGERTLFSDLSF---TLNAGEALQITGPN-------GAGKTTLLRILAGL----LRPDAGEVYWQGEPIQ   67 (209)
T ss_pred             hhccCcceeecceeE---EEcCCCEEEEECCC-------CCcHHHHHHHHHcc----cCCCCCeEEecCCCCc
Confidence            345688888887775   46789999998875       34555444544 44    3456789999987654


No 90 
>PRK00276 infA translation initiation factor IF-1; Validated
Probab=26.33  E-value=66  Score=19.43  Aligned_cols=11  Identities=9%  Similarity=0.096  Sum_probs=9.8

Q ss_pred             CCCCcEEEEec
Q 043519           23 PFANDILIFKS   33 (130)
Q Consensus        23 ~~rGDiVvf~~   33 (130)
                      |..||+|.|..
T Consensus        47 i~vGD~V~ve~   57 (72)
T PRK00276         47 ILPGDKVTVEL   57 (72)
T ss_pred             cCCCCEEEEEE
Confidence            78899999995


No 91 
>TIGR02390 RNA_pol_rpoA1 DNA-directed RNA polymerase subunit A'. This family consists of the archaeal A' subunit of the DNA-directed RNA polymerase. The example from Methanocaldococcus jannaschii contains an intein.
Probab=26.11  E-value=89  Score=28.21  Aligned_cols=37  Identities=16%  Similarity=0.250  Sum_probs=26.7

Q ss_pred             CCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEe
Q 043519           22 EPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEAC   63 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~   63 (130)
                      .+..||+|+|.-.+++.     .-...--||.-+||.|+++.
T Consensus       407 hl~dgd~vl~NRqPsLH-----r~si~a~~~~v~~~~t~r~n  443 (868)
T TIGR02390       407 HLIDGDIVLFNRQPSLH-----RMSMMGHKVKVLPGKTFRLN  443 (868)
T ss_pred             ehhcCccceeccCCccc-----cccceeEEEEEecCceEeec
Confidence            46789999998766442     23355667777899999884


No 92 
>PRK02268 hypothetical protein; Provisional
Probab=25.82  E-value=84  Score=21.94  Aligned_cols=30  Identities=20%  Similarity=0.195  Sum_probs=19.7

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      +.++.||.|+|.+|...     -.++..+..++|+
T Consensus        34 ~RmkpGD~ivyYsp~~~-----~~~~~~~qaftAi   63 (141)
T PRK02268         34 RRMKPGDWIIYYSPKTT-----FGGKDKLQAFTAI   63 (141)
T ss_pred             hcCCCCCEEEEEeceEe-----cCCCcccceEEEE
Confidence            45799999999988642     1344455555554


No 93 
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2. The human polybromo protein (BAF180) is a component of the SWI/SNF chromatin-remodeling complex PBAF. It is thought that polybromo participates in transcriptional regulation. Saccharomyces cerevisiae RSC1 and RSC2 are part of the 15-subunit nucleosome remodeling RSC complex. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=25.66  E-value=1.1e+02  Score=20.18  Aligned_cols=26  Identities=15%  Similarity=0.027  Sum_probs=18.1

Q ss_pred             CCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519           23 PFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus        23 ~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      ++.||.|.+.++.       .+...+|-||..+
T Consensus         4 ~~vGD~V~v~~~~-------~~~~~~i~~I~~i   29 (121)
T cd04717           4 YRVGDCVYVANPE-------DPSKPIIFRIERL   29 (121)
T ss_pred             EECCCEEEEeCCC-------CCCCCEEEEEeEE
Confidence            4679999998875       2356777777654


No 94 
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=25.58  E-value=2.2e+02  Score=19.28  Aligned_cols=14  Identities=7%  Similarity=0.052  Sum_probs=11.2

Q ss_pred             CCCCCcEEEEecCC
Q 043519           22 EPFANDILIFKSPP   35 (130)
Q Consensus        22 ~~~rGDiVvf~~p~   35 (130)
                      .++.||+|.+++++
T Consensus         5 ~i~vGD~V~v~~d~   18 (130)
T cd04712           5 TIRVGDVVSVERDD   18 (130)
T ss_pred             EEeCCCEEEEcCCC
Confidence            46789999998875


No 95 
>KOG1535 consensus Predicted fumarylacetoacetate hydralase [General function prediction only]
Probab=25.44  E-value=94  Score=23.27  Aligned_cols=29  Identities=21%  Similarity=0.289  Sum_probs=19.3

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEe
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEAC   63 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~   63 (130)
                      ..+..||+|+=-.|+         +.--+|     |||.++..
T Consensus       175 ~tL~~GDvILTGTP~---------GVg~v~-----~Gd~i~~e  203 (217)
T KOG1535|consen  175 MTLEPGDVILTGTPE---------GVGEVK-----PGDVIQCE  203 (217)
T ss_pred             eeecCCCEEEecCCC---------cccccc-----CCCEEEec
Confidence            356779988888775         222233     88888764


No 96 
>PRK05573 rplU 50S ribosomal protein L21; Validated
Probab=25.40  E-value=1e+02  Score=20.21  Aligned_cols=10  Identities=0%  Similarity=-0.031  Sum_probs=5.3

Q ss_pred             cCCEEEEEcc
Q 043519            7 VTSLRRKGSV   16 (130)
Q Consensus         7 ~gd~vlv~k~   16 (130)
                      .||.+.++++
T Consensus        16 ~Gd~i~v~~l   25 (103)
T PRK05573         16 EGDVIKVEKL   25 (103)
T ss_pred             CCCEEEEccc
Confidence            4555555544


No 97 
>PLN02856 fumarylacetoacetase
Probab=25.28  E-value=2e+02  Score=23.88  Aligned_cols=29  Identities=10%  Similarity=-0.049  Sum_probs=13.9

Q ss_pred             ccccCCEEEEEccccCCCCCCCCcEEEEec
Q 043519            4 AYVVTSLRRKGSVTYYFREPFANDILIFKS   33 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~~~~~rGDiVvf~~   33 (130)
                      ||++||++.---.+ .....+.|+.+....
T Consensus       346 tL~pGDLi~TGTps-G~~~~~~G~llElt~  374 (424)
T PLN02856        346 NLRPGDLLGSGTIS-GPEPGSLGCLLELTW  374 (424)
T ss_pred             ecCCCCEEEeCCCC-CCccCCCCCEEEEEe
Confidence            45566666543222 122345566665543


No 98 
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=24.94  E-value=1.8e+02  Score=18.10  Aligned_cols=34  Identities=15%  Similarity=0.248  Sum_probs=16.6

Q ss_pred             CCCCCcEEEEecCCcccccccCCCceEEEEEEEeCC
Q 043519           22 EPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEG   57 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pG   57 (130)
                      .++.||.|+++......+.  ......+.-|+-..|
T Consensus         5 ~Vk~Gd~ViV~~~~~~~~~--~~~dWWmg~Vi~~~g   38 (75)
T PF11302_consen    5 SVKPGDTVIVQDEQEVGQK--QDKDWWMGQVIHCEG   38 (75)
T ss_pred             ccCCCCEEEEecCcccccc--CCCCcEEEEEEEEec
Confidence            4567777777765422111  233455555554433


No 99 
>COG4127 Uncharacterized conserved protein [Function unknown]
Probab=24.87  E-value=70  Score=25.16  Aligned_cols=26  Identities=19%  Similarity=0.199  Sum_probs=20.6

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIVA   54 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig   54 (130)
                      .+++.||.|+...+.        ..+++|.+|.+
T Consensus        71 neI~KGDlvi~y~k~--------~r~y~IGkVts   96 (318)
T COG4127          71 NEIQKGDLVITYSKS--------NRTYLIGKVTS   96 (318)
T ss_pred             HHhccCcEEEeeccc--------CceEEEEEecC
Confidence            468999999998875        57788887765


No 100
>PF13987 YedD:  YedD-like protein
Probab=24.55  E-value=87  Score=20.79  Aligned_cols=22  Identities=18%  Similarity=0.252  Sum_probs=14.5

Q ss_pred             EEEEEeCCCEEEEeCCEEEECC
Q 043519           50 KGIVAKEGDVVEACEGKLIVNG   71 (130)
Q Consensus        50 KRVig~pGD~v~~~~~~l~vng   71 (130)
                      -||||+||-.....+.-.-|+-
T Consensus        47 QRVia~PGKL~~~~~d~yNVt~   68 (111)
T PF13987_consen   47 QRVIAKPGKLMLRDDDLYNVTR   68 (111)
T ss_pred             heeeecccceeeecCCEEEecc
Confidence            4788888877766655444443


No 101
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase. This group includes proteins similar to GTPBP1 and GTPBP2. GTPB1 is structurally, related to elongation factor 1 alpha, a key component of protein biosynthesis machinery. Immunohistochemical analyses on mouse tissues revealed that GTPBP1 is expressed in some neurons and smooth muscle cells of various organs as well as macrophages. Immunofluorescence analyses revealed that GTPBP1 is localized exclusively in cytoplasm and shows a diffuse granular network forming a gradient from the nucleus to the periphery of the cells in smooth muscle cell lines and macrophages. No significant difference was observed in the immune response to protein antigen between mutant mice and wild-type mice, suggesting normal function of antigen-presenting cells of the mutant mice. The absence of an eminent phenotype in GTPBP1-deficient mice may be due to functional compensation by GTPBP2, which is similar to GTPBP1 in structure and tissue distribution.
Probab=24.40  E-value=1.8e+02  Score=17.88  Aligned_cols=37  Identities=16%  Similarity=0.066  Sum_probs=21.8

Q ss_pred             CCCCCCcEEEEecCCcccccccCCCceEEEEEE--------EeCCCEEEE
Q 043519           21 REPFANDILIFKSPPLLQEVGYTDDGVYIKGIV--------AKEGDVVEA   62 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVi--------g~pGD~v~~   62 (130)
                      ..++.||-+.+.+....     .....-||.|-        |.|||.+.+
T Consensus        25 G~v~~g~~v~~~P~~~g-----~~~~~~V~sI~~~~~~~~~a~aGd~v~l   69 (87)
T cd03694          25 GVIRLGDTLLLGPDQDG-----SFRPVTVKSIHRNRSPVRVVRAGQSASL   69 (87)
T ss_pred             CEEeCCCEEEECCCCCC-----CEeEEEEEEEEECCeECCEECCCCEEEE
Confidence            46788888888764200     00134455554        777887776


No 102
>PF00829 Ribosomal_L21p:  Ribosomal prokaryotic L21 protein;  InterPro: IPR001787 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L21 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L21 is known to bind to the 23S rRNA in the presence of L20. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups:  Bacterial L21.  Marchantia polymorpha chloroplast L21. Cyanelle L21. Plant chloroplast L21 (nuclear-encoded).   Bacterial L21 is a protein of about 100 amino-acid residues, the mature form of the spinach chloroplast L21 has 200 residues.; GO: 0003723 RNA binding, 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2XG0_V 2X9S_V 2XG2_V 3UZ1_2 2Y19_V 2WDL_V 3V23_V 2WRO_V 2WRL_V 2Y11_V ....
Probab=23.73  E-value=82  Score=20.33  Aligned_cols=22  Identities=5%  Similarity=-0.059  Sum_probs=12.8

Q ss_pred             ccCCEEEEEccccCCCCCCCCcEEEEe
Q 043519            6 VVTSLRRKGSVTYYFREPFANDILIFK   32 (130)
Q Consensus         6 ~~gd~vlv~k~~~~~~~~~rGDiVvf~   32 (130)
                      ..||.+.++++.     ...||-|.|+
T Consensus        15 ~~gd~i~v~~l~-----~~~G~~i~l~   36 (96)
T PF00829_consen   15 EEGDVIDVERLD-----AEVGDKIELD   36 (96)
T ss_dssp             SSSEEEEEESTS-----SSTTSEEEET
T ss_pred             eCCCEEEECCcC-----cCCCCEEEEE
Confidence            456777776652     3456666554


No 103
>PF14345 GDYXXLXY:  GDYXXLXY protein
Probab=23.64  E-value=1.1e+02  Score=20.95  Aligned_cols=33  Identities=6%  Similarity=-0.098  Sum_probs=25.4

Q ss_pred             ccccCCEEEEEccccCCCCCCCCcEEEEecCCc
Q 043519            4 AYVVTSLRRKGSVTYYFREPFANDILIFKSPPL   36 (130)
Q Consensus         4 tl~~gd~vlv~k~~~~~~~~~rGDiVvf~~p~~   36 (130)
                      ++..|.-|++.--.+..+.+-+||.|.++...+
T Consensus        16 ~l~~G~~v~L~~~PvDPRdllrGdYv~L~Y~i~   48 (144)
T PF14345_consen   16 ILAQGKEVTLKTAPVDPRDLLRGDYVALNYDIS   48 (144)
T ss_pred             HHhCCCEEEEEecccCcccccccceEEEEcccc
Confidence            467788888776556667889999999998653


No 104
>PF01878 EVE:  EVE domain;  InterPro: IPR002740 The EVE domain is part of the wider PUA domain superfamily. The function of this domain is not known but, given the structural similarities to PUA, is likely to involve RNA binding []. ; PDB: 2G2X_B 2AR1_A 3EOP_A 2EVE_A 2HD9_A 2ZBN_A 1WMM_A 2P5D_A 2GBS_A 1ZCE_A.
Probab=23.37  E-value=1.1e+02  Score=20.60  Aligned_cols=15  Identities=20%  Similarity=0.224  Sum_probs=9.9

Q ss_pred             CCCCCCcEEEEecCC
Q 043519           21 REPFANDILIFKSPP   35 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~   35 (130)
                      +.++.||.|+|..+.
T Consensus        38 ~~mk~GD~vifY~s~   52 (143)
T PF01878_consen   38 KRMKPGDKVIFYHSG   52 (143)
T ss_dssp             HC--TT-EEEEEETS
T ss_pred             hcCCCCCEEEEEEcC
Confidence            478999999999864


No 105
>PF10030 DUF2272:  Uncharacterized protein conserved in bacteria (DUF2272);  InterPro: IPR019262 This is a domain of unknown function found in proteins of unknown function.
Probab=23.37  E-value=2.3e+02  Score=20.65  Aligned_cols=46  Identities=15%  Similarity=0.133  Sum_probs=28.6

Q ss_pred             CCCCCCcEEEEecCCccc----c-cccCCCceEEEEEEE---eCCCEEEEeCCE
Q 043519           21 REPFANDILIFKSPPLLQ----E-VGYTDDGVYIKGIVA---KEGDVVEACEGK   66 (130)
Q Consensus        21 ~~~~rGDiVvf~~p~~~~----~-~~~~~~~~~vKRVig---~pGD~v~~~~~~   66 (130)
                      ..|+.||+|.+.......    . .........+--|++   ..|++|++-+|.
T Consensus        92 y~P~~GDlIc~~R~~~~~~~~~~~~~~~~~~~HcdIVVa~~~~d~~~v~~IGGN  145 (183)
T PF10030_consen   92 YKPRPGDLICYDRGRSKTYDFASLPTSGGFPSHCDIVVAVNVVDGRTVTTIGGN  145 (183)
T ss_pred             CCCCCCCEEEecCCCCcccchhhhccCCCCCCceeEEEeeccCCCCEEEEEcCc
Confidence            468999999987654210    0 000113356667888   777888887664


No 106
>smart00841 Elong-fact-P_C Elongation factor P, C-terminal. These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology PUBMED:15210970.
Probab=23.21  E-value=1.3e+02  Score=17.55  Aligned_cols=12  Identities=8%  Similarity=-0.020  Sum_probs=8.6

Q ss_pred             CCCCcEEEEecC
Q 043519           23 PFANDILIFKSP   34 (130)
Q Consensus        23 ~~rGDiVvf~~p   34 (130)
                      ++.||.|.++..
T Consensus        38 I~~Gd~I~V~T~   49 (56)
T smart00841       38 INEGDKIKVDTR   49 (56)
T ss_pred             ccCCCEEEEECC
Confidence            567888777764


No 107
>PF14415 DUF4424:  Domain of unknown function (DUF4424)
Probab=23.08  E-value=76  Score=24.28  Aligned_cols=19  Identities=37%  Similarity=0.787  Sum_probs=14.9

Q ss_pred             ccCCCCCCCCcE---EEEecCC
Q 043519           17 TYYFREPFANDI---LIFKSPP   35 (130)
Q Consensus        17 ~~~~~~~~rGDi---Vvf~~p~   35 (130)
                      .|.|..+...|+   |.|..|+
T Consensus         6 ~Y~F~N~t~~dv~~~VaFPlP~   27 (253)
T PF14415_consen    6 RYVFRNPTDQDVTVTVAFPLPD   27 (253)
T ss_pred             EEEEeCCCCCcEEEEEEEeCCC
Confidence            467778888885   9999885


No 108
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=22.67  E-value=63  Score=21.45  Aligned_cols=13  Identities=31%  Similarity=0.391  Sum_probs=10.9

Q ss_pred             CCCCCCCcEEEEe
Q 043519           20 FREPFANDILIFK   32 (130)
Q Consensus        20 ~~~~~rGDiVvf~   32 (130)
                      .+.+++||.|+|.
T Consensus        31 rr~ik~GD~IiF~   43 (111)
T COG4043          31 RRQIKPGDKIIFN   43 (111)
T ss_pred             hcCCCCCCEEEEc
Confidence            3578999999996


No 109
>PF05949 DUF881:  Bacterial protein of unknown function (DUF881);  InterPro: IPR010273 This family consists of a series of hypothetical bacterial proteins. One of the family members Q45543 from SWISSPROT from Bacillus subtilis is thought to be involved in cell division and sporulation [].; PDB: 3GMG_B.
Probab=22.52  E-value=1e+02  Score=21.39  Aligned_cols=23  Identities=17%  Similarity=0.505  Sum_probs=16.3

Q ss_pred             CEEEEeCCEEEECCEEccccccc
Q 043519           58 DVVEACEGKLIVNGVVRNKDFIL   80 (130)
Q Consensus        58 D~v~~~~~~l~vng~~~~~~~~~   80 (130)
                      -.|++.++.+.|||+++..+|..
T Consensus        72 S~Ir~~g~~i~Vng~~i~~Py~I   94 (149)
T PF05949_consen   72 SAIRCAGGTILVNGRPISPPYVI   94 (149)
T ss_dssp             --EEEETTEEEETTEEE-SSEEE
T ss_pred             EEEEEeCCEEEECCEEccCCEEE
Confidence            34566689999999999888744


No 110
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=22.28  E-value=1.6e+02  Score=20.20  Aligned_cols=27  Identities=26%  Similarity=0.289  Sum_probs=20.6

Q ss_pred             CCCCCcEEEEecCCcccccccCCCceEEEEEEEe
Q 043519           22 EPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAK   55 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~   55 (130)
                      .++.||-|.+.+..       ....++|.||...
T Consensus        11 ~~~vgD~Vyv~~~~-------~~ePyyIgrI~e~   37 (135)
T cd04710          11 LLKVNDHIYMSSEP-------PGEPYYIGRIMEF   37 (135)
T ss_pred             EEeCCCEEEEecCC-------CCCCCEEEEEEEE
Confidence            46889999999864       2456789999874


No 111
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the catalytic or G-domain. The G-domain is composed of about 200 amino acid residues, arranged into a predominantly parallel six-stranded beta-sheet core surrounded by seven a-helices. Non-catalytic domains II and III are beta-barrels of seven and six, respectively, antiparallel beta-strands that share an extended interface. Either non-catalytic domain is composed of about 100 amino acid residues.  EF-Tu proteins exist in two principal conformations: in a compact one, EF-Tu*GTP, with tight interfaces between all three domains and a high affinity for aminoacyl-tRNA, and in an open one, EF-Tu*GDP, with essentially no G-domain-domain II interactions and a low affinity for aminoacyl-tRNA. EF-Tu has approximately a 100-fold higher
Probab=22.27  E-value=2e+02  Score=17.61  Aligned_cols=14  Identities=7%  Similarity=-0.223  Sum_probs=10.9

Q ss_pred             CCCCCCcEEEEecC
Q 043519           21 REPFANDILIFKSP   34 (130)
Q Consensus        21 ~~~~rGDiVvf~~p   34 (130)
                      ..++.||-|.+.++
T Consensus        25 G~v~~gd~v~~~p~   38 (87)
T cd03697          25 GTIKVGDEVEIVGF   38 (87)
T ss_pred             CCCccCCEEEEeCC
Confidence            56889999988764


No 112
>PF00380 Ribosomal_S9:  Ribosomal protein S9/S16;  InterPro: IPR000754 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S9 is one of the proteins from the small ribosomal subunit. It belongs to the S9P family of ribosomal proteins which, on the basis of sequence similarities [, ], groups bacterial; algal chloroplast; cyanelle and archaeal S9 proteins; and mammalian; plant; and yeast mitochondrial ribosomal S9 proteins. These proteins adopt a beta-alpha-beta fold similar to that found in numerous RNA/DNA-binding proteins, as well as in kinases from the GHMP kinase family [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V46_I 3T1H_I 3MR8_I 3F1G_I 3D5C_I 3D5A_I 2WDG_I 3MS0_I 2WDM_I 2J02_I ....
Probab=22.06  E-value=71  Score=21.62  Aligned_cols=26  Identities=31%  Similarity=0.431  Sum_probs=18.9

Q ss_pred             eEEEEEEEeCCCEEEEeCCEEEECCEEccccc
Q 043519           47 VYIKGIVAKEGDVVEACEGKLIVNGVVRNKDF   78 (130)
Q Consensus        47 ~~vKRVig~pGD~v~~~~~~l~vng~~~~~~~   78 (130)
                      .-+-||.-.||      +|.+.|||+++.+-|
T Consensus         5 ~a~A~v~l~~G------~G~i~INg~~l~~yf   30 (121)
T PF00380_consen    5 TAIARVWLKPG------SGKIRINGKPLEEYF   30 (121)
T ss_dssp             TEEEEEEEEES------SSEEEETTSEHHHHS
T ss_pred             eEEEEEEEEeC------ceEEEECCEEHHHhc
Confidence            44556666666      589999999986644


No 113
>PF11132 SplA:  Transcriptional regulator protein (SplA);  InterPro: IPR022608  The SplA protein functions in trans as a negative regulator of the level of splB-lacZ expression in the developing forespore []. 
Probab=21.88  E-value=76  Score=19.72  Aligned_cols=13  Identities=15%  Similarity=0.153  Sum_probs=9.6

Q ss_pred             Cc-cccccCCEEEE
Q 043519            1 ML-RAYVVTSLRRK   13 (130)
Q Consensus         1 M~-Ptl~~gd~vlv   13 (130)
                      |. .+++.||.|+|
T Consensus         1 M~~~~~~~GD~VyV   14 (75)
T PF11132_consen    1 MDMKPYHAGDIVYV   14 (75)
T ss_pred             CCccccCCCCEEEE
Confidence            44 67788888877


No 114
>smart00216 VWD von Willebrand factor (vWF) type D domain. Von Willebrand factor contains several type D domains: D1 and D2 are present within the N-terminal propeptide whereas the remaining D domains are required for multimerisation.
Probab=21.81  E-value=2.6e+02  Score=18.85  Aligned_cols=32  Identities=28%  Similarity=0.385  Sum_probs=22.0

Q ss_pred             EEEE-EEEeCCCEEEEe--CCEEEECCEEcccccc
Q 043519           48 YIKG-IVAKEGDVVEAC--EGKLIVNGVVRNKDFI   79 (130)
Q Consensus        48 ~vKR-Vig~pGD~v~~~--~~~l~vng~~~~~~~~   79 (130)
                      ..|. .+-+.++.|.+.  +..+.+||+.+.-++.
T Consensus        63 ~~~~v~v~~~~~~i~~~~~~~~v~vng~~v~~p~~   97 (162)
T smart00216       63 CLKSVKVELNGDEIELKDDNGTVTVNGQQVSLPYK   97 (162)
T ss_pred             EEEEEEEEECCEEEEEEeCCCEEEECCEEeeCCcC
Confidence            3444 456667778887  5799999997655543


No 115
>PF01079 Hint:  Hint module;  InterPro: IPR001767 This domain identifies a group of cysteine peptidases correspond to MEROPS peptidase family C46 (clan CH). The type example is the Hedgehog protein from Drosophila melanogaster (Fruit fly). These are involved in intracellular signalling required for a variety of patterning events during development. The hedgehog family of proteins self process by a cysteine-dependent mechanism, which is a one-time autolytic cleavage. It is differentiated from a typical peptidase reaction by the fact that the newly-formed carboxyl group is esterified with cholesterol, rather than being left free. The three-dimensional structure of the autolytic domain of the hedgehog protein of D. melanogaster shows that it is formed from two divergent copies of a module that also occurs in inteins, called a Hint domain [,].; GO: 0008233 peptidase activity, 0006508 proteolysis; PDB: 3K7H_B 3K7I_B 3K7G_B 1AT0_A 3MXW_A 3M1N_B 3HO5_H 2WFR_A 2WFQ_A 2WG3_B ....
Probab=21.70  E-value=1.4e+02  Score=22.19  Aligned_cols=15  Identities=13%  Similarity=0.277  Sum_probs=6.7

Q ss_pred             EEEeCCCEEEEeCCE
Q 043519           52 IVAKEGDVVEACEGK   66 (130)
Q Consensus        52 Vig~pGD~v~~~~~~   66 (130)
                      |--..|.++.++..+
T Consensus        69 i~te~g~~l~LTp~H   83 (217)
T PF01079_consen   69 IETEDGRSLTLTPNH   83 (217)
T ss_dssp             EEETTS-EEEE-TT-
T ss_pred             EEcCCCCeEEecCCc
Confidence            444455666666544


No 116
>TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF. An additional proposed function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. PubMed:12441107.
Probab=21.32  E-value=73  Score=19.78  Aligned_cols=12  Identities=17%  Similarity=0.205  Sum_probs=7.1

Q ss_pred             CCCCCcEEEEec
Q 043519           22 EPFANDILIFKS   33 (130)
Q Consensus        22 ~~~rGDiVvf~~   33 (130)
                      +++.||+|+...
T Consensus        35 ~~~vGD~VLVH~   46 (76)
T TIGR00074        35 EVKVGDYVLVHV   46 (76)
T ss_pred             CCCCCCEEEEec
Confidence            355666666654


No 117
>PF05382 Amidase_5:  Bacteriophage peptidoglycan hydrolase ;  InterPro: IPR008044 This entry is represented by Bacteriophage SFi21, lysin (Cell wall hydrolase; 3.5.1.28 from EC). At least one of proteins in this entry, the Pal protein from the pneumococcal bacteriophage Dp-1 (O03979 from SWISSPROT) has been shown to be an N-acetylmuramoyl-L-alanine amidase []. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside within this domain while a C-terminal domain binds to the choline residues of the cell wall teichoic acids [, ].
Probab=21.21  E-value=61  Score=22.70  Aligned_cols=14  Identities=21%  Similarity=0.247  Sum_probs=11.5

Q ss_pred             CCCCCCcEEEEecC
Q 043519           21 REPFANDILIFKSP   34 (130)
Q Consensus        21 ~~~~rGDiVvf~~p   34 (130)
                      ..+++|||+++...
T Consensus        74 ~~~q~GDI~I~g~~   87 (145)
T PF05382_consen   74 WNLQRGDIFIWGRR   87 (145)
T ss_pred             ccccCCCEEEEcCC
Confidence            36899999998664


No 118
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=21.14  E-value=60  Score=20.58  Aligned_cols=13  Identities=31%  Similarity=0.542  Sum_probs=10.8

Q ss_pred             CCCCCCcEEEEec
Q 043519           21 REPFANDILIFKS   33 (130)
Q Consensus        21 ~~~~rGDiVvf~~   33 (130)
                      .++++||++.|..
T Consensus        50 ~~~~pGDlif~~~   62 (105)
T PF00877_consen   50 SELQPGDLIFFKG   62 (105)
T ss_dssp             GG-TTTEEEEEEG
T ss_pred             hcCCcccEEEEeC
Confidence            4689999999998


No 119
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=20.92  E-value=1.2e+02  Score=18.13  Aligned_cols=13  Identities=15%  Similarity=0.360  Sum_probs=8.1

Q ss_pred             CCCCCcEEEEecC
Q 043519           22 EPFANDILIFKSP   34 (130)
Q Consensus        22 ~~~rGDiVvf~~p   34 (130)
                      +++.||++.+..+
T Consensus        28 ~L~~Gdvi~l~~~   40 (77)
T PF01052_consen   28 NLKVGDVIPLDKP   40 (77)
T ss_dssp             C--TT-EEEECCE
T ss_pred             cCCCCCEEEeCCC
Confidence            5788888888876


No 120
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism]
Probab=20.64  E-value=94  Score=27.90  Aligned_cols=16  Identities=38%  Similarity=0.530  Sum_probs=14.1

Q ss_pred             EEEEeCCEEEECCEEc
Q 043519           59 VVEACEGKLIVNGVVR   74 (130)
Q Consensus        59 ~v~~~~~~l~vng~~~   74 (130)
                      +|+++++.++|||+++
T Consensus       285 ~iei~~~~~~iNGkpv  300 (808)
T COG3250         285 TVEIKDGLLLINGKPV  300 (808)
T ss_pred             EEEEECCeEEECCeEE
Confidence            6788899999999986


No 121
>smart00663 RPOLA_N RNA polymerase I subunit A N-terminus.
Probab=20.38  E-value=3.1e+02  Score=21.49  Aligned_cols=37  Identities=16%  Similarity=0.349  Sum_probs=26.5

Q ss_pred             CCCCCcEEEEecCCcccccccCCCceEEEEEEEeCCCEEEEe
Q 043519           22 EPFANDILIFKSPPLLQEVGYTDDGVYIKGIVAKEGDVVEAC   63 (130)
Q Consensus        22 ~~~rGDiVvf~~p~~~~~~~~~~~~~~vKRVig~pGD~v~~~   63 (130)
                      .+..||+|+|.-..++.     ......-|+.-++|.|+.+.
T Consensus       198 ~l~dgd~Vl~NRqPsLH-----r~si~a~~v~v~~~~tir~n  234 (295)
T smart00663      198 HVIDGDVVLFNRQPTLH-----RMSIQAHRVRVLEGKTIRLN  234 (295)
T ss_pred             ehhcCCEEEEecCCccc-----cccceeEEEEEecCceEEec
Confidence            56789999998766543     23355667777788888884


No 122
>PRK10413 hydrogenase 2 accessory protein HypG; Provisional
Probab=20.29  E-value=79  Score=19.93  Aligned_cols=12  Identities=8%  Similarity=-0.180  Sum_probs=7.4

Q ss_pred             cccccCCEEEEE
Q 043519            3 RAYVVTSLRRKG   14 (130)
Q Consensus         3 Ptl~~gd~vlv~   14 (130)
                      |..+.||+|++.
T Consensus        41 ~~~~vGDyVLVH   52 (82)
T PRK10413         41 PADLLGQWVLVH   52 (82)
T ss_pred             cccccCCEEEEe
Confidence            345567777764


No 123
>PF06097 DUF945:  Bacterial protein of unknown function (DUF945);  InterPro: IPR010352 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=20.29  E-value=1.1e+02  Score=24.63  Aligned_cols=21  Identities=29%  Similarity=0.330  Sum_probs=16.5

Q ss_pred             CCCEEEE----eCCEEEECCEEccc
Q 043519           56 EGDVVEA----CEGKLIVNGVVRNK   76 (130)
Q Consensus        56 pGD~v~~----~~~~l~vng~~~~~   76 (130)
                      .|+.+..    ++|++.+||++++.
T Consensus       433 ~~~~~~~~~~~~~g~l~lNG~~ipl  457 (460)
T PF06097_consen  433 DGDNYVLELQLKNGQLTLNGQPIPL  457 (460)
T ss_pred             cCCEEEEEEEEECCEEEECCeECch
Confidence            6776654    69999999998764


No 124
>CHL00010 infA translation initiation factor 1
Probab=20.18  E-value=1.1e+02  Score=18.89  Aligned_cols=11  Identities=9%  Similarity=0.042  Sum_probs=9.5

Q ss_pred             CCCCcEEEEec
Q 043519           23 PFANDILIFKS   33 (130)
Q Consensus        23 ~~rGDiVvf~~   33 (130)
                      |..||.|.|..
T Consensus        47 ~~vGD~V~ve~   57 (78)
T CHL00010         47 ILPGDRVKVEL   57 (78)
T ss_pred             cCCCCEEEEEE
Confidence            67899999995


No 125
>PF13759 2OG-FeII_Oxy_5:  Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A.
Probab=20.09  E-value=69  Score=20.28  Aligned_cols=13  Identities=38%  Similarity=0.600  Sum_probs=8.8

Q ss_pred             CCCCCcEEEEecC
Q 043519           22 EPFANDILIFKSP   34 (130)
Q Consensus        22 ~~~rGDiVvf~~p   34 (130)
                      +|+.||+|+|.+-
T Consensus        69 ~p~~G~lvlFPs~   81 (101)
T PF13759_consen   69 EPEEGDLVLFPSW   81 (101)
T ss_dssp             ---TTEEEEEETT
T ss_pred             CCCCCEEEEeCCC
Confidence            5899999999863


Done!