BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043541
         (301 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1HYU|A Chain A, Crystal Structure Of Intact Ahpf
          Length = 521

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 263 FAKLVDSLLWISPH----AETLSIKYNDCDHEFSFQTIESL 299
           F  LV +LLW   H    A++L  +  D D +F F+T  SL
Sbjct: 87  FTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSL 127


>pdb|1ZYN|A Chain A, Oxidized Structure Of The N-Terminal Domain Of Salmonella
           Typhimurium Ahpf
 pdb|1ZYN|B Chain B, Oxidized Structure Of The N-Terminal Domain Of Salmonella
           Typhimurium Ahpf
 pdb|1ZYP|A Chain A, Synchrotron Reduced Form Of The N-Terminal Domain Of
           Salmonella Typhimurium Ahpf
 pdb|1ZYP|B Chain B, Synchrotron Reduced Form Of The N-Terminal Domain Of
           Salmonella Typhimurium Ahpf
          Length = 202

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 263 FAKLVDSLLWISPH----AETLSIKYNDCDHEFSFQTIESL 299
           F  LV +LLW   H    A++L  +  D D +F F+T  SL
Sbjct: 87  FTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSL 127


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,680,446
Number of Sequences: 62578
Number of extensions: 267446
Number of successful extensions: 688
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 687
Number of HSP's gapped (non-prelim): 7
length of query: 301
length of database: 14,973,337
effective HSP length: 98
effective length of query: 203
effective length of database: 8,840,693
effective search space: 1794660679
effective search space used: 1794660679
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)