Citrus Sinensis ID: 043602

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MWMMGYNDSGDSFNGRKLRPLIPRPLPTTTAINNNPSRIHGADFFGLNHHLGSHFGEQNKREFSSTPPVVVSSRWNPTPEQLRTLEDLYRRGTRTPSADQIQHITAQLRRFGKIEGKNVFYWFQNHKARERQKRRRQMESSPADHHHHNNNNNNLDIEIFKESAASKTGFEIEQTKNWAAPTNCSTLAEESVSAQRSTKVATAEYNRQGGWVQFDEAAVGEIQQQRQCFVERNATWQMMQYCSCPHQTAPTPTAMDQIQLIKGAHDLSIFISPYKENGHGFNNCLNHNIVNDEEDHGCGESQTLQLFPLRNGGSSDDGIDDNLGKATDVSVAAIDANNSNPCQFFEFLPLKN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccEEEccccHHHHHHHHHHHHcccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccEEcccccc
***************************************HGADFFGLNH****************************TPEQLRTLEDLYRRGTRTPSADQIQHITAQLRRFGKIEGKNVFYWFQNH***************************************************************************TAEYNRQGGWVQFDEAAVGEIQQQRQCFVERNATWQMMQYCSCPHQTAPTPTAMDQIQLIKGAHDLSIFISPYKEN********************C*******LF*********************VSVAAIDANNSNPCQFFEFLPLKN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWMMGYNDSGDSFNGRKLRPLIPRPLPTTTAINNNPSRIHGADFFGLNHHLGSHFGEQNKREFSSTPPVVVSSRWNPTPEQLRTLEDLYRRGTRTPSADQIQHITAQLRRFGKIEGKNVFYWFQNHKARERQKRRRQMESSPADHHHHNNNNNNLDIEIFKESAASKTGFEIEQTKNWAAPTNCSTLAEESVSAQRSTKVATAEYNRQGGWVQFDEAAVGEIQQQRQCFVERNATWQMMQYCSCPHQTAPTPTAMDQIQLIKGAHDLSIFISPYKENGHGFNNCLNHNIVNDEEDHGCGESQTLQLFPLRNGGSSDDGIDDNLGKATDVSVAAIDANNSNPCQFFEFLPLKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WUSCHEL-related homeobox 1 Transcription factor which may be involved in developmental processes.probableQ6X7K0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CUF, chain A
Confidence level:confident
Coverage over the Query: 69-136
View the alignment between query and template
View the model in PyMOL