BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>043621
MTSPPKPHQYSEYDKSGKPAKNHQPSNAELLSSAKLVADAAKDTLNSDHDKVDKTKVAHA
AGDLLNAGSRYGNSKTNPSGGHKDSGGVYEDYLKIAEGLIRKH

High Scoring Gene Products

Symbol, full name Information P value
NRP1
AT2G03440
protein from Arabidopsis thaliana 1.1e-09
AT1G13930 protein from Arabidopsis thaliana 2.9e-09
HES1
Transcription factor HES-1
protein from Bos taurus 0.00034
HES1
Transcription factor HES-1
protein from Homo sapiens 0.00034
HES1
Uncharacterized protein
protein from Sus scrofa 0.00034
Hes1
hairy and enhancer of split 1 (Drosophila)
gene from Rattus norvegicus 0.00034
Hes1
hairy and enhancer of split 1 (Drosophila)
protein from Mus musculus 0.00034
HES1
Transcription factor HES-1
protein from Bos taurus 0.00043

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  043621
        (103 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

TAIR|locus:2063788 - symbol:NRP1 "AT2G03440" species:3702...   140  1.1e-09   1
TAIR|locus:2035837 - symbol:AT1G13930 "AT1G13930" species...   136  2.9e-09   1
UNIPROTKB|Q3ZBG4 - symbol:HES1 "Transcription factor HES-...    78  0.00034   2
UNIPROTKB|Q14469 - symbol:HES1 "Transcription factor HES-...    78  0.00034   2
UNIPROTKB|I3LM61 - symbol:HES1 "Uncharacterized protein" ...    78  0.00034   2
RGD|62081 - symbol:Hes1 "hairy and enhancer of split 1 (D...    78  0.00034   2
MGI|MGI:104853 - symbol:Hes1 "hairy and enhancer of split...    78  0.00034   2
UNIPROTKB|G3N2D5 - symbol:HES1 "Transcription factor HES-...    78  0.00043   2


>TAIR|locus:2063788 [details] [associations]
            symbol:NRP1 "AT2G03440" species:3702 "Arabidopsis
            thaliana" [GO:0003674 "molecular_function" evidence=ND] [GO:0005575
            "cellular_component" evidence=ND] [GO:0009617 "response to
            bacterium" evidence=IEP] [GO:0009408 "response to heat"
            evidence=IEP;IMP] [GO:0009409 "response to cold" evidence=IEP]
            [GO:0009738 "abscisic acid mediated signaling pathway"
            evidence=IMP] GO:GO:0009617 EMBL:CP002685 GO:GO:0009738
            GO:GO:0009409 GO:GO:0009408 EMBL:AC006284 ProtClustDB:CLSN2683834
            EMBL:AY136477 IPI:IPI00533812 PIR:E84448 RefSeq:NP_178443.1
            UniGene:At.41393 UniGene:At.74000 STRING:Q9ZQ80 PRIDE:Q9ZQ80
            ProMEX:Q9ZQ80 EnsemblPlants:AT2G03440.1 GeneID:814873
            KEGG:ath:AT2G03440 InParanoid:Q9ZQ80 OMA:KMAQGFM
            ArrayExpress:Q9ZQ80 Genevestigator:Q9ZQ80 Uniprot:Q9ZQ80
        Length = 187

 Score = 140 (54.3 bits), Expect = 1.1e-09, P = 1.1e-09
 Identities = 39/92 (42%), Positives = 56/92 (60%)

Query:    18 KPAKN-----HQPS-NAELLSSAKLVADAAKDTLNSDHDKVDKTKVAHAAGDLLNAGSRY 71
             KP  N     H+P+ NAEL++SAK+VA+AA+     + DK+DK KVA A  D+L+A SRY
Sbjct:    50 KPVSNTDPTTHRPATNAELMASAKIVAEAAQAAARHESDKLDKAKVAGATADILDAASRY 109

Query:    72 GNSKTNPSGGHKDSGGVYEDYLKIAEGLIRKH 103
             G  K +      +  GV + YL+ AE  + K+
Sbjct:   110 G--KLD------EKSGVGQ-YLEKAEQYLHKY 132


>TAIR|locus:2035837 [details] [associations]
            symbol:AT1G13930 "AT1G13930" species:3702 "Arabidopsis
            thaliana" [GO:0003674 "molecular_function" evidence=ND] [GO:0009507
            "chloroplast" evidence=ISM;IDA] [GO:0009941 "chloroplast envelope"
            evidence=IDA] [GO:0005886 "plasma membrane" evidence=IDA]
            [GO:0009570 "chloroplast stroma" evidence=IDA] [GO:0046686
            "response to cadmium ion" evidence=IEP;RCA] [GO:0009651 "response
            to salt stress" evidence=RCA;IMP] [GO:0006096 "glycolysis"
            evidence=RCA] [GO:0006833 "water transport" evidence=RCA]
            [GO:0006972 "hyperosmotic response" evidence=RCA] [GO:0007030
            "Golgi organization" evidence=RCA] [GO:0009266 "response to
            temperature stimulus" evidence=RCA] [GO:0009611 "response to
            wounding" evidence=RCA] [GO:0009805 "coumarin biosynthetic process"
            evidence=RCA] [GO:0009963 "positive regulation of flavonoid
            biosynthetic process" evidence=RCA] [GO:0042744 "hydrogen peroxide
            catabolic process" evidence=RCA] EMBL:CP002684 GO:GO:0005886
            GO:GO:0046686 GO:GO:0009570 GO:GO:0009651 GO:GO:0009941
            EMBL:AC007576 EMBL:AC068197 UniGene:At.25532 UniGene:At.22637
            EMBL:AY045640 EMBL:AY058230 IPI:IPI00524841 PIR:D86272
            RefSeq:NP_001184989.1 RefSeq:NP_001184990.1 RefSeq:NP_563934.1
            UniGene:At.67684 STRING:Q9XI93 PRIDE:Q9XI93 ProMEX:Q9XI93
            EnsemblPlants:AT1G13930.1 EnsemblPlants:AT1G13930.2
            EnsemblPlants:AT1G13930.3 GeneID:837953 KEGG:ath:AT1G13930
            TAIR:At1g13930 InParanoid:Q9XI93 OMA:YESSHST PhylomeDB:Q9XI93
            ProtClustDB:CLSN2683834 Genevestigator:Q9XI93 Uniprot:Q9XI93
        Length = 155

 Score = 136 (52.9 bits), Expect = 2.9e-09, P = 2.9e-09
 Identities = 32/93 (34%), Positives = 53/93 (56%)

Query:     2 TSPPKPHQYSEYDKSGKPAKNHQPSNAELLSSAKLVADAAKDTLNSDHDKVDKTKVAHAA 61
             ++P +P      +  G        +NAEL++SAK+VA+AA+    ++ DK+DK KVA A+
Sbjct:    14 STPEEPDHNKPVE--GTETATRPATNAELMASAKVVAEAAQAAARNESDKLDKGKVAGAS 71

Query:    62 GDLLNAGSRYGN-SKTNPSGGHKDSGGVY-EDY 92
              D+L+A  +YG   + + +G + D    Y  DY
Sbjct:    72 ADILDAAEKYGKFDEKSSTGQYLDKAEKYLNDY 104


>UNIPROTKB|Q3ZBG4 [details] [associations]
            symbol:HES1 "Transcription factor HES-1" species:9913 "Bos
            taurus" [GO:0021861 "forebrain radial glial cell differentiation"
            evidence=ISS] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=ISS] [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=ISS]
            [GO:0043565 "sequence-specific DNA binding" evidence=ISS]
            [GO:2000978 "negative regulation of forebrain neuron
            differentiation" evidence=ISS] [GO:0046427 "positive regulation of
            JAK-STAT cascade" evidence=ISS] [GO:0043388 "positive regulation of
            DNA binding" evidence=ISS] [GO:0007262 "STAT protein import into
            nucleus" evidence=ISS] [GO:0071820 "N-box binding" evidence=ISS]
            [GO:0001078 "RNA polymerase II core promoter proximal region
            sequence-specific DNA binding transcription factor activity
            involved in negative regulation of transcription" evidence=ISS]
            [GO:0042517 "positive regulation of tyrosine phosphorylation of
            Stat3 protein" evidence=ISS] [GO:0006461 "protein complex assembly"
            evidence=ISS] [GO:0042803 "protein homodimerization activity"
            evidence=ISS] [GO:2000974 "negative regulation of pro-B cell
            differentiation" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS]
            [GO:0060253 "negative regulation of glial cell proliferation"
            evidence=ISS] [GO:0048715 "negative regulation of oligodendrocyte
            differentiation" evidence=ISS] [GO:0048711 "positive regulation of
            astrocyte differentiation" evidence=ISS] InterPro:IPR003650
            InterPro:IPR011598 Pfam:PF00010 Pfam:PF07527 PROSITE:PS50888
            PROSITE:PS51054 SMART:SM00353 GO:GO:0005634 GO:GO:0042803
            GO:GO:0006461 GO:GO:0001078 GO:GO:0043565 Gene3D:4.10.280.10
            SUPFAM:SSF47459 GO:GO:0042517 InterPro:IPR018352 SMART:SM00511
            GO:GO:0048711 GO:GO:0048715 GO:GO:0043388 eggNOG:NOG319418
            GO:GO:0007262 GO:GO:0060253 GO:GO:0021861
            GeneTree:ENSGT00700000104168 KO:K06054 EMBL:BC103309
            IPI:IPI00694289 RefSeq:NP_001029850.1 UniGene:Bt.49417
            ProteinModelPortal:Q3ZBG4 STRING:Q3ZBG4 PRIDE:Q3ZBG4
            Ensembl:ENSBTAT00000000742 GeneID:539547 KEGG:bta:539547 CTD:3280
            HOGENOM:HOG000236346 HOVERGEN:HBG005960 InParanoid:Q3ZBG4
            OrthoDB:EOG4TTGK6 NextBio:20878064 GO:GO:0071820 GO:GO:2000978
            GO:GO:2000974 Uniprot:Q3ZBG4
        Length = 280

 Score = 78 (32.5 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:     2 TSPPKPHQYSEYDKSGKPA--KNHQPSNAELLSSAK-LVADAAKDTLNSDHDKVDKTKV 57
             T+P KP   SE+ KS KP   K  +    E LS  K L+ DA K   +S H K++K  +
Sbjct:    23 TTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKD-SSRHSKLEKADI 80

 Score = 34 (17.0 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 6/16 (37%), Positives = 10/16 (62%)

Query:    66 NAGSRYGNSKTNPSGG 81
             N+G+  G +  +PS G
Sbjct:   251 NSGTSVGPNAVSPSSG 266


>UNIPROTKB|Q14469 [details] [associations]
            symbol:HES1 "Transcription factor HES-1" species:9606 "Homo
            sapiens" [GO:0001889 "liver development" evidence=IEA] [GO:0005737
            "cytoplasm" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA]
            [GO:0007224 "smoothened signaling pathway" evidence=IEA]
            [GO:0016477 "cell migration" evidence=IEA] [GO:0021537
            "telencephalon development" evidence=IEA] [GO:0021555
            "midbrain-hindbrain boundary morphogenesis" evidence=IEA]
            [GO:0021557 "oculomotor nerve development" evidence=IEA]
            [GO:0021558 "trochlear nerve development" evidence=IEA] [GO:0021575
            "hindbrain morphogenesis" evidence=IEA] [GO:0021984
            "adenohypophysis development" evidence=IEA] [GO:0030324 "lung
            development" evidence=IEA] [GO:0030513 "positive regulation of BMP
            signaling pathway" evidence=IEA] [GO:0030901 "midbrain development"
            evidence=IEA] [GO:0035019 "somatic stem cell maintenance"
            evidence=IEA] [GO:0042102 "positive regulation of T cell
            proliferation" evidence=IEA] [GO:0042668 "auditory receptor cell
            fate determination" evidence=IEA] [GO:0045598 "regulation of fat
            cell differentiation" evidence=IEA] [GO:0045608 "negative
            regulation of auditory receptor cell differentiation" evidence=IEA]
            [GO:0045747 "positive regulation of Notch signaling pathway"
            evidence=IEA] [GO:0046331 "lateral inhibition" evidence=IEA]
            [GO:0048469 "cell maturation" evidence=IEA] [GO:0048667 "cell
            morphogenesis involved in neuron differentiation" evidence=IEA]
            [GO:0060164 "regulation of timing of neuron differentiation"
            evidence=IEA] [GO:0060675 "ureteric bud morphogenesis"
            evidence=IEA] [GO:0060716 "labyrinthine layer blood vessel
            development" evidence=IEA] [GO:0061009 "common bile duct
            development" evidence=IEA] [GO:0061106 "negative regulation of
            stomach neuroendocrine cell differentiation" evidence=IEA]
            [GO:0072012 "glomerulus vasculature development" evidence=IEA]
            [GO:0072049 "comma-shaped body morphogenesis" evidence=IEA]
            [GO:0072050 "S-shaped body morphogenesis" evidence=IEA] [GO:0072141
            "renal interstitial cell development" evidence=IEA] [GO:0072282
            "metanephric nephron tubule morphogenesis" evidence=IEA]
            [GO:0090102 "cochlea development" evidence=IEA] [GO:2000227
            "negative regulation of pancreatic A cell differentiation"
            evidence=IEA] [GO:0007219 "Notch signaling pathway"
            evidence=IMP;IDA;TAS] [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IDA] [GO:0048711 "positive
            regulation of astrocyte differentiation" evidence=ISS] [GO:0048715
            "negative regulation of oligodendrocyte differentiation"
            evidence=ISS] [GO:0060253 "negative regulation of glial cell
            proliferation" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS]
            [GO:2000974 "negative regulation of pro-B cell differentiation"
            evidence=IMP] [GO:0000122 "negative regulation of transcription
            from RNA polymerase II promoter" evidence=IDA] [GO:0042803 "protein
            homodimerization activity" evidence=ISS] [GO:0006461 "protein
            complex assembly" evidence=ISS] [GO:0042517 "positive regulation of
            tyrosine phosphorylation of Stat3 protein" evidence=ISS]
            [GO:0001078 "RNA polymerase II core promoter proximal region
            sequence-specific DNA binding transcription factor activity
            involved in negative regulation of transcription" evidence=ISS]
            [GO:0071820 "N-box binding" evidence=ISS] [GO:0007262 "STAT protein
            import into nucleus" evidence=ISS] [GO:0043388 "positive regulation
            of DNA binding" evidence=ISS] [GO:0046427 "positive regulation of
            JAK-STAT cascade" evidence=ISS] [GO:2000978 "negative regulation of
            forebrain neuron differentiation" evidence=ISS] [GO:0043565
            "sequence-specific DNA binding" evidence=ISS] [GO:0021861
            "forebrain radial glial cell differentiation" evidence=ISS]
            [GO:0097150 "neuronal stem cell maintenance" evidence=IEP]
            [GO:2000737 "negative regulation of stem cell differentiation"
            evidence=IMP] [GO:0008134 "transcription factor binding"
            evidence=NAS] [GO:0003677 "DNA binding" evidence=TAS] [GO:0007399
            "nervous system development" evidence=TAS] [GO:0031018 "endocrine
            pancreas development" evidence=TAS] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0042826 "histone deacetylase binding"
            evidence=IPI] [GO:0045892 "negative regulation of transcription,
            DNA-dependent" evidence=IDA] [GO:0003143 "embryonic heart tube
            morphogenesis" evidence=ISS] [GO:0035910 "ascending aorta
            morphogenesis" evidence=ISS] [GO:0045977 "positive regulation of
            mitotic cell cycle, embryonic" evidence=ISS] [GO:0060412
            "ventricular septum morphogenesis" evidence=ISS] [GO:0003266
            "regulation of secondary heart field cardioblast proliferation"
            evidence=ISS] [GO:0061309 "cardiac neural crest cell development
            involved in outflow tract morphogenesis" evidence=ISS] [GO:0003151
            "outflow tract morphogenesis" evidence=ISS] [GO:0003281
            "ventricular septum development" evidence=ISS] [GO:0008284
            "positive regulation of cell proliferation" evidence=ISS]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=ISS] [GO:0048538 "thymus
            development" evidence=ISS] [GO:0048844 "artery morphogenesis"
            evidence=ISS] [GO:0060037 "pharyngeal system development"
            evidence=ISS] [GO:0097084 "vascular smooth muscle cell development"
            evidence=ISS] InterPro:IPR003650 InterPro:IPR011598 Pfam:PF00010
            Pfam:PF07527 PROSITE:PS50888 PROSITE:PS51054 SMART:SM00353
            GO:GO:0005634 GO:GO:0005737 Reactome:REACT_111045
            Reactome:REACT_111102 GO:GO:0042803 GO:GO:0016477 GO:GO:0006461
            GO:GO:0030324 GO:GO:0008284 GO:GO:0001078 GO:GO:0043565
            GO:GO:0001701 GO:GO:0045944 GO:GO:0007155 GO:GO:0007219
            GO:GO:0001889 GO:GO:0045747 GO:GO:0030901 GO:GO:0030513
            GO:GO:0003143 GO:GO:0060037 GO:GO:0042102 GO:GO:0097084
            GO:GO:0046331 GO:GO:0048538 GO:GO:0035019 Gene3D:4.10.280.10
            SUPFAM:SSF47459 GO:GO:0008134 GO:GO:0031018 GO:GO:0045598
            GO:GO:0072012 GO:GO:0003151 GO:GO:0007224 GO:GO:0042517
            GO:GO:0021984 GO:GO:0021575 GO:GO:0090102 GO:GO:0042668
            GO:GO:0048469 InterPro:IPR018352 SMART:SM00511 GO:GO:0048711
            GO:GO:0021537 GO:GO:0060675 GO:GO:0048715 GO:GO:0043388
            GO:GO:0060412 GO:GO:0003266 GO:GO:0045608 GO:GO:0097150
            eggNOG:NOG319418 GO:GO:0048667 GO:GO:0007262 CleanEx:HS_HES1
            GO:GO:0060253 GO:GO:0021555 GO:GO:0021861 GO:GO:0061309 KO:K06054
            CTD:3280 HOGENOM:HOG000236346 HOVERGEN:HBG005960 OrthoDB:EOG4TTGK6
            GO:GO:0071820 GO:GO:2000978 GO:GO:2000974 EMBL:L19314 EMBL:AF264785
            EMBL:AK000415 EMBL:CR541843 IPI:IPI00030964 PIR:A53027
            RefSeq:NP_005515.1 UniGene:Hs.250666 ProteinModelPortal:Q14469
            SMR:Q14469 IntAct:Q14469 STRING:Q14469 PhosphoSite:Q14469
            DMDM:3913825 PRIDE:Q14469 DNASU:3280 Ensembl:ENST00000232424
            GeneID:3280 KEGG:hsa:3280 UCSC:uc003ftq.2 GeneCards:GC03P193853
            HGNC:HGNC:5192 MIM:139605 neXtProt:NX_Q14469 PharmGKB:PA29465
            InParanoid:Q14469 OMA:TKVYGGF PhylomeDB:Q14469 GenomeRNAi:3280
            NextBio:13023 ArrayExpress:Q14469 Bgee:Q14469 Genevestigator:Q14469
            GermOnline:ENSG00000114315 GO:GO:0035910 GO:GO:0072049
            GO:GO:0061009 GO:GO:0072282 GO:GO:2000227 GO:GO:2000737
            GO:GO:0061106 GO:GO:0021557 GO:GO:0045977 GO:GO:0060164
            GO:GO:0072141 GO:GO:0072050 GO:GO:0021558 Uniprot:Q14469
        Length = 280

 Score = 78 (32.5 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:     2 TSPPKPHQYSEYDKSGKPA--KNHQPSNAELLSSAK-LVADAAKDTLNSDHDKVDKTKV 57
             T+P KP   SE+ KS KP   K  +    E LS  K L+ DA K   +S H K++K  +
Sbjct:    23 TTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKD-SSRHSKLEKADI 80

 Score = 34 (17.0 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 6/16 (37%), Positives = 10/16 (62%)

Query:    66 NAGSRYGNSKTNPSGG 81
             N+G+  G +  +PS G
Sbjct:   251 NSGTSVGPNAVSPSSG 266


>UNIPROTKB|I3LM61 [details] [associations]
            symbol:HES1 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:2000974 "negative regulation of pro-B cell
            differentiation" evidence=IEA] [GO:2000737 "negative regulation of
            stem cell differentiation" evidence=IEA] [GO:2000227 "negative
            regulation of pancreatic A cell differentiation" evidence=IEA]
            [GO:0097150 "neuronal stem cell maintenance" evidence=IEA]
            [GO:0097084 "vascular smooth muscle cell development" evidence=IEA]
            [GO:0090102 "cochlea development" evidence=IEA] [GO:0072282
            "metanephric nephron tubule morphogenesis" evidence=IEA]
            [GO:0072141 "renal interstitial cell development" evidence=IEA]
            [GO:0072050 "S-shaped body morphogenesis" evidence=IEA] [GO:0072049
            "comma-shaped body morphogenesis" evidence=IEA] [GO:0072012
            "glomerulus vasculature development" evidence=IEA] [GO:0071820
            "N-box binding" evidence=IEA] [GO:0061309 "cardiac neural crest
            cell development involved in outflow tract morphogenesis"
            evidence=IEA] [GO:0061106 "negative regulation of stomach
            neuroendocrine cell differentiation" evidence=IEA] [GO:0061009
            "common bile duct development" evidence=IEA] [GO:0060716
            "labyrinthine layer blood vessel development" evidence=IEA]
            [GO:0060675 "ureteric bud morphogenesis" evidence=IEA] [GO:0060412
            "ventricular septum morphogenesis" evidence=IEA] [GO:0060253
            "negative regulation of glial cell proliferation" evidence=IEA]
            [GO:0060164 "regulation of timing of neuron differentiation"
            evidence=IEA] [GO:0060037 "pharyngeal system development"
            evidence=IEA] [GO:0048715 "negative regulation of oligodendrocyte
            differentiation" evidence=IEA] [GO:0048711 "positive regulation of
            astrocyte differentiation" evidence=IEA] [GO:0048667 "cell
            morphogenesis involved in neuron differentiation" evidence=IEA]
            [GO:0048538 "thymus development" evidence=IEA] [GO:0048469 "cell
            maturation" evidence=IEA] [GO:0046331 "lateral inhibition"
            evidence=IEA] [GO:0045977 "positive regulation of mitotic cell
            cycle, embryonic" evidence=IEA] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0045747 "positive regulation of Notch signaling pathway"
            evidence=IEA] [GO:0045608 "negative regulation of auditory receptor
            cell differentiation" evidence=IEA] [GO:0045598 "regulation of fat
            cell differentiation" evidence=IEA] [GO:0043388 "positive
            regulation of DNA binding" evidence=IEA] [GO:0042826 "histone
            deacetylase binding" evidence=IEA] [GO:0042803 "protein
            homodimerization activity" evidence=IEA] [GO:0042668 "auditory
            receptor cell fate determination" evidence=IEA] [GO:0042517
            "positive regulation of tyrosine phosphorylation of Stat3 protein"
            evidence=IEA] [GO:0042102 "positive regulation of T cell
            proliferation" evidence=IEA] [GO:0035910 "ascending aorta
            morphogenesis" evidence=IEA] [GO:0035019 "somatic stem cell
            maintenance" evidence=IEA] [GO:0031016 "pancreas development"
            evidence=IEA] [GO:0030901 "midbrain development" evidence=IEA]
            [GO:0030513 "positive regulation of BMP signaling pathway"
            evidence=IEA] [GO:0030324 "lung development" evidence=IEA]
            [GO:0021984 "adenohypophysis development" evidence=IEA] [GO:0021575
            "hindbrain morphogenesis" evidence=IEA] [GO:0021558 "trochlear
            nerve development" evidence=IEA] [GO:0021557 "oculomotor nerve
            development" evidence=IEA] [GO:0021555 "midbrain-hindbrain boundary
            morphogenesis" evidence=IEA] [GO:0021537 "telencephalon
            development" evidence=IEA] [GO:0016477 "cell migration"
            evidence=IEA] [GO:0007262 "STAT protein import into nucleus"
            evidence=IEA] [GO:0007224 "smoothened signaling pathway"
            evidence=IEA] [GO:0007219 "Notch signaling pathway" evidence=IEA]
            [GO:0007155 "cell adhesion" evidence=IEA] [GO:0006461 "protein
            complex assembly" evidence=IEA] [GO:0005737 "cytoplasm"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0003266
            "regulation of secondary heart field cardioblast proliferation"
            evidence=IEA] [GO:0003143 "embryonic heart tube morphogenesis"
            evidence=IEA] [GO:0001889 "liver development" evidence=IEA]
            [GO:0001078 "RNA polymerase II core promoter proximal region
            sequence-specific DNA binding transcription factor activity
            involved in negative regulation of transcription" evidence=IEA]
            InterPro:IPR003650 InterPro:IPR011598 Pfam:PF00010 Pfam:PF07527
            PROSITE:PS50888 PROSITE:PS51054 SMART:SM00353 GO:GO:0005634
            GO:GO:0005737 GO:GO:0016477 GO:GO:0006461 GO:GO:0030324
            GO:GO:0001078 GO:GO:0001701 GO:GO:0045944 GO:GO:0007155
            GO:GO:0007219 GO:GO:0001889 GO:GO:0045747 GO:GO:0030901
            GO:GO:0030513 GO:GO:0060037 GO:GO:0042102 GO:GO:0097084
            GO:GO:0046331 GO:GO:0048538 GO:GO:0035019 Gene3D:4.10.280.10
            SUPFAM:SSF47459 GO:GO:0031016 GO:GO:0045598 GO:GO:0048844
            GO:GO:0072012 GO:GO:0003151 GO:GO:0007224 GO:GO:0042517
            GO:GO:0021984 GO:GO:0021575 GO:GO:0090102 GO:GO:0042668
            GO:GO:0048469 InterPro:IPR018352 SMART:SM00511 GO:GO:0048711
            GO:GO:0021537 GO:GO:0060675 GO:GO:0048715 GO:GO:0043388
            GO:GO:0003281 GO:GO:0003266 GO:GO:0045608 GO:GO:0097150
            GO:GO:0048667 GO:GO:0007262 GO:GO:0060253 GO:GO:0021555
            GeneTree:ENSGT00700000104168 GO:GO:0061309 GO:GO:0071820
            GO:GO:2000974 OMA:TKVYGGF GO:GO:0072049 GO:GO:0061009 GO:GO:0072282
            GO:GO:2000227 GO:GO:2000737 GO:GO:0061106 GO:GO:0021557
            GO:GO:0060164 GO:GO:0072141 GO:GO:0072050 GO:GO:0021558
            EMBL:FP565159 ProteinModelPortal:I3LM61 PRIDE:I3LM61
            Ensembl:ENSSSCT00000026743 Uniprot:I3LM61
        Length = 280

 Score = 78 (32.5 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:     2 TSPPKPHQYSEYDKSGKPA--KNHQPSNAELLSSAK-LVADAAKDTLNSDHDKVDKTKV 57
             T+P KP   SE+ KS KP   K  +    E LS  K L+ DA K   +S H K++K  +
Sbjct:    23 TTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKD-SSRHSKLEKADI 80

 Score = 34 (17.0 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 6/16 (37%), Positives = 10/16 (62%)

Query:    66 NAGSRYGNSKTNPSGG 81
             N+G+  G +  +PS G
Sbjct:   251 NSGTSVGPNAVSPSSG 266


>RGD|62081 [details] [associations]
            symbol:Hes1 "hairy and enhancer of split 1 (Drosophila)"
           species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation
           of transcription from RNA polymerase II promoter"
           evidence=ISO;IDA;IMP] [GO:0000981 "sequence-specific DNA binding RNA
           polymerase II transcription factor activity" evidence=ISO]
           [GO:0001078 "RNA polymerase II core promoter proximal region
           sequence-specific DNA binding transcription factor activity involved
           in negative regulation of transcription" evidence=ISO;ISS]
           [GO:0001701 "in utero embryonic development" evidence=ISO]
           [GO:0001889 "liver development" evidence=ISO] [GO:0003143 "embryonic
           heart tube morphogenesis" evidence=ISO] [GO:0003151 "outflow tract
           morphogenesis" evidence=ISO] [GO:0003266 "regulation of secondary
           heart field cardioblast proliferation" evidence=ISO] [GO:0003281
           "ventricular septum development" evidence=ISO] [GO:0003677 "DNA
           binding" evidence=IEA;ISO] [GO:0003700 "sequence-specific DNA
           binding transcription factor activity" evidence=ISO] [GO:0005515
           "protein binding" evidence=IPI] [GO:0005622 "intracellular"
           evidence=ISO] [GO:0005634 "nucleus" evidence=IEA;ISO;ISS]
           [GO:0005654 "nucleoplasm" evidence=TAS] [GO:0005737 "cytoplasm"
           evidence=ISO] [GO:0006351 "transcription, DNA-dependent"
           evidence=IEA] [GO:0006355 "regulation of transcription,
           DNA-dependent" evidence=IEA] [GO:0006357 "regulation of
           transcription from RNA polymerase II promoter" evidence=ISO]
           [GO:0006461 "protein complex assembly" evidence=ISO;ISS] [GO:0007155
           "cell adhesion" evidence=ISO] [GO:0007219 "Notch signaling pathway"
           evidence=ISO] [GO:0007224 "smoothened signaling pathway"
           evidence=ISO] [GO:0007262 "STAT protein import into nucleus"
           evidence=ISO;ISS] [GO:0007389 "pattern specification process"
           evidence=ISO] [GO:0008284 "positive regulation of cell
           proliferation" evidence=ISO] [GO:0016477 "cell migration"
           evidence=ISO] [GO:0021537 "telencephalon development" evidence=ISO]
           [GO:0021555 "midbrain-hindbrain boundary morphogenesis"
           evidence=ISO] [GO:0021557 "oculomotor nerve development"
           evidence=ISO] [GO:0021558 "trochlear nerve development"
           evidence=ISO] [GO:0021575 "hindbrain morphogenesis" evidence=ISO]
           [GO:0021861 "forebrain radial glial cell differentiation"
           evidence=IDA] [GO:0021915 "neural tube development" evidence=ISO]
           [GO:0021983 "pituitary gland development" evidence=ISO] [GO:0021984
           "adenohypophysis development" evidence=ISO] [GO:0030324 "lung
           development" evidence=ISO] [GO:0030513 "positive regulation of BMP
           signaling pathway" evidence=ISO] [GO:0030901 "midbrain development"
           evidence=ISO] [GO:0031016 "pancreas development" evidence=ISO]
           [GO:0035019 "somatic stem cell maintenance" evidence=ISO]
           [GO:0035909 "aorta morphogenesis" evidence=ISO] [GO:0035910
           "ascending aorta morphogenesis" evidence=ISO] [GO:0042102 "positive
           regulation of T cell proliferation" evidence=ISO] [GO:0042491
           "auditory receptor cell differentiation" evidence=ISO] [GO:0042517
           "positive regulation of tyrosine phosphorylation of Stat3 protein"
           evidence=ISO;ISS] [GO:0042668 "auditory receptor cell fate
           determination" evidence=ISO] [GO:0042803 "protein homodimerization
           activity" evidence=ISO;ISS] [GO:0042826 "histone deacetylase
           binding" evidence=ISO] [GO:0043388 "positive regulation of DNA
           binding" evidence=ISO;ISS] [GO:0043565 "sequence-specific DNA
           binding" evidence=IDA] [GO:0045165 "cell fate commitment"
           evidence=ISO] [GO:0045596 "negative regulation of cell
           differentiation" evidence=ISO] [GO:0045598 "regulation of fat cell
           differentiation" evidence=ISO] [GO:0045608 "negative regulation of
           auditory receptor cell differentiation" evidence=ISO] [GO:0045665
           "negative regulation of neuron differentiation" evidence=ISO]
           [GO:0045747 "positive regulation of Notch signaling pathway"
           evidence=ISO] [GO:0045892 "negative regulation of transcription,
           DNA-dependent" evidence=ISO;IDA] [GO:0045893 "positive regulation of
           transcription, DNA-dependent" evidence=ISO] [GO:0045944 "positive
           regulation of transcription from RNA polymerase II promoter"
           evidence=ISO] [GO:0045977 "positive regulation of mitotic cell
           cycle, embryonic" evidence=ISO] [GO:0046331 "lateral inhibition"
           evidence=ISO] [GO:0046427 "positive regulation of JAK-STAT cascade"
           evidence=ISO;ISS] [GO:0046983 "protein dimerization activity"
           evidence=IEA] [GO:0048469 "cell maturation" evidence=ISO]
           [GO:0048505 "regulation of timing of cell differentiation"
           evidence=ISO] [GO:0048538 "thymus development" evidence=ISO]
           [GO:0048667 "cell morphogenesis involved in neuron differentiation"
           evidence=ISO] [GO:0048711 "positive regulation of astrocyte
           differentiation" evidence=ISO;ISS] [GO:0048715 "negative regulation
           of oligodendrocyte differentiation" evidence=ISO;ISS] [GO:0048844
           "artery morphogenesis" evidence=ISO] [GO:0050767 "regulation of
           neurogenesis" evidence=ISO] [GO:0060037 "pharyngeal system
           development" evidence=ISO] [GO:0060164 "regulation of timing of
           neuron differentiation" evidence=ISO] [GO:0060253 "negative
           regulation of glial cell proliferation" evidence=ISO;ISS]
           [GO:0060412 "ventricular septum morphogenesis" evidence=ISO]
           [GO:0060716 "labyrinthine layer blood vessel development"
           evidence=ISO] [GO:0061009 "common bile duct development"
           evidence=ISO] [GO:0061106 "negative regulation of stomach
           neuroendocrine cell differentiation" evidence=ISO] [GO:0061309
           "cardiac neural crest cell development involved in outflow tract
           morphogenesis" evidence=ISO] [GO:0071820 "N-box binding"
           evidence=ISO;ISS] [GO:0090102 "cochlea development" evidence=ISO]
           [GO:0097084 "vascular smooth muscle cell development" evidence=ISO]
           [GO:0097150 "neuronal stem cell maintenance" evidence=ISO;IDA]
           [GO:2000227 "negative regulation of pancreatic A cell
           differentiation" evidence=ISO] [GO:2000737 "negative regulation of
           stem cell differentiation" evidence=ISO] [GO:2000974 "negative
           regulation of pro-B cell differentiation" evidence=ISO;ISS]
           [GO:2000978 "negative regulation of forebrain neuron
           differentiation" evidence=IDA] [GO:2000981 "negative regulation of
           inner ear receptor cell differentiation" evidence=ISO]
           InterPro:IPR003650 InterPro:IPR011598 Pfam:PF00010 Pfam:PF07527
           PROSITE:PS50888 PROSITE:PS51054 SMART:SM00353 RGD:62081
           GO:GO:0042803 GO:GO:0005654 GO:GO:0006461 GO:GO:0001078
           GO:GO:0043565 Gene3D:4.10.280.10 SUPFAM:SSF47459 GO:GO:0042517
           InterPro:IPR018352 SMART:SM00511 GO:GO:0048711 GO:GO:0048715
           GO:GO:0043388 GO:GO:0097150 eggNOG:NOG319418 GO:GO:0007262
           GO:GO:0060253 GO:GO:0021861 KO:K06054 CTD:3280 HOVERGEN:HBG005960
           GO:GO:0071820 GO:GO:2000978 GO:GO:2000974 EMBL:D13417 EMBL:L04527
           EMBL:BC061730 IPI:IPI00188114 PIR:S36748 RefSeq:NP_077336.3
           UniGene:Rn.19727 ProteinModelPortal:Q04666 STRING:Q04666
           PhosphoSite:Q04666 GeneID:29577 KEGG:rno:29577 UCSC:RGD:62081
           NextBio:609674 Genevestigator:Q04666 Uniprot:Q04666
        Length = 281

 Score = 78 (32.5 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:     2 TSPPKPHQYSEYDKSGKPA--KNHQPSNAELLSSAK-LVADAAKDTLNSDHDKVDKTKV 57
             T+P KP   SE+ KS KP   K  +    E LS  K L+ DA K   +S H K++K  +
Sbjct:    23 TTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKD-SSRHSKLEKADI 80

 Score = 34 (17.0 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 6/16 (37%), Positives = 10/16 (62%)

Query:    66 NAGSRYGNSKTNPSGG 81
             N+G+  G +  +PS G
Sbjct:   252 NSGTSVGPNAVSPSSG 267


>MGI|MGI:104853 [details] [associations]
            symbol:Hes1 "hairy and enhancer of split 1 (Drosophila)"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter"
            evidence=ISO;IGI;IMP;IDA] [GO:0000981 "sequence-specific DNA
            binding RNA polymerase II transcription factor activity"
            evidence=IDA] [GO:0001078 "RNA polymerase II core promoter proximal
            region sequence-specific DNA binding transcription factor activity
            involved in negative regulation of transcription" evidence=IDA]
            [GO:0001701 "in utero embryonic development" evidence=IGI]
            [GO:0001889 "liver development" evidence=IMP] [GO:0003143
            "embryonic heart tube morphogenesis" evidence=IMP] [GO:0003151
            "outflow tract morphogenesis" evidence=IMP] [GO:0003266 "regulation
            of secondary heart field cardioblast proliferation" evidence=IMP]
            [GO:0003281 "ventricular septum development" evidence=IMP]
            [GO:0003677 "DNA binding" evidence=IDA] [GO:0003700
            "sequence-specific DNA binding transcription factor activity"
            evidence=ISO] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005622 "intracellular" evidence=IDA] [GO:0005634 "nucleus"
            evidence=IDA] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0006351
            "transcription, DNA-dependent" evidence=IEA] [GO:0006355
            "regulation of transcription, DNA-dependent" evidence=IEA]
            [GO:0006357 "regulation of transcription from RNA polymerase II
            promoter" evidence=IGI] [GO:0006461 "protein complex assembly"
            evidence=IDA] [GO:0007155 "cell adhesion" evidence=IGI] [GO:0007219
            "Notch signaling pathway" evidence=ISO;NAS;TAS] [GO:0007224
            "smoothened signaling pathway" evidence=IDA] [GO:0007262 "STAT
            protein import into nucleus" evidence=IDA] [GO:0007389 "pattern
            specification process" evidence=IGI;IMP] [GO:0008134 "transcription
            factor binding" evidence=NAS] [GO:0008284 "positive regulation of
            cell proliferation" evidence=IMP] [GO:0016477 "cell migration"
            evidence=IGI] [GO:0021537 "telencephalon development"
            evidence=IGI;IMP] [GO:0021555 "midbrain-hindbrain boundary
            morphogenesis" evidence=IGI] [GO:0021557 "oculomotor nerve
            development" evidence=IGI] [GO:0021558 "trochlear nerve
            development" evidence=IGI] [GO:0021575 "hindbrain morphogenesis"
            evidence=IGI] [GO:0021861 "forebrain radial glial cell
            differentiation" evidence=ISO] [GO:0021915 "neural tube
            development" evidence=IGI] [GO:0021983 "pituitary gland
            development" evidence=IGI;IMP] [GO:0021984 "adenohypophysis
            development" evidence=IMP] [GO:0030324 "lung development"
            evidence=IMP] [GO:0030513 "positive regulation of BMP signaling
            pathway" evidence=IGI] [GO:0030901 "midbrain development"
            evidence=IGI] [GO:0031016 "pancreas development" evidence=IMP]
            [GO:0035019 "somatic stem cell maintenance" evidence=IMP]
            [GO:0035909 "aorta morphogenesis" evidence=IMP] [GO:0035910
            "ascending aorta morphogenesis" evidence=IMP] [GO:0042102 "positive
            regulation of T cell proliferation" evidence=IMP] [GO:0042491
            "auditory receptor cell differentiation" evidence=IMP] [GO:0042517
            "positive regulation of tyrosine phosphorylation of Stat3 protein"
            evidence=IDA] [GO:0042668 "auditory receptor cell fate
            determination" evidence=IMP] [GO:0042803 "protein homodimerization
            activity" evidence=IDA] [GO:0042826 "histone deacetylase binding"
            evidence=ISO] [GO:0043388 "positive regulation of DNA binding"
            evidence=IDA] [GO:0043565 "sequence-specific DNA binding"
            evidence=ISO] [GO:0045165 "cell fate commitment" evidence=IMP]
            [GO:0045596 "negative regulation of cell differentiation"
            evidence=IMP] [GO:0045598 "regulation of fat cell differentiation"
            evidence=IMP] [GO:0045608 "negative regulation of auditory receptor
            cell differentiation" evidence=IMP] [GO:0045665 "negative
            regulation of neuron differentiation" evidence=IGI;IMP] [GO:0045747
            "positive regulation of Notch signaling pathway" evidence=IMP]
            [GO:0045892 "negative regulation of transcription, DNA-dependent"
            evidence=ISO;IMP] [GO:0045893 "positive regulation of
            transcription, DNA-dependent" evidence=IMP] [GO:0045944 "positive
            regulation of transcription from RNA polymerase II promoter"
            evidence=IGI;IMP] [GO:0045977 "positive regulation of mitotic cell
            cycle, embryonic" evidence=IMP] [GO:0046331 "lateral inhibition"
            evidence=IMP] [GO:0046427 "positive regulation of JAK-STAT cascade"
            evidence=IDA] [GO:0046983 "protein dimerization activity"
            evidence=IEA] [GO:0048469 "cell maturation" evidence=IGI]
            [GO:0048505 "regulation of timing of cell differentiation"
            evidence=IMP] [GO:0048538 "thymus development" evidence=IMP]
            [GO:0048667 "cell morphogenesis involved in neuron differentiation"
            evidence=IGI] [GO:0048711 "positive regulation of astrocyte
            differentiation" evidence=IDA] [GO:0048715 "negative regulation of
            oligodendrocyte differentiation" evidence=IDA] [GO:0048844 "artery
            morphogenesis" evidence=IMP] [GO:0050767 "regulation of
            neurogenesis" evidence=IGI] [GO:0060037 "pharyngeal system
            development" evidence=IMP] [GO:0060164 "regulation of timing of
            neuron differentiation" evidence=IGI;IMP] [GO:0060253 "negative
            regulation of glial cell proliferation" evidence=IDA] [GO:0060412
            "ventricular septum morphogenesis" evidence=IMP] [GO:0060716
            "labyrinthine layer blood vessel development" evidence=IMP]
            [GO:0061009 "common bile duct development" evidence=IMP]
            [GO:0061106 "negative regulation of stomach neuroendocrine cell
            differentiation" evidence=IMP] [GO:0061309 "cardiac neural crest
            cell development involved in outflow tract morphogenesis"
            evidence=IMP] [GO:0071820 "N-box binding" evidence=IDA] [GO:0090102
            "cochlea development" evidence=IGI;IMP] [GO:0097084 "vascular
            smooth muscle cell development" evidence=IMP] [GO:0097150 "neuronal
            stem cell maintenance" evidence=ISO;IMP] [GO:2000227 "negative
            regulation of pancreatic A cell differentiation" evidence=IMP]
            [GO:2000737 "negative regulation of stem cell differentiation"
            evidence=ISO] [GO:2000974 "negative regulation of pro-B cell
            differentiation" evidence=ISO] [GO:2000978 "negative regulation of
            forebrain neuron differentiation" evidence=ISO] [GO:2000981
            "negative regulation of inner ear receptor cell differentiation"
            evidence=IMP] Reactome:REACT_13641 InterPro:IPR003650
            InterPro:IPR011598 Pfam:PF00010 Pfam:PF07527 PROSITE:PS50888
            PROSITE:PS51054 SMART:SM00353 MGI:MGI:104853 GO:GO:0005737
            GO:GO:0042803 GO:GO:0005654 GO:GO:0016477 GO:GO:0006461
            GO:GO:0030324 GO:GO:0001078 GO:GO:0043565 GO:GO:0045944
            GO:GO:0007155 GO:GO:0007219 GO:GO:0001889 GO:GO:0045747
            Reactome:REACT_127416 GO:GO:0030901 GO:GO:0030513 GO:GO:0003143
            GO:GO:0060037 GO:GO:0042102 GO:GO:0097084 GO:GO:0046331
            GO:GO:0048538 GO:GO:0035019 Gene3D:4.10.280.10 SUPFAM:SSF47459
            GO:GO:0008134 GO:GO:0031018 GO:GO:0060716 GO:GO:0045598
            GO:GO:0072012 GO:GO:0003151 GO:GO:0007224 GO:GO:0042517
            GO:GO:0021984 GO:GO:0021575 GO:GO:0090102 GO:GO:0042668
            GO:GO:0048469 InterPro:IPR018352 SMART:SM00511 GO:GO:0048711
            GO:GO:0021537 GO:GO:0060675 GO:GO:0048715 GO:GO:0043388
            GO:GO:0060412 GO:GO:0003266 GO:GO:0045608 GO:GO:0097150
            eggNOG:NOG319418 GO:GO:0048667 GO:GO:0007262 GO:GO:0060253
            GO:GO:0021555 GO:GO:0021861 GO:GO:0061309 KO:K06054 CTD:3280
            HOGENOM:HOG000236346 HOVERGEN:HBG005960 OrthoDB:EOG4TTGK6
            GO:GO:0071820 GO:GO:2000978 GO:GO:2000974 OMA:TKVYGGF GO:GO:0035910
            GO:GO:0072049 GO:GO:0061009 GO:GO:0072282 GO:GO:2000227
            GO:GO:2000737 GO:GO:0061106 GO:GO:0021557 GO:GO:0045977
            GO:GO:0060164 GO:GO:0072141 GO:GO:0072050 GO:GO:0021558 EMBL:D16464
            EMBL:BC018375 EMBL:BC051428 IPI:IPI00118341 PIR:A53336
            RefSeq:NP_032261.1 UniGene:Mm.390859 ProteinModelPortal:P35428
            SMR:P35428 STRING:P35428 PhosphoSite:P35428 PRIDE:P35428
            Ensembl:ENSMUST00000023171 GeneID:15205 KEGG:mmu:15205
            InParanoid:P35428 Reactome:REACT_118814 ChEMBL:CHEMBL1075292
            NextBio:287757 Bgee:P35428 CleanEx:MM_HES1 Genevestigator:P35428
            GermOnline:ENSMUSG00000022528 Uniprot:P35428
        Length = 282

 Score = 78 (32.5 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:     2 TSPPKPHQYSEYDKSGKPA--KNHQPSNAELLSSAK-LVADAAKDTLNSDHDKVDKTKV 57
             T+P KP   SE+ KS KP   K  +    E LS  K L+ DA K   +S H K++K  +
Sbjct:    23 TTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKD-SSRHSKLEKADI 80

 Score = 34 (17.0 bits), Expect = 0.00034, Sum P(2) = 0.00034
 Identities = 6/16 (37%), Positives = 10/16 (62%)

Query:    66 NAGSRYGNSKTNPSGG 81
             N+G+  G +  +PS G
Sbjct:   253 NSGTSVGPNAVSPSSG 268


>UNIPROTKB|G3N2D5 [details] [associations]
            symbol:HES1 "Transcription factor HES-1" species:9913 "Bos
            taurus" [GO:2000974 "negative regulation of pro-B cell
            differentiation" evidence=IEA] [GO:2000737 "negative regulation of
            stem cell differentiation" evidence=IEA] [GO:2000227 "negative
            regulation of pancreatic A cell differentiation" evidence=IEA]
            [GO:0097150 "neuronal stem cell maintenance" evidence=IEA]
            [GO:0097084 "vascular smooth muscle cell development" evidence=IEA]
            [GO:0090102 "cochlea development" evidence=IEA] [GO:0072282
            "metanephric nephron tubule morphogenesis" evidence=IEA]
            [GO:0072141 "renal interstitial cell development" evidence=IEA]
            [GO:0072050 "S-shaped body morphogenesis" evidence=IEA] [GO:0072049
            "comma-shaped body morphogenesis" evidence=IEA] [GO:0072012
            "glomerulus vasculature development" evidence=IEA] [GO:0071820
            "N-box binding" evidence=IEA] [GO:0061309 "cardiac neural crest
            cell development involved in outflow tract morphogenesis"
            evidence=IEA] [GO:0061106 "negative regulation of stomach
            neuroendocrine cell differentiation" evidence=IEA] [GO:0061009
            "common bile duct development" evidence=IEA] [GO:0060716
            "labyrinthine layer blood vessel development" evidence=IEA]
            [GO:0060675 "ureteric bud morphogenesis" evidence=IEA] [GO:0060412
            "ventricular septum morphogenesis" evidence=IEA] [GO:0060253
            "negative regulation of glial cell proliferation" evidence=IEA]
            [GO:0060164 "regulation of timing of neuron differentiation"
            evidence=IEA] [GO:0060037 "pharyngeal system development"
            evidence=IEA] [GO:0048715 "negative regulation of oligodendrocyte
            differentiation" evidence=IEA] [GO:0048711 "positive regulation of
            astrocyte differentiation" evidence=IEA] [GO:0048667 "cell
            morphogenesis involved in neuron differentiation" evidence=IEA]
            [GO:0048538 "thymus development" evidence=IEA] [GO:0048469 "cell
            maturation" evidence=IEA] [GO:0046331 "lateral inhibition"
            evidence=IEA] [GO:0045977 "positive regulation of mitotic cell
            cycle, embryonic" evidence=IEA] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0045747 "positive regulation of Notch signaling pathway"
            evidence=IEA] [GO:0045608 "negative regulation of auditory receptor
            cell differentiation" evidence=IEA] [GO:0045598 "regulation of fat
            cell differentiation" evidence=IEA] [GO:0043388 "positive
            regulation of DNA binding" evidence=IEA] [GO:0042826 "histone
            deacetylase binding" evidence=IEA] [GO:0042803 "protein
            homodimerization activity" evidence=IEA] [GO:0042668 "auditory
            receptor cell fate determination" evidence=IEA] [GO:0042517
            "positive regulation of tyrosine phosphorylation of Stat3 protein"
            evidence=IEA] [GO:0042102 "positive regulation of T cell
            proliferation" evidence=IEA] [GO:0035910 "ascending aorta
            morphogenesis" evidence=IEA] [GO:0035019 "somatic stem cell
            maintenance" evidence=IEA] [GO:0031016 "pancreas development"
            evidence=IEA] [GO:0030901 "midbrain development" evidence=IEA]
            [GO:0030513 "positive regulation of BMP signaling pathway"
            evidence=IEA] [GO:0030324 "lung development" evidence=IEA]
            [GO:0021984 "adenohypophysis development" evidence=IEA] [GO:0021575
            "hindbrain morphogenesis" evidence=IEA] [GO:0021558 "trochlear
            nerve development" evidence=IEA] [GO:0021557 "oculomotor nerve
            development" evidence=IEA] [GO:0021555 "midbrain-hindbrain boundary
            morphogenesis" evidence=IEA] [GO:0021537 "telencephalon
            development" evidence=IEA] [GO:0016477 "cell migration"
            evidence=IEA] [GO:0007262 "STAT protein import into nucleus"
            evidence=IEA] [GO:0007224 "smoothened signaling pathway"
            evidence=IEA] [GO:0007219 "Notch signaling pathway" evidence=IEA]
            [GO:0007155 "cell adhesion" evidence=IEA] [GO:0006461 "protein
            complex assembly" evidence=IEA] [GO:0005737 "cytoplasm"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0003266
            "regulation of secondary heart field cardioblast proliferation"
            evidence=IEA] [GO:0003143 "embryonic heart tube morphogenesis"
            evidence=IEA] [GO:0001889 "liver development" evidence=IEA]
            [GO:0001078 "RNA polymerase II core promoter proximal region
            sequence-specific DNA binding transcription factor activity
            involved in negative regulation of transcription" evidence=IEA]
            InterPro:IPR003650 InterPro:IPR011598 Pfam:PF00010 Pfam:PF07527
            PROSITE:PS50888 PROSITE:PS51054 SMART:SM00353 GO:GO:0005634
            GO:GO:0005737 GO:GO:0016477 GO:GO:0006461 GO:GO:0030324
            GO:GO:0001078 GO:GO:0001701 GO:GO:0045944 GO:GO:0007155
            GO:GO:0007219 GO:GO:0001889 GO:GO:0045747 GO:GO:0030901
            GO:GO:0030513 GO:GO:0060037 GO:GO:0042102 GO:GO:0097084
            GO:GO:0046331 GO:GO:0048538 GO:GO:0035019 Gene3D:4.10.280.10
            SUPFAM:SSF47459 GO:GO:0031016 GO:GO:0045598 GO:GO:0048844
            GO:GO:0072012 GO:GO:0003151 GO:GO:0007224 GO:GO:0042517
            GO:GO:0021984 GO:GO:0021575 GO:GO:0090102 GO:GO:0042668
            GO:GO:0048469 InterPro:IPR018352 SMART:SM00511 GO:GO:0048711
            GO:GO:0021537 GO:GO:0060675 GO:GO:0048715 GO:GO:0043388
            GO:GO:0003281 GO:GO:0003266 GO:GO:0045608 GO:GO:0097150
            GO:GO:0048667 GO:GO:0007262 GO:GO:0060253 GO:GO:0021555
            GeneTree:ENSGT00700000104168 GO:GO:0061309 GO:GO:0071820
            GO:GO:2000974 OMA:TKVYGGF GO:GO:0072049 GO:GO:0061009 GO:GO:0072282
            GO:GO:2000227 GO:GO:2000737 GO:GO:0061106 GO:GO:0021557
            GO:GO:0060164 GO:GO:0072141 GO:GO:0072050 GO:GO:0021558
            EMBL:DAAA02001738 Ensembl:ENSBTAT00000062965 Uniprot:G3N2D5
        Length = 304

 Score = 78 (32.5 bits), Expect = 0.00043, Sum P(2) = 0.00043
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query:     2 TSPPKPHQYSEYDKSGKPA--KNHQPSNAELLSSAK-LVADAAKDTLNSDHDKVDKTKV 57
             T+P KP   SE+ KS KP   K  +    E LS  K L+ DA K   +S H K++K  +
Sbjct:    23 TTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKD-SSRHSKLEKADI 80

 Score = 34 (17.0 bits), Expect = 0.00043, Sum P(2) = 0.00043
 Identities = 6/16 (37%), Positives = 10/16 (62%)

Query:    66 NAGSRYGNSKTNPSGG 81
             N+G+  G +  +PS G
Sbjct:   251 NSGTSVGPNAVSPSSG 266


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.305   0.125   0.353    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      103       103   0.00091  102 3  11 23  0.41    31
                                                     29  0.49    31


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  8
  No. of states in DFA:  481 (51 KB)
  Total size of DFA:  104 KB (2074 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  12.64u 0.12s 12.76t   Elapsed:  00:00:01
  Total cpu time:  12.64u 0.12s 12.76t   Elapsed:  00:00:01
  Start:  Fri May 10 10:13:42 2013   End:  Fri May 10 10:13:43 2013

Back to top