BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 043659
(112 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2RKN|A Chain A, X-Ray Structure Of The Self-Defense And Signaling Protein
Dir1 From Arabidopsis Taliana
Length = 77
Score = 26.6 bits (57), Expect = 4.2, Method: Compositional matrix adjust.
Identities = 12/34 (35%), Positives = 17/34 (50%)
Query: 68 CLCAVLLSDTAKLSGVKPQVAITIPKRCNITKLP 101
CLC S GV P++A +PK+C + P
Sbjct: 42 CLCGYKNSPWLGSFGVDPELASALPKQCGLANAP 75
>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Capric Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Lauric Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Myristic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Palmitoleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Stearic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Oleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Alpha-Linolenic
Acid Revealed By High-Resolution X-Ray Crystallography
pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Ricinoleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15
Structures
pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With
Palmitate
Length = 93
Score = 26.2 bits (56), Expect = 4.6, Method: Compositional matrix adjust.
Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 6/71 (8%)
Query: 34 AMKLSPCATAPQDEKVPVSAGC------RRNVQRIGQNPNCLCAVLLSDTAKLSGVKPQV 87
A ++PC + + + SAGC N R + C L + A +SG+
Sbjct: 8 ASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGN 67
Query: 88 AITIPKRCNIT 98
A +IP +C ++
Sbjct: 68 AASIPSKCGVS 78
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.428
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,236,298
Number of Sequences: 62578
Number of extensions: 113141
Number of successful extensions: 189
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 188
Number of HSP's gapped (non-prelim): 4
length of query: 112
length of database: 14,973,337
effective HSP length: 76
effective length of query: 36
effective length of database: 10,217,409
effective search space: 367826724
effective search space used: 367826724
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)