Citrus Sinensis ID: 043673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MSLKQRVRDMERELLGEMDKDSMATEAPYAPVTYERRVSTDLEDRLPKPYMPRALEAPDTYHPNGTPGHMHHGLSVLQQHVAFFDQDDNGIIYPWETYSGLRQIGFNIIASLVLAFVINLGLTYPTLPGWFPSPLLPIYIHNIHRSKHGSDSGTYDTEGRYTPVNLENMFSKYARTVPDKLTLGEVWNLTEGNRLAFDLFGWVAAKLEWILLYILARDEEGLLSKEAVRRCFDGSLFEYCARMNLVGEDKMG
ccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccEEcccccccccccHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHccccccc
**************************APYAPVTYERRV******RL**PYMPRALEA************MHHGLSVLQQHVAFFDQDDNGIIYPWETYSGLRQIGFNIIASLVLAFVINLGLTYPTLPGWFPSPLLPIYIHNIHRSKHGSDSGTYDTEGRYTPVNLENMFSKYARTVPDKLTLGEVWNLTEGNRLAFDLFGWVAAKLEWILLYILARDEEGLLSKEAVRRCFDGSLFEYCARMNLV******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLKQRVRDMERELLGEMDKDSMATEAPYAPVTYERRVSTDLEDRLPKPYMPRALEAPDTYHPNGTPGHMHHGLSVLQQHVAFFDQDDNGIIYPWETYSGLRQIGFNIIASLVLAFVINLGLTYPTLPGWFPSPLLPIYIHNIHRSKHGSDSGTYDTEGRYTPVNLENMFSKYARTVPDKLTLGEVWNLTEGNRLAFDLFGWVAAKLEWILLYILARDEEGLLSKEAVRRCFDGSLFEYCARMNLVGEDKMG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxygenase 1 Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline, epoxidation of oleic acid or intramolecular oxygen transfer.confidentO81270
Peroxygenase Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination.probableQ9SQ57
Peroxygenase Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline and epoxidation of oleic acid.probableQ7FAX1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BE4, chain A
Confidence level:confident
Coverage over the Query: 76-113,163-233
View the alignment between query and template
View the model in PyMOL
Template: 2HPK, chain A
Confidence level:probable
Coverage over the Query: 75-233
View the alignment between query and template
View the model in PyMOL
Template: 1JUO, chain A
Confidence level:probable
Coverage over the Query: 69-126,156-232
View the alignment between query and template
View the model in PyMOL