Query         043708
Match_columns 254
No_of_seqs    122 out of 219
Neff          2.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:35:27 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043708.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043708hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03141 Methyltransf_29:  Puta 100.0 1.3E-29 2.8E-34  242.3   4.8   71  184-254    19-107 (506)
  2 KOG1619 Cytochrome b [Energy p  62.6     7.9 0.00017   35.9   3.2   32    2-33      6-40  (245)
  3 PF07172 GRP:  Glycine rich pro  57.7     8.6 0.00019   30.4   2.3   22   19-40      6-27  (95)
  4 PF12553 DUF3742:  Protein of u  56.7      10 0.00022   27.7   2.3   18   20-37      3-20  (54)
  5 PF00672 HAMP:  HAMP domain;  I  56.2      14  0.0003   25.0   2.8   26   15-40      2-27  (70)
  6 PF13172 PepSY_TM_1:  PepSY-ass  53.5      15 0.00033   23.6   2.5   23   10-32      9-31  (34)
  7 PF13624 SurA_N_3:  SurA N-term  49.5     1.7 3.7E-05   33.8  -2.8   32   27-59     27-58  (154)
  8 PF06724 DUF1206:  Domain of Un  48.9      19 0.00041   26.0   2.7   24   11-34     44-67  (73)
  9 PRK14125 cell division suppres  46.8      22 0.00048   28.3   3.0   20   18-38     11-30  (103)
 10 PRK05696 fliL flagellar basal   46.4      22 0.00049   29.7   3.1   15   26-40     35-49  (170)
 11 PF14991 MLANA:  Protein melan-  42.7     7.8 0.00017   32.7  -0.1   20   13-32     28-47  (118)
 12 PF14341 PilX_N:  PilX N-termin  41.5      25 0.00054   24.5   2.3   25   12-36      3-27  (51)
 13 PF10828 DUF2570:  Protein of u  40.4      26 0.00055   27.7   2.5   17   10-26      2-18  (110)
 14 PF13800 Sigma_reg_N:  Sigma fa  39.9      25 0.00054   26.6   2.2   23   13-35     14-36  (96)
 15 PF12911 OppC_N:  N-terminal TM  39.7      28 0.00061   23.5   2.3   19   13-31     20-38  (56)
 16 PF12273 RCR:  Chitin synthesis  39.5      26 0.00056   28.0   2.4   18   14-31      4-21  (130)
 17 PF09889 DUF2116:  Uncharacteri  39.4      34 0.00074   25.4   2.8   14   22-35     45-58  (59)
 18 KOG3142 Prenylated rab accepto  37.8      28 0.00061   31.0   2.5   24   10-33     71-105 (187)
 19 PRK10476 multidrug resistance   37.3      32 0.00069   30.8   2.9   38    7-44      5-42  (346)
 20 COG1987 FliQ Flagellar biosynt  37.0      28 0.00061   28.1   2.2   16   18-33     56-71  (89)
 21 PF05545 FixQ:  Cbb3-type cytoc  36.6      44 0.00094   22.9   2.8   21   14-34     12-32  (49)
 22 PF03779 SPW:  SPW repeat;  Int  36.1      20 0.00043   25.5   1.1   18   23-40      4-21  (51)
 23 PF12729 4HB_MCP_1:  Four helix  34.3      41 0.00089   25.0   2.6   23   13-35     11-33  (181)
 24 PF09680 Tiny_TM_bacill:  Prote  34.3      30 0.00065   22.3   1.6   17   13-29      5-21  (24)
 25 PF03929 PepSY_TM:  PepSY-assoc  34.1      44 0.00095   21.4   2.3   21   12-32      7-27  (27)
 26 PF02950 Conotoxin:  Conotoxin;  32.4      15 0.00032   26.2   0.0   12   16-27      3-14  (75)
 27 COG4068 Uncharacterized protei  32.4      40 0.00088   26.0   2.3   18   15-32     44-61  (64)
 28 COG3115 ZipA Cell division pro  31.4      33 0.00072   33.1   2.1   20   12-31      7-26  (324)
 29 PF13908 Shisa:  Wnt and FGF in  31.2      29 0.00063   28.8   1.5   28   11-38     77-104 (179)
 30 PF11807 DUF3328:  Domain of un  30.6      77  0.0017   25.1   3.7   23   10-32     11-33  (217)
 31 PRK01294 lipase chaperone; Pro  30.3      59  0.0013   30.6   3.5   20   14-33      5-24  (336)
 32 cd08762 Cyt_b561_CYBASC3 Verte  30.0      46   0.001   29.3   2.6   21   13-33      1-21  (179)
 33 PF03839 Sec62:  Translocation   29.6      31 0.00068   31.2   1.5    6   35-40    177-182 (224)
 34 COG5353 Uncharacterized protei  29.4      44 0.00095   29.6   2.4   26   14-40      9-34  (161)
 35 PF07423 DUF1510:  Protein of u  29.0      78  0.0017   28.6   3.9   58  156-214   137-203 (217)
 36 PRK10299 PhoPQ regulatory prot  28.5      57  0.0012   23.9   2.4   20   16-36      7-26  (47)
 37 PF14285 DUF4367:  Domain of un  28.1      45 0.00097   26.1   2.0   24   12-35      1-24  (168)
 38 PF11660 DUF3262:  Protein of u  27.3      61  0.0013   24.5   2.6   25   14-38     22-46  (76)
 39 PF13665 DUF4150:  Domain of un  26.5      33 0.00072   27.7   1.0   17  198-216    10-26  (110)
 40 TIGR01732 tiny_TM_bacill conse  25.7      53  0.0011   21.5   1.6   16   14-29      8-23  (26)
 41 PF01313 Bac_export_3:  Bacteri  25.6      63  0.0014   24.9   2.3   16   18-33     53-68  (76)
 42 PRK14859 tatA twin arginine tr  25.3      43 0.00093   25.2   1.4   14   16-29      9-22  (63)
 43 PRK03625 tatE twin arginine tr  24.9      41 0.00089   25.6   1.2   14   16-29      9-22  (67)
 44 PRK06010 fliQ flagellar biosyn  24.9      64  0.0014   25.6   2.3   16   18-33     56-71  (88)
 45 KOG2927 Membrane component of   24.4      73  0.0016   31.4   3.1   39   16-58    232-275 (372)
 46 TIGR01167 LPXTG_anchor LPXTG-m  24.4 1.1E+02  0.0025   18.8   3.0   27    6-32      2-28  (34)
 47 PF10749 DUF2534:  Protein of u  24.1      53  0.0012   26.5   1.8   29    4-32      7-35  (85)
 48 TIGR01403 fliQ_rel_III type II  24.1      67  0.0014   25.1   2.3   16   18-33     52-67  (81)
 49 PF02416 MttA_Hcf106:  mttA/Hcf  24.0      48  0.0011   23.6   1.4   13   16-28      6-18  (53)
 50 PF13706 PepSY_TM_3:  PepSY-ass  23.7      92   0.002   20.5   2.6   24   10-33      8-31  (37)
 51 PF03866 HAP:  Hydrophobic abun  23.4      59  0.0013   28.7   2.0   15   20-34      5-19  (164)
 52 PRK05700 fliQ flagellar biosyn  23.1      70  0.0015   25.3   2.2   16   18-33     56-71  (89)
 53 PRK02958 tatA twin arginine tr  22.9      52  0.0011   25.5   1.4   14   16-29      9-22  (73)
 54 PF14030 DUF4245:  Protein of u  22.7 1.1E+02  0.0025   25.9   3.6   21   13-33      8-28  (169)
 55 TIGR01402 fliQ flagellar biosy  22.5      73  0.0016   25.2   2.2   16   18-33     56-71  (88)
 56 PF08733 PalH:  PalH/RIM21;  In  22.1      76  0.0017   29.8   2.7   27   12-38     80-106 (348)
 57 PRK12785 fliL flagellar basal   22.1      26 0.00056   29.5  -0.4   19   17-35     31-49  (166)
 58 PRK15350 type III secretion sy  21.7      80  0.0017   25.0   2.3   16   18-33     56-71  (88)
 59 TIGR02832 spo_yunB sporulation  21.7      78  0.0017   28.1   2.5   29   11-40      4-32  (204)
 60 PF14998 Ripply:  Transcription  21.5      39 0.00084   27.2   0.5   17  203-219    35-53  (87)
 61 PF10601 zf-LITAF-like:  LITAF-  21.4      66  0.0014   23.3   1.7   24    9-32     21-44  (73)
 62 PRK12781 fliQ flagellar biosyn  21.2      83  0.0018   25.0   2.3   16   18-33     56-71  (88)
 63 PTZ00382 Variant-specific surf  21.1      39 0.00085   26.5   0.5   20   14-33     71-91  (96)
 64 TIGR02205 septum_zipA cell div  21.0      50  0.0011   30.8   1.2   20   13-32      6-25  (284)
 65 PRK10549 signal transduction h  20.9      77  0.0017   28.1   2.3   15    1-15      1-15  (466)
 66 PF03954 Lectin_N:  Hepatic lec  20.8      52  0.0011   28.4   1.2   15   14-28     40-54  (138)
 67 PF02532 PsbI:  Photosystem II   20.6      80  0.0017   22.1   1.9   15   15-29      9-23  (36)
 68 PF12012 DUF3504:  Domain of un  20.4      65  0.0014   26.6   1.6   33  198-230   127-159 (172)
 69 TIGR03745 conj_TIGR03745 integ  20.2      79  0.0017   26.2   2.1   21   16-36     81-101 (104)
 70 PF02340 PRRSV_Env:  PRRSV puta  20.1      56  0.0012   30.4   1.3   36    6-41      1-41  (234)
 71 TIGR02830 spore_III_AG stage I  20.0 1.5E+02  0.0033   26.2   3.9   23   18-40      3-25  (186)

No 1  
>PF03141 Methyltransf_29:  Putative S-adenosyl-L-methionine-dependent methyltransferase;  InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases. ; GO: 0008168 methyltransferase activity
Probab=99.95  E-value=1.3e-29  Score=242.33  Aligned_cols=71  Identities=52%  Similarity=0.866  Sum_probs=65.7

Q ss_pred             ccceeEeccCCC--CCCcccccCCCCCCCCCCCCCccccccccCCCCcccccccc----------------CCCcCcCcH
Q 043708          184 GHRWKIWRYCPE--EACTSIAPLPEGYKRSIKWPKSRDRIWYYNFPHTKLSEVKG----------------GETQFENGA  245 (254)
Q Consensus       184 ~y~WkLcRHCPe--e~~~CLVPpP~GYK~PIrWPkSRDkIWy~NVPHTkLae~KG----------------GGTqF~~GA  245 (254)
                      ...=.++||||.  ++++||||+|+|||+||+||+|||+|||+||||++|+++|+                |||||++||
T Consensus        19 ~~~~~rERhCP~~~~~~~CLVp~P~gYk~P~~WP~SRd~iW~~Nvph~~L~~~K~~qnWv~~~gd~~~FPgggt~F~~Ga   98 (506)
T PF03141_consen   19 ERMEHRERHCPPPEERLRCLVPPPKGYKTPIPWPKSRDYIWYANVPHTKLAEEKADQNWVRVEGDKFRFPGGGTMFPHGA   98 (506)
T ss_pred             ccccEeeccCcCCCCCCccccCCCccCCCCCCCCcccceeeecccCchHHhhhcccccceeecCCEEEeCCCCccccCCH
Confidence            344568999995  89999999999999999999999999999999999999994                999999999


Q ss_pred             HHHHHHhhC
Q 043708          246 LHYIDFILK  254 (254)
Q Consensus       246 ~~YID~IaE  254 (254)
                      ++|||+|++
T Consensus        99 ~~Yid~i~~  107 (506)
T PF03141_consen   99 DHYIDQIAE  107 (506)
T ss_pred             HHHHHHHHH
Confidence            999999974


No 2  
>KOG1619 consensus Cytochrome b [Energy production and conversion]
Probab=62.61  E-value=7.9  Score=35.91  Aligned_cols=32  Identities=31%  Similarity=0.565  Sum_probs=25.2

Q ss_pred             ccccCccccchhhhh---HhHHHHHHHHHHHHHhh
Q 043708            2 RLMRMPSIQKFLIVV---TVVVFVGLCLVGVWMLM   33 (254)
Q Consensus         2 ~~~~~~s~~~y~~~~---t~v~fv~lclvgvwm~~   33 (254)
                      |+|.||+-.+|.+.+   .++.|+++||||+|++.
T Consensus         6 ~~~~~~~~~~f~~~~~~s~l~G~i~v~lvl~W~~~   40 (245)
T KOG1619|consen    6 RTKAASSLGRFLIIVVVSHLLGFITVVLVLYWVNT   40 (245)
T ss_pred             cccccCCcccchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            677788877765443   37889999999999986


No 3  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=57.70  E-value=8.6  Score=30.42  Aligned_cols=22  Identities=18%  Similarity=0.427  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHhhcCCcccC
Q 043708           19 VVFVGLCLVGVWMLMSSSVVPD   40 (254)
Q Consensus        19 v~fv~lclvgvwm~~sssv~p~   40 (254)
                      .||++|+|+-|-+++|-.+++.
T Consensus         6 ~llL~l~LA~lLlisSevaa~~   27 (95)
T PF07172_consen    6 FLLLGLLLAALLLISSEVAARE   27 (95)
T ss_pred             HHHHHHHHHHHHHHHhhhhhHH
Confidence            5666666665555555444443


No 4  
>PF12553 DUF3742:  Protein of unknown function (DUF3742);  InterPro: IPR022213  This domain family is found in bacteria, and is approximately 50 amino acids in length. There is a single completely conserved residue Y that may be functionally important. 
Probab=56.70  E-value=10  Score=27.66  Aligned_cols=18  Identities=11%  Similarity=0.516  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHhhcCCc
Q 043708           20 VFVGLCLVGVWMLMSSSV   37 (254)
Q Consensus        20 ~fv~lclvgvwm~~sssv   37 (254)
                      +.+++.++++||+.++.+
T Consensus         3 Lll~f~~iaaw~~~~~~~   20 (54)
T PF12553_consen    3 LLLVFAAIAAWMARNPDI   20 (54)
T ss_pred             HHHHHHHHHHHHHhCCcc
Confidence            346677889999998776


No 5  
>PF00672 HAMP:  HAMP domain;  InterPro: IPR003660 The HAMP linker domain (present in Histidine kinases, Adenyl cyclases, Methyl-accepting proteins and Phosphatases) is an approximately 50-amino acid alpha-helical region. It is found in bacterial sensor and chemotaxis proteins and in eukaryotic histidine kinases. The bacterial proteins are usually integral membrane proteins and part of a two-component signal transduction pathway. One or several copies of the HAMP domain can be found in association with other domains, such as the histidine kinase domain, the bacterial chemotaxis sensory transducer domain, the PAS repeat, the EAL domain, the GGDEF domain, the protein phosphatase 2C-like domain, the guanylate cyclase domain, or the response regulatory domain. It has been suggested that the HAMP domain possesses a role of regulating the phosphorylation or methylation of homodimeric receptors by transmitting the conformational changes in periplasmic ligand-binding domains to cytoplasmic signalling kinase and methyl-acceptor domains.; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0016021 integral to membrane; PDB: 3PJX_A 3PJW_A 3ZX6_B 2Y20_B 2Y0Q_D 2Y21_H 3ZRW_C 2L7H_B 2LFS_B 2L7I_B ....
Probab=56.23  E-value=14  Score=24.96  Aligned_cols=26  Identities=23%  Similarity=0.419  Sum_probs=18.1

Q ss_pred             hhHhHHHHHHHHHHHHHhhcCCcccC
Q 043708           15 VVTVVVFVGLCLVGVWMLMSSSVVPD   40 (254)
Q Consensus        15 ~~t~v~fv~lclvgvwm~~sssv~p~   40 (254)
                      .+.+++++.++++.+|.+..+-..|-
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~i~~pl   27 (70)
T PF00672_consen    2 LVLFLIILLLSLLLAWLLARRITRPL   27 (70)
T ss_dssp             HHHHHHHHHHHHHHHHH--HTTCCCH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45667777778888888888888776


No 6  
>PF13172 PepSY_TM_1:  PepSY-associated TM helix
Probab=53.49  E-value=15  Score=23.58  Aligned_cols=23  Identities=17%  Similarity=0.429  Sum_probs=19.7

Q ss_pred             cchhhhhHhHHHHHHHHHHHHHh
Q 043708           10 QKFLIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus        10 ~~y~~~~t~v~fv~lclvgvwm~   32 (254)
                      -.|...++.++++.+|+-|++|.
T Consensus         9 H~~~g~~~~~~ll~~~lTG~~l~   31 (34)
T PF13172_consen    9 HRWLGLIAAIFLLLLALTGALLN   31 (34)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            45788888999999999999885


No 7  
>PF13624 SurA_N_3:  SurA N-terminal domain; PDB: 3NRK_A.
Probab=49.46  E-value=1.7  Score=33.83  Aligned_cols=32  Identities=19%  Similarity=0.062  Sum_probs=10.4

Q ss_pred             HHHHHhhcCCcccCCCCCCCCCccccccccccc
Q 043708           27 VGVWMLMSSSVVPDSTNGDGDDVPVEKSENRVE   59 (254)
Q Consensus        27 vgvwm~~sssv~p~~~n~~~~dv~~~ks~~~~~   59 (254)
                      +|+|.+.+.. .+...-..-++.++++.|++-+
T Consensus        27 ~~~~~~~~~~-~~~~~vA~V~g~~It~~e~~~~   58 (154)
T PF13624_consen   27 FGIGGCGSGS-SNNNVVAKVNGEKITKSELDRR   58 (154)
T ss_dssp             ---------------EEEEETTEEEEHHHHHHH
T ss_pred             HHHHHHhccC-CCCCEEEEECCEEeCHHHHHHH
Confidence            4666654433 3333333445667777776543


No 8  
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=48.86  E-value=19  Score=26.03  Aligned_cols=24  Identities=25%  Similarity=0.347  Sum_probs=20.4

Q ss_pred             chhhhhHhHHHHHHHHHHHHHhhc
Q 043708           11 KFLIVVTVVVFVGLCLVGVWMLMS   34 (254)
Q Consensus        11 ~y~~~~t~v~fv~lclvgvwm~~s   34 (254)
                      .|+-++..++-++|..+|+|++..
T Consensus        44 p~G~~ll~~vg~gli~~gi~~~~~   67 (73)
T PF06724_consen   44 PFGRWLLGAVGLGLIGYGIWQFVK   67 (73)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHH
Confidence            478888888999999999999864


No 9  
>PRK14125 cell division suppressor protein YneA; Provisional
Probab=46.81  E-value=22  Score=28.28  Aligned_cols=20  Identities=25%  Similarity=0.406  Sum_probs=11.8

Q ss_pred             hHHHHHHHHHHHHHhhcCCcc
Q 043708           18 VVVFVGLCLVGVWMLMSSSVV   38 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~sssv~   38 (254)
                      +.+||.||+| +|++...+..
T Consensus        11 ~ii~~~l~~~-~~~~~~~~~~   30 (103)
T PRK14125         11 SIFFVLTALV-LLIFVYATVP   30 (103)
T ss_pred             HHHHHHHHHH-HHHHHHcccc
Confidence            3355555555 8988755443


No 10 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=46.38  E-value=22  Score=29.68  Aligned_cols=15  Identities=27%  Similarity=0.339  Sum_probs=10.5

Q ss_pred             HHHHHHhhcCCcccC
Q 043708           26 LVGVWMLMSSSVVPD   40 (254)
Q Consensus        26 lvgvwm~~sssv~p~   40 (254)
                      .+|+|+|++....++
T Consensus        35 g~~~~f~l~~~~~~~   49 (170)
T PRK05696         35 GGAAWFFMGSSDKAA   49 (170)
T ss_pred             HHHHHhhhcCCCCCc
Confidence            468999988765443


No 11 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=42.70  E-value=7.8  Score=32.72  Aligned_cols=20  Identities=30%  Similarity=0.511  Sum_probs=2.1

Q ss_pred             hhhhHhHHHHHHHHHHHHHh
Q 043708           13 LIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm~   32 (254)
                      ++.|.+||..+|.|+|.|-.
T Consensus        28 GIGiL~VILgiLLliGCWYc   47 (118)
T PF14991_consen   28 GIGILIVILGILLLIGCWYC   47 (118)
T ss_dssp             SSS-----------------
T ss_pred             cceeHHHHHHHHHHHhheee
Confidence            67788999999999999975


No 12 
>PF14341 PilX_N:  PilX N-terminal
Probab=41.53  E-value=25  Score=24.51  Aligned_cols=25  Identities=32%  Similarity=0.497  Sum_probs=19.5

Q ss_pred             hhhhhHhHHHHHHHHHHHHHhhcCC
Q 043708           12 FLIVVTVVVFVGLCLVGVWMLMSSS   36 (254)
Q Consensus        12 y~~~~t~v~fv~lclvgvwm~~sss   36 (254)
                      +.+++++++++.|-|+|+.++.++.
T Consensus         3 ~aLvvaLi~l~vltll~~~~~~~s~   27 (51)
T PF14341_consen    3 AALVVALIILLVLTLLGVAAMRSST   27 (51)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4567777777889999999987754


No 13 
>PF10828 DUF2570:  Protein of unknown function (DUF2570);  InterPro: IPR022538 This entry is represented by Bacteriophage IME08, pseT.3. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This is a family of proteins with unknown function. 
Probab=40.39  E-value=26  Score=27.67  Aligned_cols=17  Identities=24%  Similarity=0.495  Sum_probs=10.1

Q ss_pred             cchhhhhHhHHHHHHHH
Q 043708           10 QKFLIVVTVVVFVGLCL   26 (254)
Q Consensus        10 ~~y~~~~t~v~fv~lcl   26 (254)
                      +.|...+.+|++|+||.
T Consensus         2 ~~~~~~~l~~lvl~L~~   18 (110)
T PF10828_consen    2 KKYIYIALAVLVLGLGG   18 (110)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            45666666666655543


No 14 
>PF13800 Sigma_reg_N:  Sigma factor regulator N-terminal
Probab=39.89  E-value=25  Score=26.60  Aligned_cols=23  Identities=17%  Similarity=0.336  Sum_probs=15.0

Q ss_pred             hhhhHhHHHHHHHHHHHHHhhcC
Q 043708           13 LIVVTVVVFVGLCLVGVWMLMSS   35 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm~~ss   35 (254)
                      .-++++.++++|++++++.+++.
T Consensus        14 l~~~~isi~~~lvi~~i~~~~~~   36 (96)
T PF13800_consen   14 LRTVVISIISALVIFIISFIISA   36 (96)
T ss_pred             HHHHHHHHhhhhhhHHHHHHhhh
Confidence            34556666677777777776654


No 15 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=39.72  E-value=28  Score=23.50  Aligned_cols=19  Identities=11%  Similarity=0.396  Sum_probs=13.9

Q ss_pred             hhhhHhHHHHHHHHHHHHH
Q 043708           13 LIVVTVVVFVGLCLVGVWM   31 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm   31 (254)
                      ...+.++++|.+|++|-|.
T Consensus        20 ~gl~il~~~vl~ai~~p~~   38 (56)
T PF12911_consen   20 IGLIILLILVLLAIFAPFI   38 (56)
T ss_pred             HHHHHHHHHHHHHHHHHHc
Confidence            4556677778888888776


No 16 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=39.49  E-value=26  Score=27.96  Aligned_cols=18  Identities=17%  Similarity=0.272  Sum_probs=8.4

Q ss_pred             hhhHhHHHHHHHHHHHHH
Q 043708           14 IVVTVVVFVGLCLVGVWM   31 (254)
Q Consensus        14 ~~~t~v~fv~lclvgvwm   31 (254)
                      +.+.||+++.|+||++..
T Consensus         4 l~~iii~~i~l~~~~~~~   21 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLFYC   21 (130)
T ss_pred             eHHHHHHHHHHHHHHHHH
Confidence            344444444455544443


No 17 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=39.41  E-value=34  Score=25.43  Aligned_cols=14  Identities=21%  Similarity=0.681  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHhhcC
Q 043708           22 VGLCLVGVWMLMSS   35 (254)
Q Consensus        22 v~lclvgvwm~~ss   35 (254)
                      +.+.+++|||++..
T Consensus        45 ~~i~~l~v~~~~~~   58 (59)
T PF09889_consen   45 IFILFLAVWIFMTF   58 (59)
T ss_pred             HHHHHHHHHHHHHh
Confidence            33444789998753


No 18 
>KOG3142 consensus Prenylated rab acceptor 1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=37.76  E-value=28  Score=30.96  Aligned_cols=24  Identities=29%  Similarity=0.809  Sum_probs=17.3

Q ss_pred             cchhhhhHhH-----------HHHHHHHHHHHHhh
Q 043708           10 QKFLIVVTVV-----------VFVGLCLVGVWMLM   33 (254)
Q Consensus        10 ~~y~~~~t~v-----------~fv~lclvgvwm~~   33 (254)
                      .||...+.++           ++|-+|+||.|++.
T Consensus        71 ~NY~~iv~~~~~~sLi~~P~~Livl~~lv~~w~~L  105 (187)
T KOG3142|consen   71 VNYVIIVAILLFLSLITHPLSLIVLLALVAAWLFL  105 (187)
T ss_pred             HhHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhe
Confidence            4676666554           45667999999985


No 19 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=37.29  E-value=32  Score=30.79  Aligned_cols=38  Identities=8%  Similarity=0.160  Sum_probs=24.2

Q ss_pred             ccccchhhhhHhHHHHHHHHHHHHHhhcCCcccCCCCC
Q 043708            7 PSIQKFLIVVTVVVFVGLCLVGVWMLMSSSVVPDSTNG   44 (254)
Q Consensus         7 ~s~~~y~~~~t~v~fv~lclvgvwm~~sssv~p~~~n~   44 (254)
                      |+-+...-.+.+++++.+.|+++|+..+....|.+.++
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~   42 (346)
T PRK10476          5 PKKSPRKKLPALAIVALAIVALVFVIWRTDSAPSTDDA   42 (346)
T ss_pred             CCCCCcccchhHHHHHHHHHHHHHHheccCceEecCCe
Confidence            44444444555556666666777888888887775554


No 20 
>COG1987 FliQ Flagellar biosynthesis pathway, component FliQ [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=37.02  E-value=28  Score=28.05  Aligned_cols=16  Identities=50%  Similarity=0.956  Sum_probs=14.0

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      +++|++|.++|=||+.
T Consensus        56 iai~~~l~~~gpWm~~   71 (89)
T COG1987          56 IAVFLVLILLGPWMLN   71 (89)
T ss_pred             HHHHHHHHHHhHHHHH
Confidence            6788999999999974


No 21 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=36.55  E-value=44  Score=22.87  Aligned_cols=21  Identities=24%  Similarity=0.360  Sum_probs=14.3

Q ss_pred             hhhHhHHHHHHHHHHHHHhhc
Q 043708           14 IVVTVVVFVGLCLVGVWMLMS   34 (254)
Q Consensus        14 ~~~t~v~fv~lclvgvwm~~s   34 (254)
                      +..|+++|+.++.+.+|.+..
T Consensus        12 ~~~~v~~~~~F~gi~~w~~~~   32 (49)
T PF05545_consen   12 SIGTVLFFVFFIGIVIWAYRP   32 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHcc
Confidence            455666677777777888754


No 22 
>PF03779 SPW:  SPW repeat;  InterPro: IPR005530 A short repeat found in a small family of membrane-bound proteins. This repeat contains a conserved SPW motif in the first of two transmembrane helices [].
Probab=36.05  E-value=20  Score=25.54  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=14.4

Q ss_pred             HHHHHHHHHhhcCCcccC
Q 043708           23 GLCLVGVWMLMSSSVVPD   40 (254)
Q Consensus        23 ~lclvgvwm~~sssv~p~   40 (254)
                      ..+++|+|++.|-|+.=-
T Consensus         4 ~~~llGlwli~SPWvlgf   21 (51)
T PF03779_consen    4 LNLLLGLWLIVSPWVLGF   21 (51)
T ss_pred             HHHHHHHHHHHhHHHccc
Confidence            356889999999998733


No 23 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=34.28  E-value=41  Score=24.98  Aligned_cols=23  Identities=13%  Similarity=0.271  Sum_probs=13.8

Q ss_pred             hhhhHhHHHHHHHHHHHHHhhcC
Q 043708           13 LIVVTVVVFVGLCLVGVWMLMSS   35 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm~~ss   35 (254)
                      +..+.+++|+++.+||+|-|.+.
T Consensus        11 ~f~~~~~l~~~~~~~~~~~l~~~   33 (181)
T PF12729_consen   11 GFGLIILLLLIVGIVGLYSLSQI   33 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            34455556666666777766543


No 24 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=34.27  E-value=30  Score=22.30  Aligned_cols=17  Identities=35%  Similarity=0.550  Sum_probs=13.7

Q ss_pred             hhhhHhHHHHHHHHHHH
Q 043708           13 LIVVTVVVFVGLCLVGV   29 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgv   29 (254)
                      +.+..+|+|+-|.+||+
T Consensus         5 ~FalivVLFILLiIvG~   21 (24)
T PF09680_consen    5 GFALIVVLFILLIIVGA   21 (24)
T ss_pred             cchhHHHHHHHHHHhcc
Confidence            44667899999999985


No 25 
>PF03929 PepSY_TM:  PepSY-associated TM helix;  InterPro: IPR005625  This domain represents a conserved transmembrane (TM) helix that is found in bacterial proteins. Coil residues are significantly more conserved than other residues and are frequently found within channels and transporters, where they introduce the flexibility and polarity required for transport across the membrane []. This TM helix associates with PepSY (peptidase (M4) and YpeB of subtilis). PepSY is a repeated region first identified in Thermoanaerobacter tengcongensis. The PepSY domain functions in the control of M4 peptidases through their propeptide and in the germination of spores. It may also play a part in regulating protease activity [].
Probab=34.13  E-value=44  Score=21.38  Aligned_cols=21  Identities=5%  Similarity=0.243  Sum_probs=17.8

Q ss_pred             hhhhhHhHHHHHHHHHHHHHh
Q 043708           12 FLIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus        12 y~~~~t~v~fv~lclvgvwm~   32 (254)
                      |...++.++++-+|+-|++|+
T Consensus         7 w~~~i~al~~lv~~iTGl~l~   27 (27)
T PF03929_consen    7 WFGDIFALFMLVFAITGLILW   27 (27)
T ss_pred             HHHHHHHHHHHHHHHHHHHhC
Confidence            777888888899999999874


No 26 
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=32.44  E-value=15  Score=26.20  Aligned_cols=12  Identities=33%  Similarity=0.570  Sum_probs=0.0

Q ss_pred             hHhHHHHHHHHH
Q 043708           16 VTVVVFVGLCLV   27 (254)
Q Consensus        16 ~t~v~fv~lclv   27 (254)
                      .|+|+||||.|+
T Consensus         3 Lt~vliVavLll   14 (75)
T PF02950_consen    3 LTCVLIVAVLLL   14 (75)
T ss_dssp             ------------
T ss_pred             cchHHHHHHHHH
Confidence            478888888765


No 27 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=32.41  E-value=40  Score=25.98  Aligned_cols=18  Identities=22%  Similarity=0.340  Sum_probs=10.7

Q ss_pred             hhHhHHHHHHHHHHHHHh
Q 043708           15 VVTVVVFVGLCLVGVWML   32 (254)
Q Consensus        15 ~~t~v~fv~lclvgvwm~   32 (254)
                      ++.+.++.||.||+||.+
T Consensus        44 ~~~~~li~aLi~v~vvL~   61 (64)
T COG4068          44 MILMFLILALILVMVVLP   61 (64)
T ss_pred             HHHHHHHHHHHHHHHhhc
Confidence            344555566667777654


No 28 
>COG3115 ZipA Cell division protein [Cell division and chromosome partitioning]
Probab=31.43  E-value=33  Score=33.14  Aligned_cols=20  Identities=30%  Similarity=0.776  Sum_probs=17.3

Q ss_pred             hhhhhHhHHHHHHHHHHHHH
Q 043708           12 FLIVVTVVVFVGLCLVGVWM   31 (254)
Q Consensus        12 y~~~~t~v~fv~lclvgvwm   31 (254)
                      .++.|.++++|||.+.|.|-
T Consensus         7 ILIIvG~IAIiaLLvhGlWt   26 (324)
T COG3115           7 ILIIVGAIAIIALLVHGLWT   26 (324)
T ss_pred             HHHHHHHHHHHHHHHhhhhh
Confidence            46778889999999999994


No 29 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=31.22  E-value=29  Score=28.78  Aligned_cols=28  Identities=18%  Similarity=0.007  Sum_probs=19.6

Q ss_pred             chhhhhHhHHHHHHHHHHHHHhhcCCcc
Q 043708           11 KFLIVVTVVVFVGLCLVGVWMLMSSSVV   38 (254)
Q Consensus        11 ~y~~~~t~v~fv~lclvgvwm~~sssv~   38 (254)
                      ..++++.|++||++.+++|..+..+-..
T Consensus        77 ~~~iivgvi~~Vi~Iv~~Iv~~~Cc~c~  104 (179)
T PF13908_consen   77 ITGIIVGVICGVIAIVVLIVCFCCCCCC  104 (179)
T ss_pred             eeeeeeehhhHHHHHHHhHhhheecccc
Confidence            4567777777888878777777765443


No 30 
>PF11807 DUF3328:  Domain of unknown function (DUF3328);  InterPro: IPR021765  This family of proteins are functionally uncharacterised. This family is only found in eukaryotes. 
Probab=30.59  E-value=77  Score=25.11  Aligned_cols=23  Identities=17%  Similarity=0.450  Sum_probs=9.9

Q ss_pred             cchhhhhHhHHHHHHHHHHHHHh
Q 043708           10 QKFLIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus        10 ~~y~~~~t~v~fv~lclvgvwm~   32 (254)
                      ..+++.+++++++.|.++-+|.+
T Consensus        11 ~~~~~~~~~~l~~~l~~~~~~~~   33 (217)
T PF11807_consen   11 RRLLLLFLLLLILSLLLLVLAVL   33 (217)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444444444444444433333


No 31 
>PRK01294 lipase chaperone; Provisional
Probab=30.28  E-value=59  Score=30.61  Aligned_cols=20  Identities=10%  Similarity=0.223  Sum_probs=13.0

Q ss_pred             hhhHhHHHHHHHHHHHHHhh
Q 043708           14 IVVTVVVFVGLCLVGVWMLM   33 (254)
Q Consensus        14 ~~~t~v~fv~lclvgvwm~~   33 (254)
                      ..+++++|++.|+.|||++.
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~   24 (336)
T PRK01294          5 RALSLGLVGLVAIGAVWLWP   24 (336)
T ss_pred             hhHHHHHHHHHHHHHHHHhc
Confidence            44555666666667788876


No 32 
>cd08762 Cyt_b561_CYBASC3 Vertebrate cytochrome b(561), CYBASC3 gene product. Cytochrome b ascorbate-dependent 3, as found in vertebrates, which might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
Probab=29.95  E-value=46  Score=29.35  Aligned_cols=21  Identities=19%  Similarity=0.368  Sum_probs=17.0

Q ss_pred             hhhhHhHHHHHHHHHHHHHhh
Q 043708           13 LIVVTVVVFVGLCLVGVWMLM   33 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm~~   33 (254)
                      |..+.++-++++|||++||..
T Consensus         1 ~~~~~~lg~~~~~lv~~W~~~   21 (179)
T cd08762           1 CLLLGILGIACVVLVVHWNQM   21 (179)
T ss_pred             ChHHHHHHHHHHHHHHHHHHH
Confidence            345667889999999999983


No 33 
>PF03839 Sec62:  Translocation protein Sec62;  InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane
Probab=29.64  E-value=31  Score=31.21  Aligned_cols=6  Identities=17%  Similarity=0.312  Sum_probs=3.1

Q ss_pred             CCcccC
Q 043708           35 SSVVPD   40 (254)
Q Consensus        35 ssv~p~   40 (254)
                      -|..|-
T Consensus       177 fWlfPN  182 (224)
T PF03839_consen  177 FWLFPN  182 (224)
T ss_pred             EEeCCc
Confidence            355554


No 34 
>COG5353 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.42  E-value=44  Score=29.61  Aligned_cols=26  Identities=23%  Similarity=0.468  Sum_probs=19.7

Q ss_pred             hhhHhHHHHHHHHHHHHHhhcCCcccC
Q 043708           14 IVVTVVVFVGLCLVGVWMLMSSSVVPD   40 (254)
Q Consensus        14 ~~~t~v~fv~lclvgvwm~~sssv~p~   40 (254)
                      +.|.+|+|+|+.|+++-|+.++ ..|-
T Consensus         9 i~ii~viflai~~s~~~~~~~s-~~P~   34 (161)
T COG5353           9 IIIILVIFLAIILSIALFFWKS-MKPY   34 (161)
T ss_pred             ehhHHHHHHHHHHHHHHHHhHh-cCcc
Confidence            4556699999999999988765 4454


No 35 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=28.99  E-value=78  Score=28.60  Aligned_cols=58  Identities=21%  Similarity=0.229  Sum_probs=26.2

Q ss_pred             cCCCcccccccch---hhhhhhccc---CCCCCCccceeEeccCCCCCCccccc---CCCCCCCCCCC
Q 043708          156 QNGAWSTQPIESQ---NETISQQSS---IFKDQYGHRWKIWRYCPEEACTSIAP---LPEGYKRSIKW  214 (254)
Q Consensus       156 qngs~sTQa~ES~---~Ek~~q~~~---~~~~~~~y~WkLcRHCPee~~~CLVP---pP~GYK~PIrW  214 (254)
                      |.|...+.-....   +|+.+.-+.   +..+ .-.-|.+-+--+...-.--|.   -+..||+=|.|
T Consensus       137 Q~g~h~~~y~~~S~DW~Em~~Ais~atgi~~~-~mi~w~ign~G~~~~a~gtVs~k~~~~~YrV~i~W  203 (217)
T PF07423_consen  137 QTGEHVMTYDSGSVDWNEMLKAISYATGISED-NMIVWFIGNNGSPQKAIGTVSDKDTGKKYRVYIEW  203 (217)
T ss_pred             cCCCccccccCCCcCHHHHHHHHHHhhCCChh-heEEEhhhcCCcccceeEEeccCCCCceEEEEEEE
Confidence            5566555554443   444433331   2222 235677776554111111122   23457777766


No 36 
>PRK10299 PhoPQ regulatory protein; Provisional
Probab=28.51  E-value=57  Score=23.90  Aligned_cols=20  Identities=35%  Similarity=0.654  Sum_probs=14.1

Q ss_pred             hHhHHHHHHHHHHHHHhhcCC
Q 043708           16 VTVVVFVGLCLVGVWMLMSSS   36 (254)
Q Consensus        16 ~t~v~fv~lclvgvwm~~sss   36 (254)
                      |.++++|+.||+ .|+++=++
T Consensus         7 iili~iv~~Cl~-lyl~ald~   26 (47)
T PRK10299          7 VVLVVVVLACLL-LWAQVFNM   26 (47)
T ss_pred             hHHHHHHHHHHH-HHHHHHHH
Confidence            445667777999 99886544


No 37 
>PF14285 DUF4367:  Domain of unknown function (DUF4367)
Probab=28.08  E-value=45  Score=26.07  Aligned_cols=24  Identities=13%  Similarity=-0.025  Sum_probs=16.1

Q ss_pred             hhhhhHhHHHHHHHHHHHHHhhcC
Q 043708           12 FLIVVTVVVFVGLCLVGVWMLMSS   35 (254)
Q Consensus        12 y~~~~t~v~fv~lclvgvwm~~ss   35 (254)
                      |..-+.+++.++++|++++++++.
T Consensus         1 ~~~r~a~~~~a~~i~~~~~~~t~~   24 (168)
T PF14285_consen    1 YRKRAAVAAAAVIILVFAASMTVQ   24 (168)
T ss_pred             ChHHHHHHHHHHHHHHHhHhEEeh
Confidence            444566777777777777777554


No 38 
>PF11660 DUF3262:  Protein of unknown function (DUF3262);  InterPro: IPR021676  This entry represents small, hydrophobic proteins that are found occasionally on plasmids such as the Pseudomonas putida TOL (toluene catabolic) plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition. 
Probab=27.30  E-value=61  Score=24.53  Aligned_cols=25  Identities=24%  Similarity=0.387  Sum_probs=19.8

Q ss_pred             hhhHhHHHHHHHHHHHHHhhcCCcc
Q 043708           14 IVVTVVVFVGLCLVGVWMLMSSSVV   38 (254)
Q Consensus        14 ~~~t~v~fv~lclvgvwm~~sssv~   38 (254)
                      .++..++++.|.|.++|.+.+....
T Consensus        22 ~li~g~~~avllLW~aWa~~~~y~G   46 (76)
T PF11660_consen   22 LLILGILFAVLLLWAAWALWSAYRG   46 (76)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4566778888999999999887654


No 39 
>PF13665 DUF4150:  Domain of unknown function (DUF4150)
Probab=26.45  E-value=33  Score=27.69  Aligned_cols=17  Identities=18%  Similarity=0.223  Sum_probs=14.2

Q ss_pred             CcccccCCCCCCCCCCCCC
Q 043708          198 CTSIAPLPEGYKRSIKWPK  216 (254)
Q Consensus       198 ~~CLVPpP~GYK~PIrWPk  216 (254)
                      --||.|+|+.  +||+.|-
T Consensus        10 DVC~TP~~~~--vPIPYpn   26 (110)
T PF13665_consen   10 DVCKTPPGPP--VPIPYPN   26 (110)
T ss_pred             cceeCCCCCC--ccCcccc
Confidence            3599999877  9999884


No 40 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=25.68  E-value=53  Score=21.54  Aligned_cols=16  Identities=38%  Similarity=0.698  Sum_probs=12.6

Q ss_pred             hhhHhHHHHHHHHHHH
Q 043708           14 IVVTVVVFVGLCLVGV   29 (254)
Q Consensus        14 ~~~t~v~fv~lclvgv   29 (254)
                      .++.+|+|+-|.++|+
T Consensus         8 f~livVLFILLIIiga   23 (26)
T TIGR01732         8 FALIVVLFILLVIVGA   23 (26)
T ss_pred             hHHHHHHHHHHHHhhe
Confidence            3566889999999885


No 41 
>PF01313 Bac_export_3:  Bacterial export proteins, family 3;  InterPro: IPR002191 The fliL operon of Escherichia coli contains seven genes (including fliO, fliP, fliQ and fliR) involved in the biosynthesis and functioning of the flagellar organelle []. The fliO, fliP, fliQ and fliR genes encode highly hydrophobic polypeptides. The fliQ gene product, a small integral membrane protein that contains two putative transmembrane (TM) regions, is required for the assembly of the rivet at the earliest stage of flagellar biosynthesis. Proteins sharing an evolutionary relationship with FliQ have been found in a range of bacteria: these include Yop translocation protein S from Yersinia pestis []; surface antigen-presentation protein SpaQ from Salmonella typhimurium and Shigella flexneri []; and probable translocation protein Y4YM from Rhizobium sp. (strain NGR234) []. All of these members export proteins, that do not possess signal peptides, through the membrane. Although the proteins that these exporters move may be different, the exporters are thought to function in similar ways [].; GO: 0009306 protein secretion, 0016020 membrane
Probab=25.60  E-value=63  Score=24.93  Aligned_cols=16  Identities=50%  Similarity=0.910  Sum_probs=13.6

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      ++++++|.+.|-||+.
T Consensus        53 ~av~~~l~~~g~wm~~   68 (76)
T PF01313_consen   53 LAVFLVLLLFGPWMLQ   68 (76)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678899999999975


No 42 
>PRK14859 tatA twin arginine translocase protein A; Provisional
Probab=25.33  E-value=43  Score=25.16  Aligned_cols=14  Identities=21%  Similarity=0.498  Sum_probs=10.6

Q ss_pred             hHhHHHHHHHHHHH
Q 043708           16 VTVVVFVGLCLVGV   29 (254)
Q Consensus        16 ~t~v~fv~lclvgv   29 (254)
                      +.|+++|+|.|||.
T Consensus         9 lliIlvv~LlvfGp   22 (63)
T PRK14859          9 LIVILVIVLIVFGA   22 (63)
T ss_pred             HHHHHHHHHHHhCc
Confidence            56778888888874


No 43 
>PRK03625 tatE twin arginine translocase protein E; Validated
Probab=24.92  E-value=41  Score=25.56  Aligned_cols=14  Identities=29%  Similarity=0.349  Sum_probs=10.8

Q ss_pred             hHhHHHHHHHHHHH
Q 043708           16 VTVVVFVGLCLVGV   29 (254)
Q Consensus        16 ~t~v~fv~lclvgv   29 (254)
                      +.||++|+|.|||.
T Consensus         9 lliIlvI~lllFGp   22 (67)
T PRK03625          9 LLVVAALVVLLFGT   22 (67)
T ss_pred             HHHHHHHHHHHcCc
Confidence            56778888888884


No 44 
>PRK06010 fliQ flagellar biosynthesis protein FliQ; Reviewed
Probab=24.87  E-value=64  Score=25.60  Aligned_cols=16  Identities=38%  Similarity=0.397  Sum_probs=13.6

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      ++++++|.+.|-||+.
T Consensus        56 iav~~~l~~~g~Wm~~   71 (88)
T PRK06010         56 VAIFVTLLLTLPFMGA   71 (88)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678889999999985


No 45 
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=24.42  E-value=73  Score=31.39  Aligned_cols=39  Identities=28%  Similarity=0.495  Sum_probs=26.0

Q ss_pred             hHhHHHHHHHHHHH-HHhhc----CCcccCCCCCCCCCcccccccccc
Q 043708           16 VTVVVFVGLCLVGV-WMLMS----SSVVPDSTNGDGDDVPVEKSENRV   58 (254)
Q Consensus        16 ~t~v~fv~lclvgv-wm~~s----ssv~p~~~n~~~~dv~~~ks~~~~   58 (254)
                      |.+++||=|.|||+ |.++-    -|+.|--    +.||-+-+|=++.
T Consensus       232 IlvLaIvRlILF~I~~il~~g~~g~W~FPNL----~eDvGfleSF~PL  275 (372)
T KOG2927|consen  232 ILVLAIVRLILFGITWILTGGKHGFWLFPNL----TEDVGFLESFKPL  275 (372)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCCceEeccch----hhhhhHHHhhccc
Confidence            66677787888875 77765    5777753    4566666665543


No 46 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=24.36  E-value=1.1e+02  Score=18.77  Aligned_cols=27  Identities=15%  Similarity=0.082  Sum_probs=11.2

Q ss_pred             CccccchhhhhHhHHHHHHHHHHHHHh
Q 043708            6 MPSIQKFLIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus         6 ~~s~~~y~~~~t~v~fv~lclvgvwm~   32 (254)
                      +|.|-.-.....+++-++|.++++|++
T Consensus         2 LP~TG~~~~~~~~~~G~~l~~~~~~~~   28 (34)
T TIGR01167         2 LPKTGESGNSLLLLLGLLLLGLGGLLL   28 (34)
T ss_pred             CCCCCCcccHHHHHHHHHHHHHHHHHh
Confidence            465553222233333334444455554


No 47 
>PF10749 DUF2534:  Protein of unknown function (DUF2534);  InterPro: IPR019685  This entry represents proteins with unknown function, and appear to be restricted to Enterobacteriaceae. 
Probab=24.12  E-value=53  Score=26.53  Aligned_cols=29  Identities=21%  Similarity=0.448  Sum_probs=23.2

Q ss_pred             ccCccccchhhhhHhHHHHHHHHHHHHHh
Q 043708            4 MRMPSIQKFLIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus         4 ~~~~s~~~y~~~~t~v~fv~lclvgvwm~   32 (254)
                      .+-+.-.+|+..+.+|.++|+|+||==|+
T Consensus         7 lk~~~~kkFl~~l~~vfiia~~Vv~rAt~   35 (85)
T PF10749_consen    7 LKTKEGKKFLLALAIVFIIAATVVGRATI   35 (85)
T ss_pred             hcChhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            34456678999999999999999986554


No 48 
>TIGR01403 fliQ_rel_III type III secretion protein, HrpO family. This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FliQ. This model may not identify all type III secretion system FliQ homologs.
Probab=24.08  E-value=67  Score=25.10  Aligned_cols=16  Identities=31%  Similarity=0.663  Sum_probs=13.5

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      +++|++|.+.|-||+.
T Consensus        52 iav~~~l~~~~pwm~~   67 (81)
T TIGR01403        52 IAVFITLMLTAGWLGA   67 (81)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678889999999975


No 49 
>PF02416 MttA_Hcf106:  mttA/Hcf106 family;  InterPro: IPR003369 Members of this protein family are involved in a sec-independent translocation mechanism. This pathway has been called the DeltapH pathway in chloroplasts []. Members of this family in Escherichia coli are involved in export of redox proteins with a "twin arginine" leader motif (S/T-R-R-X-F-L-K) []. This sec-independent pathway is termed TAT for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export.; GO: 0008565 protein transporter activity, 0015031 protein transport; PDB: 2L16_A.
Probab=24.01  E-value=48  Score=23.56  Aligned_cols=13  Identities=31%  Similarity=0.659  Sum_probs=8.9

Q ss_pred             hHhHHHHHHHHHH
Q 043708           16 VTVVVFVGLCLVG   28 (254)
Q Consensus        16 ~t~v~fv~lclvg   28 (254)
                      +.++++|+|.|||
T Consensus         6 l~iI~vvalllfG   18 (53)
T PF02416_consen    6 LLIILVVALLLFG   18 (53)
T ss_dssp             HHHHHHHHHHHS-
T ss_pred             HHHHHHHHHHHhC
Confidence            4567778888887


No 50 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=23.67  E-value=92  Score=20.53  Aligned_cols=24  Identities=17%  Similarity=0.383  Sum_probs=18.9

Q ss_pred             cchhhhhHhHHHHHHHHHHHHHhh
Q 043708           10 QKFLIVVTVVVFVGLCLVGVWMLM   33 (254)
Q Consensus        10 ~~y~~~~t~v~fv~lclvgvwm~~   33 (254)
                      -.++..++-++++..|+-|+.|+.
T Consensus         8 H~W~Gl~~g~~l~~~~~tG~~~~f   31 (37)
T PF13706_consen    8 HRWLGLILGLLLFVIFLTGAVMVF   31 (37)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHHHH
Confidence            356677788888889999998864


No 51 
>PF03866 HAP:  Hydrophobic abundant protein (HAP)        ;  InterPro: IPR005566  Expression of Hydrophobic Abundant protein is thought to be developmentally regulated and possibly involved in spherule cell wall formation []. 
Probab=23.38  E-value=59  Score=28.70  Aligned_cols=15  Identities=53%  Similarity=0.873  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHhhc
Q 043708           20 VFVGLCLVGVWMLMS   34 (254)
Q Consensus        20 ~fv~lclvgvwm~~s   34 (254)
                      +|||||++.+--+.+
T Consensus         5 vfvalc~~avvalat   19 (164)
T PF03866_consen    5 VFVALCLFAVVALAT   19 (164)
T ss_pred             HHHHHHHHHHHHHhh
Confidence            799999999987655


No 52 
>PRK05700 fliQ flagellar biosynthesis protein FliQ; Validated
Probab=23.10  E-value=70  Score=25.33  Aligned_cols=16  Identities=38%  Similarity=0.810  Sum_probs=13.4

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      +++|++|.+.|-||+.
T Consensus        56 iav~~~l~~~g~Wm~~   71 (89)
T PRK05700         56 LAVLLTLIIAGPWMLN   71 (89)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678889999999975


No 53 
>PRK02958 tatA twin arginine translocase protein A; Provisional
Probab=22.89  E-value=52  Score=25.49  Aligned_cols=14  Identities=14%  Similarity=0.313  Sum_probs=10.2

Q ss_pred             hHhHHHHHHHHHHH
Q 043708           16 VTVVVFVGLCLVGV   29 (254)
Q Consensus        16 ~t~v~fv~lclvgv   29 (254)
                      +.||++|+|.|||.
T Consensus         9 lliIl~IvlllFG~   22 (73)
T PRK02958          9 WLIVLVIVVLVFGT   22 (73)
T ss_pred             HHHHHHHHHHHhCc
Confidence            45677788888883


No 54 
>PF14030 DUF4245:  Protein of unknown function (DUF4245)
Probab=22.67  E-value=1.1e+02  Score=25.88  Aligned_cols=21  Identities=14%  Similarity=0.200  Sum_probs=15.7

Q ss_pred             hhhhHhHHHHHHHHHHHHHhh
Q 043708           13 LIVVTVVVFVGLCLVGVWMLM   33 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm~~   33 (254)
                      -.+++|+++|++|++=+++++
T Consensus         8 dMilSL~vl~~~~~~i~~~~~   28 (169)
T PF14030_consen    8 DMILSLAVLVAIVALIVAGVT   28 (169)
T ss_pred             HHHHHHHHHHHHHHHHHHhhc
Confidence            356778888888888767765


No 55 
>TIGR01402 fliQ flagellar biosynthetic protein FliQ. This model describes FliQ, a protein involved in biosynthesis of bacterial flagella. A related family of proteins, excluded from this model, participates in bacterial type III protein secretion systems.
Probab=22.46  E-value=73  Score=25.22  Aligned_cols=16  Identities=38%  Similarity=0.991  Sum_probs=13.4

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      +++|++|.+.|-||+.
T Consensus        56 iav~~~l~~~gpWm~~   71 (88)
T TIGR01402        56 IAILLALALLGPWMLT   71 (88)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678889999999974


No 56 
>PF08733 PalH:  PalH/RIM21;  InterPro: IPR014844 PalH (also known as RIM21) is a transmembrane protein required for proteolytic cleavage of Rim101/PacC transcription factors which are activated by C-terminal proteolytic processing. Rim101/PacC family proteins play a key role in pH-dependent responses and PalH has been implicated as a pH sensor []. 
Probab=22.09  E-value=76  Score=29.84  Aligned_cols=27  Identities=19%  Similarity=0.349  Sum_probs=20.1

Q ss_pred             hhhhhHhHHHHHHHHHHHHHhhcCCcc
Q 043708           12 FLIVVTVVVFVGLCLVGVWMLMSSSVV   38 (254)
Q Consensus        12 y~~~~t~v~fv~lclvgvwm~~sssv~   38 (254)
                      |.+++.++.-++-..|+.|||+=-...
T Consensus        80 ~~s~~~i~y~~s~~~V~~wmL~lll~l  106 (348)
T PF08733_consen   80 YYSIVPILYSISASCVITWMLTLLLFL  106 (348)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            456666666677788999999866665


No 57 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=22.06  E-value=26  Score=29.50  Aligned_cols=19  Identities=16%  Similarity=0.020  Sum_probs=11.9

Q ss_pred             HhHHHHHHHHHHHHHhhcC
Q 043708           17 TVVVFVGLCLVGVWMLMSS   35 (254)
Q Consensus        17 t~v~fv~lclvgvwm~~ss   35 (254)
                      .+|+.++.|..|+|||+..
T Consensus        31 ~~~lll~~~g~g~~f~~~~   49 (166)
T PRK12785         31 AAAVLLLGGGGGGFFFFFS   49 (166)
T ss_pred             HHHHHHHhcchheEEEEEe
Confidence            3344444455789998865


No 58 
>PRK15350 type III secretion system protein SsaS; Provisional
Probab=21.72  E-value=80  Score=25.05  Aligned_cols=16  Identities=13%  Similarity=0.297  Sum_probs=13.4

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      +++|+.|.+.|-||+.
T Consensus        56 iav~~~l~~~gpWm~~   71 (88)
T PRK15350         56 LAIAITLMVSYPWLSG   71 (88)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678889999999975


No 59 
>TIGR02832 spo_yunB sporulation protein YunB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. Mutation of this sigma E-regulated gene, designated yunB, has been shown to cause a sporulation defect.
Probab=21.65  E-value=78  Score=28.14  Aligned_cols=29  Identities=21%  Similarity=0.616  Sum_probs=22.6

Q ss_pred             chhhhhHhHHHHHHHHHHHHHhhcCCcccC
Q 043708           11 KFLIVVTVVVFVGLCLVGVWMLMSSSVVPD   40 (254)
Q Consensus        11 ~y~~~~t~v~fv~lclvgvwm~~sssv~p~   40 (254)
                      .|-..+++++|+.+.+.++|++ -..+-|+
T Consensus         4 R~~~l~~~i~~~~~~~~~~~~~-~~~i~P~   32 (204)
T TIGR02832         4 RRILLISLILFILLLLQFLWIV-DSLIKPT   32 (204)
T ss_pred             eehHHHHHHHHHHHHHHHHHhh-hhccchH
Confidence            4667889999999999999976 4455555


No 60 
>PF14998 Ripply:  Transcription Regulator
Probab=21.47  E-value=39  Score=27.20  Aligned_cols=17  Identities=29%  Similarity=0.776  Sum_probs=13.6

Q ss_pred             cCCCCCCCCCC--CCCccc
Q 043708          203 PLPEGYKRSIK--WPKSRD  219 (254)
Q Consensus       203 PpP~GYK~PIr--WPkSRD  219 (254)
                      ..+.+|+-|||  ||+||-
T Consensus        35 ~~~~~FqHPVRL~wPkSk~   53 (87)
T PF14998_consen   35 KGLSGFQHPVRLYWPKSKC   53 (87)
T ss_pred             CcccccCCceEeeccchHH
Confidence            34568999988  999974


No 61 
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=21.38  E-value=66  Score=23.29  Aligned_cols=24  Identities=25%  Similarity=0.401  Sum_probs=16.7

Q ss_pred             ccchhhhhHhHHHHHHHHHHHHHh
Q 043708            9 IQKFLIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus         9 ~~~y~~~~t~v~fv~lclvgvwm~   32 (254)
                      +.......|.++.+.|||+|.|-+
T Consensus        21 v~~~~g~~t~~~~~~l~~~~~~~~   44 (73)
T PF10601_consen   21 VEYKSGTMTYICAALLCLFGCWPC   44 (73)
T ss_pred             EEEEeChHHHHHHHHHHHHHHHHH
Confidence            344455667777788888888764


No 62 
>PRK12781 fliQ flagellar biosynthesis protein FliQ; Reviewed
Probab=21.21  E-value=83  Score=24.97  Aligned_cols=16  Identities=19%  Similarity=0.470  Sum_probs=13.4

Q ss_pred             hHHHHHHHHHHHHHhh
Q 043708           18 VVVFVGLCLVGVWMLM   33 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~   33 (254)
                      +++|+.|.+.|-||+.
T Consensus        56 iav~~~l~~~~~wm~~   71 (88)
T PRK12781         56 VVILIVMAVTGSFVGA   71 (88)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678889999999975


No 63 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=21.06  E-value=39  Score=26.54  Aligned_cols=20  Identities=40%  Similarity=0.602  Sum_probs=11.2

Q ss_pred             hhhHhHHHH-HHHHHHHHHhh
Q 043708           14 IVVTVVVFV-GLCLVGVWMLM   33 (254)
Q Consensus        14 ~~~t~v~fv-~lclvgvwm~~   33 (254)
                      ++|.+|++| +|..|.+|.|.
T Consensus        71 i~vg~~~~v~~lv~~l~w~f~   91 (96)
T PTZ00382         71 ISVAVVAVVGGLVGFLCWWFV   91 (96)
T ss_pred             EEeehhhHHHHHHHHHhheeE
Confidence            345444444 55667778763


No 64 
>TIGR02205 septum_zipA cell division protein ZipA. This model represents the full length of bacterial cell division protein ZipA. The N-terminal hydrophobic stretch is an uncleaved signal-anchor sequence. This is followed by an unconserved, variable length, low complexity region, and then a conserved C-terminal region of about 140 amino acids (see pfam04354) that interacts with the tubulin-like cell division protein FtsZ.
Probab=21.01  E-value=50  Score=30.79  Aligned_cols=20  Identities=30%  Similarity=0.707  Sum_probs=16.9

Q ss_pred             hhhhHhHHHHHHHHHHHHHh
Q 043708           13 LIVVTVVVFVGLCLVGVWML   32 (254)
Q Consensus        13 ~~~~t~v~fv~lclvgvwm~   32 (254)
                      +++|.+++++||.+-|.|-+
T Consensus         6 LIIvGaiaI~aLl~hGlwt~   25 (284)
T TIGR02205         6 LIIVGILAIAALLFHGLWTS   25 (284)
T ss_pred             HHHHHHHHHHHHHHcccccc
Confidence            57788889999999999953


No 65 
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional
Probab=20.87  E-value=77  Score=28.06  Aligned_cols=15  Identities=20%  Similarity=0.343  Sum_probs=8.8

Q ss_pred             CccccCccccchhhh
Q 043708            1 MRLMRMPSIQKFLIV   15 (254)
Q Consensus         1 ~~~~~~~s~~~y~~~   15 (254)
                      |++|||.-..+-.+.
T Consensus         1 m~~~~~si~~kl~~~   15 (466)
T PRK10549          1 MKFWRPGITGKLFLA   15 (466)
T ss_pred             CchhhhhHHHHHHHH
Confidence            667776655554443


No 66 
>PF03954 Lectin_N:  Hepatic lectin, N-terminal domain;  InterPro: IPR005640 Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. C-type lectins display a wide range of specificities. They require Ca2+ for their activity They are found predominantly but not exclusively in vertebrates. This entry presents N-terminal domain, which is found in C-type lectins.; GO: 0005529 sugar binding, 0016020 membrane
Probab=20.79  E-value=52  Score=28.37  Aligned_cols=15  Identities=20%  Similarity=0.802  Sum_probs=8.2

Q ss_pred             hhhHhHHHHHHHHHH
Q 043708           14 IVVTVVVFVGLCLVG   28 (254)
Q Consensus        14 ~~~t~v~fv~lclvg   28 (254)
                      +.+.+.+.|++|++|
T Consensus        40 Lgl~~LLLV~IcVig   54 (138)
T PF03954_consen   40 LGLSLLLLVVICVIG   54 (138)
T ss_pred             HHHHHHHHHHHHhhc
Confidence            344455556666665


No 67 
>PF02532 PsbI:  Photosystem II reaction centre I protein (PSII 4.8 kDa protein);  InterPro: IPR003686 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbI, which is tightly associated with the D1/D2 heterodimer in PSII. The function of PsbI is unknown, but it may be involved in the assembly, dimerisation or stabilisation of PSII dimers [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_i 3ARC_I 3A0B_i 3BZ2_I 3PRQ_I 3KZI_I 3PRR_I 2AXT_i 4FBY_I 1S5L_i ....
Probab=20.62  E-value=80  Score=22.06  Aligned_cols=15  Identities=33%  Similarity=0.647  Sum_probs=10.2

Q ss_pred             hhHhHHHHHHHHHHH
Q 043708           15 VVTVVVFVGLCLVGV   29 (254)
Q Consensus        15 ~~t~v~fv~lclvgv   29 (254)
                      .+.|..||+|.++|.
T Consensus         9 y~vV~ffv~LFifGf   23 (36)
T PF02532_consen    9 YTVVIFFVSLFIFGF   23 (36)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHhccc
Confidence            345566788888884


No 68 
>PF12012 DUF3504:  Domain of unknown function (DUF3504);  InterPro: IPR021893  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 156 to 173 amino acids in length. 
Probab=20.35  E-value=65  Score=26.65  Aligned_cols=33  Identities=18%  Similarity=0.140  Sum_probs=21.3

Q ss_pred             CcccccCCCCCCCCCCCCCccccccccCCCCcc
Q 043708          198 CTSIAPLPEGYKRSIKWPKSRDRIWYYNFPHTK  230 (254)
Q Consensus       198 ~~CLVPpP~GYK~PIrWPkSRDkIWy~NVPHTk  230 (254)
                      +.|.-+...=|..|.+=-.-.+.+||.++|..+
T Consensus       127 ~~~~~~~~~FYl~P~~~~~~~~~~WY~~~PlG~  159 (172)
T PF12012_consen  127 PSVRPRSDPFYLRPERSCSPDSPPWYSSQPLGK  159 (172)
T ss_pred             hhhccCCCCeEeCccCccCCCCCCCeeccccCH
Confidence            445555556677776531224689999999765


No 69 
>TIGR03745 conj_TIGR03745 integrating conjugative element membrane protein, PFL_4702 family. Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in a region flanked by markers of conjugative transfer and/or transposition.
Probab=20.18  E-value=79  Score=26.21  Aligned_cols=21  Identities=38%  Similarity=0.518  Sum_probs=15.7

Q ss_pred             hHhHHHHHHHHHHHHHhhcCC
Q 043708           16 VTVVVFVGLCLVGVWMLMSSS   36 (254)
Q Consensus        16 ~t~v~fv~lclvgvwm~~sss   36 (254)
                      .++++=|.|.++++|+++=++
T Consensus        81 ~~v~VGviLLv~vIwLltkA~  101 (104)
T TIGR03745        81 ATVVVGAILLVVIIWLLTKAT  101 (104)
T ss_pred             chhhhHhHHHHHHHHHHHHHh
Confidence            456677778889999987543


No 70 
>PF02340 PRRSV_Env:  PRRSV putative envelope protein;  InterPro: IPR003434 This family consists of a conserved probable envelope protein or ORF2 in Porcine reproductive and respiratory syndrome virus (PRRSV) also in the family is a minor structural protein from lactate dehydrogenase-elevating virus.
Probab=20.11  E-value=56  Score=30.35  Aligned_cols=36  Identities=31%  Similarity=0.540  Sum_probs=32.4

Q ss_pred             CccccchhhhhHhHHHHHHHH-----HHHHHhhcCCcccCC
Q 043708            6 MPSIQKFLIVVTVVVFVGLCL-----VGVWMLMSSSVVPDS   41 (254)
Q Consensus         6 ~~s~~~y~~~~t~v~fv~lcl-----vgvwm~~sssv~p~~   41 (254)
                      ||+.+..|--.+.-.|...||     +|-|.+.|-|.+|-.
T Consensus         1 m~~~s~l~p~li~~~~~~fcl~~psp~g~w~~~sdwfapr~   41 (234)
T PF02340_consen    1 MPSRSSLCPWLISSFFWPFCLASPSPVGCWSFFSDWFAPRY   41 (234)
T ss_pred             CcchhhHHHHHHHHHHHHHHhCCCCCCceehhhhhhcCccc
Confidence            788888888888899999999     799999999999974


No 71 
>TIGR02830 spore_III_AG stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG.
Probab=20.01  E-value=1.5e+02  Score=26.19  Aligned_cols=23  Identities=26%  Similarity=0.469  Sum_probs=13.9

Q ss_pred             hHHHHHHHHHHHHHhhcCCcccC
Q 043708           18 VVVFVGLCLVGVWMLMSSSVVPD   40 (254)
Q Consensus        18 ~v~fv~lclvgvwm~~sssv~p~   40 (254)
                      +-.++.|+|+|+-+|..++..+.
T Consensus         3 ~~~l~il~l~GvlLli~s~~f~~   25 (186)
T TIGR02830         3 LTYLLVLLLIGLLLLIVSSFFSS   25 (186)
T ss_pred             hHHHHHHHHHHHHHHHhhccccC
Confidence            34456666777776665555443


Done!