Citrus Sinensis ID: 043720

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100---
SGKVLPEKTILLEFKNSVSDPSGILSSWQTNTSSHCSWFGVSCDSESRVVALNITGGDVSEGNSKPFFSCLMTAQFPFYGFGMRRRTCLHGRGKLVGKLSPLVGGLSELRVLSLPFNGFSGEFPPEIWSLEKLEVLDVEGNFLSGRLPNEFVGLRNLRVLNLAFNRIDGDIPFSLRNFESLEVLNLAGNQVKGVIPGFLGSFLKLRVLFLSYNELNGSIPSELGKYCRYLEHLDLSGNSLVGRIPSSLGKCQQLRTLLLFSNMLNDVIPRELGWLRKLEVLDVSRNRLNGLIPTELGNCVELSVLVLSNLFDPLLSGRNIRGELSVGQSDASNGEKNSFIGSIPMEITTLSKLRIIWAPRLNLEGKLPSSWGACESLEMLNLAQNVLRGDLIGVFDRCKKLHFIDLSSNELSGELDVKLQVPCMALFDVSGNHMSGSIPRFDYNVCHQMPLQSSDLCQGYDPSFTYMQYFMSKARLGMPLLVSAARFMVIHNFSGNNFTGPICWLPVAPERLRRRTDYAFLAGANKLTGSFPGSLFQACNEFHGMVANLSNNNIIGHIPLDIGVMCKSLRVLDASHNQISGIVPQSLENLTSLVFLDLNGNKLQGEIPSSLHRLKYLRHLSLADNNLTGGIPSSIGELRSLEVLELSSNSLSGEVPEGVVNLRNLTALLLDNNKLSGHLPSGLANVTSLSIFNASFNNLSGPFPWNVTTMNCSGVIGNPFLDPCQMYKDISSSELTSSNANSQHNITAPTGSRTEDHKIQIASIVSASAIVLILLTLVILFFYVRKGFPDTRVQVSESRELTLFIDIGVPLTYESIIRATGDFNTSNCIGSGGFGTTYKAEISPGILVAVKKLAVGRFQHGVQQFHAEIKTLGNVRHPNLVTLIGYRASGNEMFLIYNYLPGGNLENFIKARTSRAVDWKILHKIALDVASALAYLHDQCAPRVLHRDVKPSNILLDDDFNAYLSDFGLSRLLGTSETHATTGVAGTFGYVAPEYALTCRVSDKADVYSYGVVLLELISDKKALDPSFSSHGDGFNIISWASMLLRQGQVKDVFNAELWASGPHDDLEDMLHLALRCTVETLSTRPTMKQVVQCLKQIQHSPN
cccccHHHHHHHHHHHccccccccccccccccccccccEEEEEcccccEEEEEcccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEECccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccEEEccccCEECcccHHHHcccccccccccccccCCcccccccccccccEEEcccccccccccHHHcccccccEEEcccccccCCcccccccccccEEEccccccCECccccccccccccccccccccccccccccEEEccccEEEEcccHHccccccccEEEcccccccCCcccccccccccccccccEEEcccccccccccHHHHHccccccccEEEcccccccccccHHHHHHcccccEEEccccccccccccHHccccccccEEccccccccccccHHccccccccccccccccccccccHHcccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccEEEccccccEEEEECccccEEEEEEEcccccccccHHHHHHHHHHccccccccccEEEEEEccccEEEEEcccccccHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccECcccccccccccccccEEEcccccHHccccccccCECcccccccccccccccccccccccccEEHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccc
**KVLPEKTILLEFKNSVSDPSGILSSWQTNTSSHCSWFGVSCDSESRVVALNITGGDVSEGNSKPFFSCLMTAQFPFYGFGMRRRTCLHGRGKLVGKLSPLVGGLSELRVLSLPFNGFSGEFPPEIWSLEKLEVLDVEGNFLSGRLPNEFVGLRNLRVLNLAFNRIDGDIPFSLRNFESLEVLNLAGNQVKGVIPGFLGSFLKLRVLFLSYNELNGSIPSELGKYCRYLEHLDLSGNSLVGRIPSSLGKCQQLRTLLLFSNMLNDVIPRELGWLRKLEVLDVSRNRLNGLIPTELGNCVELSVLVLSNLFDPLLSGRNIRGELSVGQSDASNGEKNSFIGSIPMEITTLSKLRIIWAPRLNLEGKLPSSWGACESLEMLNLAQNVLRGDLIGVFDRCKKLHFIDLSSNELSGELDVKLQVPCMALFDVSGNHMSGSIPRFDYNVCHQMPLQSSDLCQGYDPSFTYMQYFMSKARLGMPLLVSAARFMVIHNFSGNNFTGPICWLPVAPERLRRRTDYAFLAGANKLTGSFPGSLFQACNEFHGMVANLSNNNIIGHIPLDIGVMCKSLRVLDASHNQISGIVPQSLENLTSLVFLDLNGNKLQGEIPSSLHRLKYLRHLSLADNNLTGGIPSSIGELRSLEVLELSSNSLSGEVPEGVVNLRNLTALLLDNNKLSGHLPSGLANVTSLSIFNASFNNLSGPFPWNVTTMNCSGVIGNPFLDPCQMYKD****************************KIQIASIVSASAIVLILLTLVILFFYVRKGF***********ELTLFIDIGVPLTYESIIRATGDFNTSNCIGSGGFGTTYKAEISPGILVAVKKLAVGRFQHGVQQFHAEIKTLGNVRHPNLVTLIGYRASGNEMFLIYNYLPGGNLENFIKARTSRAVDWKILHKIALDVASALAYLHDQCAPRVLHRDVKPSNILLDDDFNAYLSDFGLSRLLGTSETHATTGVAGTFGYVAPEYALTCRVSDKADVYSYGVVLLELISDKKALDPSFSSHGDGFNIISWASMLLRQGQVKDVFNAELWASGPHDDLEDMLHLALRCTVETLSTRPTMKQVVQCLKQIQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGKVLPEKTILLEFKNSVSDPSGILSSWQTNTSSHCSWFGVSCDSESRVVALNITGGDVSEGNSKPFFSCLMTAQFPFYGFGMRRRTCLHGRGKLVGKLSPLVGGLSELRVLSLPFNGFSGEFPPEIWSLEKLEVLDVEGNFLSGRLPNEFVGLRNLRVLNLAFNRIDGDIPFSLRNFESLEVLNLAGNQVKGVIPGFLGSFLKLRVLFLSYNELNGSIPSELGKYCRYLEHLDLSGNSLVGRIPSSLGKCQQLRTLLLFSNMLNDVIPRELGWLRKLEVLDVSRNRLNGLIPTELGNCVELSVLVLSNLFDPLLSGRNIRGELSVGQSDASNGEKNSFIGSIPMEITTLSKLRIIWAPRLNLEGKLPSSWGACESLEMLNLAQNVLRGDLIGVFDRCKKLHFIDLSSNELSGELDVKLQVPCMALFDVSGNHMSGSIPRFDYNVCHQMPLQSSDLCQGYDPSFTYMQYFMSKARLGMPLLVSAARFMVIHNFSGNNFTGPICWLPVAPERLRRRTDYAFLAGANKLTGSFPGSLFQACNEFHGMVANLSNNNIIGHIPLDIGVMCKSLRVLDASHNQISGIVPQSLENLTSLVFLDLNGNKLQGEIPSSLHRLKYLRHLSLADNNLTGGIPSSIGELRSLEVLELSSNSLSGEVPEGVVNLRNLTALLLDNNKLSGHLPSGLANVTSLSIFNASFNNLSGPFPWNVTTMNCSGVIGNPFLDPCQMYKDISSSELTSSNANSQHNITAPTGSRTEDHKIQIASIVSASAIVLILLTLVILFFYVRKGFPDTRVQVSESRELTLFIDIGVPLTYESIIRATGDFNTSNCIGSGGFGTTYKAEISPGILVAVKKLAVGRFQHGVQQFHAEIKTLGNVRHPNLVTLIGYRASGNEMFLIYNYLPGGNLENFIKARTSRAVDWKILHKIALDVASALAYLHDQCAPRVLHRDVKPSNILLDDDFNAYLSDFGLSRLLGTSETHATTGVAGTFGYVAPEYALTCRVSDKADVYSYGVVLLELISDKKALDPSFSSHGDGFNIISWASMLLRQGQVKDVFNAELWASGPHDDLEDMLHLALRCTVETLSTRPTMKQVVQCLKQIQHSPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LRR receptor-like serine/threonine-protein kinase RPK2 Key regulator of anther development (e.g. lignification pattern), including tapetum degradation during pollen maturation (e.g. germination capacity). Together with RPK1, required for pattern formation along the radial axis (e.g. the apical embryonic domain cell types that generate cotyledon primordia), and the apical-basal axis (e.g. differentiation of the basal pole during early embryogenesis).probableQ9S7I6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 117-307,359-437,559-677
View the alignment between query and template
View the model in PyMOL
Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 104-309,361-417
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 96-309,337-446,484-732
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 2-59,97-310
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 3-308,336-458,472-725
View the alignment between query and template
View the model in PyMOL
Template: 3QD2, chain B
Confidence level:very confident
Coverage over the Query: 820-1026,1037-1094
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 809-1099
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:confident
Coverage over the Query: 107-325,336-704
View the alignment between query and template
View the model in PyMOL
Template: 2J0K, chain A
Confidence level:probable
Coverage over the Query: 795-969,985-1018
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 760-788
View the alignment between query and template
View the model in PyMOL