BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043785
         (68 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q7Z408|CSMD2_HUMAN CUB and sushi domain-containing protein 2 OS=Homo sapiens GN=CSMD2
            PE=1 SV=2
          Length = 3487

 Score = 28.9 bits (63), Expect = 8.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 24/57 (42%)

Query: 6    FTVAFSAVPLTLYIPPLRSLNLFVETMEDFLRESRIYTNRLYPRARFVWSRVLDCIL 62
            F +AFSA PLT   PP    N  V T  +      I   R  P    V + +L C L
Sbjct: 2282 FAIAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNEILTCKL 2338


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.336    0.146    0.461 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,099,630
Number of Sequences: 539616
Number of extensions: 571033
Number of successful extensions: 2214
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2213
Number of HSP's gapped (non-prelim): 1
length of query: 68
length of database: 191,569,459
effective HSP length: 40
effective length of query: 28
effective length of database: 169,984,819
effective search space: 4759574932
effective search space used: 4759574932
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 55 (25.8 bits)