Citrus Sinensis ID: 043920

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----

MAVSGFPSSVEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAGNDGTVVEKPFIKPNKVMGC

cccccccccccccccccccccEEEEEccccEEcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHccHHHHccccHHHHHHHHHcccEEEEccccHHHHHHHHHHHccccEEEEEEEEEEcEEEEEEEEccccccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHccccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcEEEEEEcccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEccccHHHHHHccHHHcccccHHHHHHHHHHHcccccccccccccccccccEEEEccccccccccccEEEEEEEcccccccccccccccccEEEEEEccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccc

cccccccccHHccccccccccEEEEEEccEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHEHHHccccHHHHHHHHHHHcHHHHHHHccHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccEEEccEEEEEccEEEEEEcccccEccHHHHHHHHHHHccccccccccccccccHHHHHHHHEEEccccccccccccccccccEEEEcccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccEEEEEccccccccccccccEEEEEEcccccccHHHHHHHccccccEEEEEHHHHHHHHcccccEEccccHHHHHHHHHHHHHcccEEEccccccccccEEEEEcHHHHHHHccccEEEEEEEEccEcccccccccccccEEEEcccccEEEEEEccccccHccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccEcccccccHcccccc

mavsgfpssvekcssigrekhtvvadmdgtllrgrssfpyFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVlpkfyasdlhpeswrvfsscgkrcvltanPRIMVEAFLKDFLAADLVLGTEiatykgratglvrdpgvlvgNKKADALLKAFgetqpeiglgdrqtdipfmalckegylvpskpevkavtcdklpkpiifhdgrlvrkpaPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVkgtpppaakkstgqtgvLFVCshrtlldpiflsvalgrpiptvtYSVSRLSEIISPIKAvrlsrdratDASTIKKLLeegdlamcpegttcrepFLLRFSALFAELTDELVPVAMVNRMsmfhgttargwkgmdpfyffmnpcpayevtflnklpmeltcgsgkssHEVANYIQRVIAATLSYESTRFTRKDKYRAlagndgtvvekpfikpnkvmgc

mavsgfpssvekcssigrekhtvvaDMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIAtykgratglvrdpgvLVGNKKADALLKAFgetqpeiglgdrqTDIPFMALCKEGYLVPSKPEVKAVTCDKlpkpiifhdgrlvRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYsvsrlseiispikavrlsrdraTDASTIKklleegdlamcpeGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATlsyestrftrkdkyralagndgtvvekpfikpnkvmgc

MAVSGFPSSVEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEaggilrllflllaspiagllYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAGNDGTVVEKPFIKPNKVMGC

*********************TVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGT*********GQTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAGNDGTVVE************

******P***************VVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKG***********QTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDR***************LAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKL*************EVANYIQRVIAATLSYESTRFTRKDKYRALAGND**************MG*

*************SSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPP********QTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAGNDGTVVEKPFIKPNKVMGC

******************EKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPA*****GQTGVLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAGNDGTVVEKP**********

ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		504	2.2.26 [Sep-21-2011]
O80437		501	Glycerol-3-phosphate 2-O-	yes	no	0.952	0.958	0.552	1e-153
Q9CAY3		502	Glycerol-3-phosphate acyl	no	no	0.926	0.930	0.549	1e-144
Q9LMM0		503	Glycerol-3-phosphate 2-O-	no	no	0.946	0.948	0.542	1e-144
Q5XF03		500	Probable glycerol-3-phosp	no	no	0.932	0.94	0.555	1e-143
Q9LHS7		500	Glycerol-3-phosphate acyl	no	no	0.944	0.952	0.538	1e-141
Q9SHJ5		585	Glycerol-3-phosphate acyl	no	no	0.938	0.808	0.450	1e-115
Q9FZ22		530	Probable glycerol-3-phosp	no	no	0.926	0.881	0.394	7e-94
Q9SYJ2		520	Probable glycerol-3-phosp	no	no	0.910	0.882	0.401	2e-93
P0CAV6		222	Protein CicA OS=Caulobact	yes	no	0.384	0.873	0.287	4e-05
B8GX15		222	Protein CicA OS=Caulobact	yes	no	0.384	0.873	0.287	4e-05

>sp\|O80437\|GPAT6_ARATH Glycerol-3-phosphate 2-O-acyltransferase 6 OS=Arabidopsis thaliana GN=GPAT6 PE=1 SV=1	Back alignment and function desciption

 Score =  540 bits (1392), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 269/487 (55%), Positives = 347/487 (71%), Gaps = 7/487 (1%)

Query: 8   SSVEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLL 67
             + KC    R  HTV AD+DGTLL  RS+FPY+ LVA EAG +LR L LL++ P   L 
Sbjct: 11  EQISKCDVKDRSNHTVAADLDGTLLISRSAFPYYFLVALEAGSLLRALILLVSVPFVYLT 70

Query: 68  YYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLT 127
           Y  +SE+  I V +F +F GL++ D+E V R+VLP+FYA D+ P++WR+F++ GKR ++T
Sbjct: 71  YLTISETLAINVFVFITFAGLKIRDVELVVRSVLPRFYAEDVRPDTWRIFNTFGKRYIIT 130

Query: 128 ANPRIMVEAFLKDFLAADLVLGTEIATYK-GRATGLVRDPGVLVGNKKADALLKAFG--- 183
           A+PRIMVE F+K FL  D VLGTE+   K GRATG  R PG+LVG  K D +L+ FG   
Sbjct: 131 ASPRIMVEPFVKTFLGVDKVLGTELEVSKSGRATGFTRKPGILVGQYKRDVVLREFGGLA 190

Query: 184 ETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLM 243
              P++GLGD +TD  FM++CKEGY+VP + + + +  +KL  PIIFH+GRLV++P PL+
Sbjct: 191 SDLPDLGLGDSKTDHDFMSICKEGYMVP-RTKCEPLPRNKLLSPIIFHEGRLVQRPTPLV 249

Query: 244 ALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGV 303
           ALL  LW P+GF L+ +R+     LP     Y +   G++++V G PPP  K        
Sbjct: 250 ALLTFLWLPVGFVLSIIRVYTNIPLPERIARYNYKLTGIKLVVNGHPPPPPKPGQPGH-- 307

Query: 304 LFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLL 363
           L VC+HRT+LDP+  +VALGR I  VTYS+S+ SE+ISPIKAV L+R R  DA+ IK+LL
Sbjct: 308 LLVCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALTRQREKDAANIKRLL 367

Query: 364 EEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFY 423
           EEGDL +CPEGTTCREPFLLRFSALFAELTD +VPVA+  + SMF+GTT RG+K +DP++
Sbjct: 368 EEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFNGTTTRGYKLLDPYF 427

Query: 424 FFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRAL 483
            FMNP P YE+TFL ++P ELTC  GKS  EVANYIQRV+  TL +E T FTRKDKY  L
Sbjct: 428 AFMNPRPTYEITFLKQIPAELTCKGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYAML 487

Query: 484 AGNDGTV 490
           AG DG V
Sbjct: 488 AGTDGRV 494

Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 5

>sp\|Q9CAY3\|GPAT5_ARATH Glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=GPAT5 PE=1 SV=1	Back alignment and function description

>sp\|Q9LMM0\|GPAT4_ARATH Glycerol-3-phosphate 2-O-acyltransferase 4 OS=Arabidopsis thaliana GN=GPAT4 PE=1 SV=1	Back alignment and function description

>sp\|Q5XF03\|GPAT8_ARATH Probable glycerol-3-phosphate acyltransferase 8 OS=Arabidopsis thaliana GN=GPAT8 PE=2 SV=1	Back alignment and function description

>sp\|Q9LHS7\|GPAT7_ARATH Glycerol-3-phosphate acyltransferase 7 OS=Arabidopsis thaliana GN=GPAT7 PE=1 SV=1	Back alignment and function description

>sp\|Q9SHJ5\|GPAT1_ARATH Glycerol-3-phosphate acyltransferase 1 OS=Arabidopsis thaliana GN=GPAT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9FZ22\|GPAT2_ARATH Probable glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=GPAT2 PE=2 SV=1	Back alignment and function description

>sp\|Q9SYJ2\|GPAT3_ARATH Probable glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=GPAT3 PE=2 SV=1	Back alignment and function description

>sp\|P0CAV6\|CICA_CAUCR Protein CicA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cicA PE=4 SV=1	Back alignment and function description

>sp\|B8GX15\|CICA_CAUCN Protein CicA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cicA PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		504
224138190		501	predicted protein [Populus trichocarpa]	0.994	1.0	0.856	0.0
224091505		501	predicted protein [Populus trichocarpa]	0.988	0.994	0.855	0.0
255558288		504	ER glycerol-phosphate acyltransferase [R	0.994	0.994	0.858	0.0
225452611		510	PREDICTED: glycerol-3-phosphate acyltran	0.984	0.972	0.826	0.0
388894442		526	required for arbuscular mycorrhization 2	0.996	0.954	0.818	0.0
225424841		503	PREDICTED: glycerol-3-phosphate acyltran	0.998	1.0	0.845	0.0
356577516		512	PREDICTED: glycerol-3-phosphate acyltran	0.998	0.982	0.824	0.0
357439161		568	ER glycerol-phosphate acyltransferase [M	0.996	0.883	0.818	0.0
356533281		509	PREDICTED: glycerol-3-phosphate acyltran	0.998	0.988	0.823	0.0
449459508		511	PREDICTED: glycerol-3-phosphate 2-O-acyl	0.982	0.968	0.798	0.0

>gi\|224138190\|ref\|XP_002322752.1\| predicted protein [Populus trichocarpa] gi\|222867382\|gb\|EEF04513.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/502 (85%), Positives = 461/502 (91%), Gaps = 1/502 (0%)

Query: 3   VSGFPSSVEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASP 62
           +  FP+ V+KC+SIGREKHTVVADMDGTLLRGRSSFPYFAL+AFEAGGI RL+FLLLASP
Sbjct: 1   MDSFPT-VDKCASIGREKHTVVADMDGTLLRGRSSFPYFALLAFEAGGIFRLIFLLLASP 59

Query: 63  IAGLLYYLVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGK 122
           +AGLLYY VSESAGI+VLIFA+  G++V+DIESVARAVLPKFY+SDLH ESWRVFSSCGK
Sbjct: 60  LAGLLYYFVSESAGIKVLIFATCAGMKVSDIESVARAVLPKFYSSDLHSESWRVFSSCGK 119

Query: 123 RCVLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADALLKAF 182
           RCVLTANPRIMVEAFLKDFL ADLVLGTE++TYKGRATG V+ PGVLVG  KADAL KAF
Sbjct: 120 RCVLTANPRIMVEAFLKDFLGADLVLGTEMSTYKGRATGFVQSPGVLVGKNKADALKKAF 179

Query: 183 GETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPL 242
           G TQPEIGLGDR TD PFMALCKEGY+VP KPEV+AVT DKLPKP+IFHDGRLV+KP PL
Sbjct: 180 GMTQPEIGLGDRHTDAPFMALCKEGYIVPPKPEVEAVTTDKLPKPVIFHDGRLVQKPTPL 239

Query: 243 MALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTG 302
            ALL ILW PIGF LACLRIAAG+LLPM  VYYAFWALGVRVI+KGTPPP AKKS GQ+G
Sbjct: 240 SALLTILWIPIGFILACLRIAAGSLLPMPMVYYAFWALGVRVIIKGTPPPPAKKSIGQSG 299

Query: 303 VLFVCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKL 362
           VLF+CSHRTLLDPIFLS ALGRPIP VTYSVSRLSEIISPIK VRLSRDRATDAS IKKL
Sbjct: 300 VLFICSHRTLLDPIFLSTALGRPIPAVTYSVSRLSEIISPIKTVRLSRDRATDASMIKKL 359

Query: 363 LEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPF 422
           LEEGDLA+CPEGTTCREPFLLRFSALFAELTD+LVPVA+VNRMSMFHGTTARGWKGMDPF
Sbjct: 360 LEEGDLAICPEGTTCREPFLLRFSALFAELTDQLVPVAVVNRMSMFHGTTARGWKGMDPF 419

Query: 423 YFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRA 482
           YFFMNP PAYEVTFLN+LP ELTC  GKSSHEVANYIQRVIAATLSYE T FTR+DKYRA
Sbjct: 420 YFFMNPSPAYEVTFLNRLPQELTCTGGKSSHEVANYIQRVIAATLSYECTSFTRRDKYRA 479

Query: 483 LAGNDGTVVEKPFIKPNKVMGC 504
           LAGNDGTVVEK  ++ NKVMGC
Sbjct: 480 LAGNDGTVVEKTKLQANKVMGC 501

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224091505\|ref\|XP_002309276.1\| predicted protein [Populus trichocarpa] gi\|222855252\|gb\|EEE92799.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255558288\|ref\|XP_002520171.1\| ER glycerol-phosphate acyltransferase [Ricinus communis] gi\|223540663\|gb\|EEF42226.1\| ER glycerol-phosphate acyltransferase [Ricinus communis]	Back alignment and taxonomy information

>gi\|225452611\|ref\|XP_002276032.1\| PREDICTED: glycerol-3-phosphate acyltransferase 6 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|388894442\|gb\|AFK81970.1\| required for arbuscular mycorrhization 2 [Medicago truncatula] gi\|388894446\|gb\|AFK81972.1\| required for arbuscular mycorrhization 2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|225424841\|ref\|XP_002268513.1\| PREDICTED: glycerol-3-phosphate acyltransferase 6 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356577516\|ref\|XP_003556870.1\| PREDICTED: glycerol-3-phosphate acyltransferase 6-like [Glycine max]	Back alignment and taxonomy information

>gi\|357439161\|ref\|XP_003589857.1\| ER glycerol-phosphate acyltransferase [Medicago truncatula] gi\|355478905\|gb\|AES60108.1\| ER glycerol-phosphate acyltransferase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356533281\|ref\|XP_003535194.1\| PREDICTED: glycerol-3-phosphate acyltransferase 6-like [Glycine max]	Back alignment and taxonomy information

>gi\|449459508\|ref\|XP_004147488.1\| PREDICTED: glycerol-3-phosphate 2-O-acyltransferase 6-like [Cucumis sativus] gi\|449515732\|ref\|XP_004164902.1\| PREDICTED: glycerol-3-phosphate 2-O-acyltransferase 6-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		504
TAIR\|locus:2042947		501	GPAT6 "GLYCEROL-3-PHOSPHATE sn	0.954	0.960	0.540	4.9e-140
TAIR\|locus:2126101		500	GPAT8 "GLYCEROL-3-PHOSPHATE sn	0.952	0.96	0.532	1e-130
TAIR\|locus:2025381		503	GPAT4 "GLYCEROL-3-PHOSPHATE sn	0.952	0.954	0.529	2.8e-130
TAIR\|locus:2080687		502	GPAT5 "GLYCEROL-3-PHOSPHATE sn	0.926	0.930	0.533	2.6e-127
TAIR\|locus:2152825		500	GPAT7 "GLYCEROL-3-PHOSPHATE sn	0.936	0.944	0.521	1.9e-124
TAIR\|locus:2009225		585	GPAT1 "GLYCEROL-3-PHOSPHATE sn	0.938	0.808	0.434	4.9e-101
TAIR\|locus:2204818		530	GPAT2 "GLYCEROL-3-PHOSPHATE sn	0.942	0.896	0.378	3.1e-83
TAIR\|locus:2141410		520	GPAT3 "GLYCEROL-3-PHOSPHATE sn	0.942	0.913	0.393	3.9e-83
ZFIN\|ZDB-GENE-030131-3375		423	aup1 "ancient ubiquitous prote	0.448	0.534	0.272	7.9e-06

TAIR\|locus:2042947 GPAT6 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1370 (487.3 bits), Expect = 4.9e-140, P = 4.9e-140
 Identities = 264/488 (54%), Positives = 339/488 (69%)

Query:    10 VEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEXXXXXXXXXXXXXXXXXXXXYY 69
             + KC    R  HTV AD+DGTLL  RS+FPY+ LVA E                    Y 
Sbjct:    13 ISKCDVKDRSNHTVAADLDGTLLISRSAFPYYFLVALEAGSLLRALILLVSVPFVYLTYL 72

Query:    70 LVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTAN 129
              +SE+  I V +F +F GL++ D+E V R+VLP+FYA D+ P++WR+F++ GKR ++TA+
Sbjct:    73 TISETLAINVFVFITFAGLKIRDVELVVRSVLPRFYAEDVRPDTWRIFNTFGKRYIITAS 132

Query:   130 PRIMVEAFLKDFLAADLVLGTEIATYK-GRATGLVRDPGVLVGNKKADALLKAFG---ET 185
             PRIMVE F+K FL  D VLGTE+   K GRATG  R PG+LVG  K D +L+ FG     
Sbjct:   133 PRIMVEPFVKTFLGVDKVLGTELEVSKSGRATGFTRKPGILVGQYKRDVVLREFGGLASD 192

Query:   186 QPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMAL 245
              P++GLGD +TD  FM++CKEGY+VP + + + +  +KL  PIIFH+GRLV++P PL+AL
Sbjct:   193 LPDLGLGDSKTDHDFMSICKEGYMVP-RTKCEPLPRNKLLSPIIFHEGRLVQRPTPLVAL 251

Query:   246 LIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGVLF 305
             L  LW P+GF L+ +R+     LP     Y +   G++++V G PPP  K   GQ G L 
Sbjct:   252 LTFLWLPVGFVLSIIRVYTNIPLPERIARYNYKLTGIKLVVNGHPPPPPKP--GQPGHLL 309

Query:   306 VCSHRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEE 365
             VC+HRT+LDP+  +VALGR I  VTYS+S+ SE+ISPIKAV L+R R  DA+ IK+LLEE
Sbjct:   310 VCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALTRQREKDAANIKRLLEE 369

Query:   366 GDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFF 425
             GDL +CPEGTTCREPFLLRFSALFAELTD +VPVA+  + SMF+GTT RG+K +DP++ F
Sbjct:   370 GDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFNGTTTRGYKLLDPYFAF 429

Query:   426 MNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAG 485
             MNP P YE+TFL ++P ELTC  GKS  EVANYIQRV+  TL +E T FTRKDKY  LAG
Sbjct:   430 MNPRPTYEITFLKQIPAELTCKGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYAMLAG 489

Query:   486 NDGTVVEK 493
              DG V  K
Sbjct:   490 TDGRVPVK 497

GO:0005739 "mitochondrion" evidence=ISM

GO:0008152 "metabolic process" evidence=IEA;ISS

GO:0016746 "transferase activity, transferring acyl groups" evidence=ISS

GO:0009908 "flower development" evidence=IMP

GO:0010143 "cutin biosynthetic process" evidence=IMP

GO:0016791 "phosphatase activity" evidence=IDA

GO:0006655 "phosphatidylglycerol biosynthetic process" evidence=RCA

GO:0090447 "glycerol-3-phosphate 2-O-acyltransferase activity" evidence=IDA

TAIR\|locus:2126101 GPAT8 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2025381 GPAT4 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2080687 GPAT5 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2152825 GPAT7 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2009225 GPAT1 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2204818 GPAT2 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2141410 GPAT3 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-3375 aup1 "ancient ubiquitous protein 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O80437	GPAT6_ARATH	2, ., 3, ., 1, ., 1, 5	0.5523	0.9523	0.9580	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.1.15	0.946
3rd Layer	2.3.1	0.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_XVI000515	hypothetical protein (501 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		504
PLN02177		497	PLN02177, PLN02177, glycerol-3-phosphate acyltrans	0.0
PLN02499		498	PLN02499, PLN02499, glycerol-3-phosphate acyltrans	0.0
PLN02588		525	PLN02588, PLN02588, glycerol-3-phosphate acyltrans	1e-120
cd06551		187	cd06551, LPLAT, Lysophospholipid acyltransferases	3e-22
COG0560		212	COG0560, SerB, Phosphoserine phosphatase [Amino ac	5e-13
smart00563		118	smart00563, PlsC, Phosphate acyltransferases	2e-11
TIGR01490		202	TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfami	5e-10
cd07989		184	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltr	1e-09
pfam01553		131	pfam01553, Acyltransferase, Acyltransferase	1e-08
COG0204		255	COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyl	2e-06
cd07991		211	cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acylt	1e-05
TIGR00530		130	TIGR00530, AGP_acyltrn, 1-acyl-sn-glycerol-3-phosp	6e-04
TIGR01488		177	TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superf	0.003
pfam00702		187	pfam00702, Hydrolase, haloacid dehalogenase-like h	0.004

>gnl\|CDD\|215118 PLN02177, PLN02177, glycerol-3-phosphate acyltransferase	Back alignment and domain information

 Score =  650 bits (1679), Expect = 0.0
 Identities = 296/485 (61%), Positives = 366/485 (75%), Gaps = 4/485 (0%)

Query: 10  VEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYY 69
           + KCSS GR   TV AD+DGTLL  RS+FPY+ LVA EAG +LR L LLL+ P     Y 
Sbjct: 12  ISKCSSEGRSNQTVAADLDGTLLISRSAFPYYLLVALEAGSLLRALILLLSVPFVYFTYL 71

Query: 70  LVSESAGIQVLIFASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTAN 129
            +SES  I+  +F +F GL++ DIE V+R+VLPKFYA D+HPE+WRVF+S GKR ++TA+
Sbjct: 72  FISESLAIKTFVFIAFAGLKIRDIELVSRSVLPKFYAEDVHPETWRVFNSFGKRYIITAS 131

Query: 130 PRIMVEAFLKDFLAADLVLGTEI-ATYKGRATGLVRDPGVLVGNKKADALLKAFGETQPE 188
           PRIMVE F+K FL AD VLGTE+  +  GRATG ++ PGVLVG+ K DA+LK FG+  P+
Sbjct: 132 PRIMVEPFVKTFLGADKVLGTELEVSKSGRATGFMKKPGVLVGDHKRDAVLKEFGDALPD 191

Query: 189 IGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPLMALLII 248
           +GLGDR+TD  FM++CKEGY+VP   + + +  +KL  P+IFH+GRLV++P PL+ALL  
Sbjct: 192 LGLGDRETDHDFMSICKEGYMVPRT-KCEPLPRNKLLSPVIFHEGRLVQRPTPLVALLTF 250

Query: 249 LWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGVLFVCS 308
           LW PIGF L+ LR+     LP     Y +  LG+R+IVKG PPP  KK  GQ GVLFVC+
Sbjct: 251 LWMPIGFILSLLRVYLNIPLPERIARYNYKLLGIRLIVKGNPPPPPKK--GQPGVLFVCN 308

Query: 309 HRTLLDPIFLSVALGRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDL 368
           HRT+LDP+  +VALGR I  VTYS+S+ SE+ISPIKAV LSR+R  DA+ IK+LLEEGDL
Sbjct: 309 HRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALSREREKDAANIKRLLEEGDL 368

Query: 369 AMCPEGTTCREPFLLRFSALFAELTDELVPVAMVNRMSMFHGTTARGWKGMDPFYFFMNP 428
            +CPEGTTCREPFLLRFSALFAELTD +VPVA+  + SMFHGTT RG+K +DP++ FMNP
Sbjct: 369 VICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFHGTTVRGYKLLDPYFVFMNP 428

Query: 429 CPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRALAGNDG 488
            P YE+TFLN+LP ELTC  GKS  EVANYIQRV+A TL +E T  TRKDKY  LAG DG
Sbjct: 429 RPTYEITFLNQLPKELTCKGGKSPIEVANYIQRVLAGTLGFECTNLTRKDKYAILAGTDG 488

Query: 489 TVVEK 493
            V  K
Sbjct: 489 RVPSK 493

Length = 497

>gnl\|CDD\|178115 PLN02499, PLN02499, glycerol-3-phosphate acyltransferase	Back alignment and domain information

>gnl\|CDD\|215320 PLN02588, PLN02588, glycerol-3-phosphate acyltransferase	Back alignment and domain information

>gnl\|CDD\|153244 cd06551, LPLAT, Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis	Back alignment and domain information

>gnl\|CDD\|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|214724 smart00563, PlsC, Phosphate acyltransferases	Back alignment and domain information

>gnl\|CDD\|233436 TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>gnl\|CDD\|153251 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like	Back alignment and domain information

>gnl\|CDD\|216567 pfam01553, Acyltransferase, Acyltransferase	Back alignment and domain information

>gnl\|CDD\|223282 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|153253 cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like	Back alignment and domain information

>gnl\|CDD\|129621 TIGR00530, AGP_acyltrn, 1-acyl-sn-glycerol-3-phosphate acyltransferases	Back alignment and domain information

>gnl\|CDD\|233435 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>gnl\|CDD\|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		504
PLN02177		497	glycerol-3-phosphate acyltransferase	100.0
PLN02499		498	glycerol-3-phosphate acyltransferase	100.0
PLN02588		525	glycerol-3-phosphate acyltransferase	100.0
KOG2848		276	consensus 1-acyl-sn-glycerol-3-phosphate acyltrans	100.0
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	100.0
cd07991		211	LPLAT_LPCAT1-like Lysophospholipid Acyltransferase	100.0
PRK15018		245	1-acyl-sn-glycerol-3-phosphate acyltransferase; Pr	99.98
PRK11590		211	hypothetical protein; Provisional	99.97
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	99.97
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	99.97
PLN02833		376	glycerol acyltransferase family protein	99.96
PLN02901		214	1-acyl-sn-glycerol-3-phosphate acyltransferase	99.94
PTZ00261		355	acyltransferase; Provisional	99.94
cd07992		203	LPLAT_AAK14816-like Lysophospholipid Acyltransfera	99.92
cd07988		163	LPLAT_ABO13168-like Lysophospholipid Acyltransfera	99.91
COG0204		255	PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferas	99.9
cd07986		210	LPLAT_ACT14924-like Lysophospholipid Acyltransfera	99.89
PRK06814		1140	acylglycerophosphoethanolamine acyltransferase; Pr	99.89
PRK08043		718	bifunctional acyl-[acyl carrier protein] synthetas	99.89
PRK08633		1146	2-acyl-glycerophospho-ethanolamine acyltransferase	99.89
PLN02783		315	diacylglycerol O-acyltransferase	99.88
cd07987		212	LPLAT_MGAT-like Lysophospholipid Acyltransferases	99.86
cd07993		205	LPLAT_DHAPAT-like Lysophospholipid Acyltransferase	99.85
PRK14014		301	putative acyltransferase; Provisional	99.85
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	99.84
PRK08238		479	hypothetical protein; Validated	99.83
TIGR00530		130	AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltra	99.82
cd06551		187	LPLAT Lysophospholipid acyltransferases (LPLATs) o	99.82
PRK03355		783	glycerol-3-phosphate acyltransferase; Validated	99.82
cd07985		235	LPLAT_GPAT Lysophospholipid Acyltransferases (LPLA	99.81
cd07983		189	LPLAT_DUF374-like Lysophospholipid Acyltransferase	99.8
PRK11133		322	serB phosphoserine phosphatase; Provisional	99.8
PF01553		132	Acyltransferase: Acyltransferase; InterPro: IPR002	99.79
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	99.78
PRK04974		818	glycerol-3-phosphate acyltransferase; Validated	99.76
TIGR03703		799	plsB glycerol-3-phosphate O-acyltransferase. Membe	99.76
cd07989		184	LPLAT_AGPAT-like Lysophospholipid Acyltransferases	99.76
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	99.72
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	99.71
PLN02510		374	probable 1-acyl-sn-glycerol-3-phosphate acyltransf	99.69
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	99.66
cd07990		193	LPLAT_LCLAT1-like Lysophospholipid Acyltransferase	99.65
PTZ00374		1108	dihydroxyacetone phosphate acyltransferase; Provis	99.65
PLN02380		376	1-acyl-sn-glycerol-3-phosphate acyltransferase	99.62
smart00563		118	PlsC Phosphate acyltransferases. Function in phosp	99.62
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	99.6
PRK11915		621	glycerol-3-phosphate acyltransferase; Reviewed	99.56
cd07984		192	LPLAT_LABLAT-like Lysophospholipid Acyltransferase	99.55
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	99.52
PLN02954		224	phosphoserine phosphatase	99.45
KOG1615		227	consensus Phosphoserine phosphatase [Amino acid tr	99.27
PRK13582		205	thrH phosphoserine phosphatase; Provisional	99.27
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	99.26
KOG4666		412	consensus Predicted phosphate acyltransferase, con	99.25
KOG2847		286	consensus Phosphate acyltransferase [Lipid transpo	99.21
KOG1505		346	consensus Lysophosphatidic acid acyltransferase LP	98.78
COG4359		220	Uncharacterized conserved protein [Function unknow	98.75
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	98.73
KOG2898		354	consensus Predicted phosphate acyltransferase, con	98.72
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	98.69
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	98.68
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	98.67
COG2937		810	PlsB Glycerol-3-phosphate O-acyltransferase [Lipid	98.64
PRK13222		226	phosphoglycolate phosphatase; Provisional	98.64
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	98.63
PRK13223		272	phosphoglycolate phosphatase; Provisional	98.56
PRK08419		298	lipid A biosynthesis lauroyl acyltransferase; Revi	98.37
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	98.36
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	98.36
PRK13226		229	phosphoglycolate phosphatase; Provisional	98.36
PRK13288		214	pyrophosphatase PpaX; Provisional	98.32
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	98.3
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	98.29
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	98.28
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	98.26
COG0546		220	Gph Predicted phosphatases [General function predi	98.26
PF00702		215	Hydrolase: haloacid dehalogenase-like hydrolase; I	98.26
KOG3120		256	consensus Predicted haloacid dehalogenase-like hyd	98.25
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	98.24
PRK12702		302	mannosyl-3-phosphoglycerate phosphatase; Reviewed	98.24
KOG3729		715	consensus Mitochondrial glycerol-3-phosphate acylt	98.23
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	98.22
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	98.15
PLN02349		426	glycerol-3-phosphate acyltransferase	98.13
PRK13225		273	phosphoglycolate phosphatase; Provisional	98.13
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	98.11
PLN02575		381	haloacid dehalogenase-like hydrolase	98.11
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	98.1
TIGR01497		675	kdpB K+-transporting ATPase, B subunit. One sequen	98.1
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	98.05
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	98.04
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	98.03
KOG3730		685	consensus Acyl-CoA:dihydroxyactetone-phosphate acy	98.0
PHA02597		197	30.2 hypothetical protein; Provisional	97.99
PRK11587		218	putative phosphatase; Provisional	97.98
COG2121		214	Uncharacterized protein conserved in bacteria [Fun	97.98
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	97.98
COG4030		315	Uncharacterized protein conserved in archaea [Func	97.97
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	97.96
PRK14988		224	GMP/IMP nucleotidase; Provisional	97.95
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	97.91
PRK07920		298	lipid A biosynthesis lauroyl acyltransferase; Prov	97.86
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	97.84
PLN02940		382	riboflavin kinase	97.84
PRK10563		221	6-phosphogluconate phosphatase; Provisional	97.76
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	97.73
PRK09449		224	dUMP phosphatase; Provisional	97.7
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	97.69
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	97.66
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	97.65
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	97.64
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	97.63
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	97.58
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	97.56
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	97.51
TIGR01511		562	ATPase-IB1_Cu copper-(or silver)-translocating P-t	97.5
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	97.5
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	97.45
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	97.41
PRK01122		679	potassium-transporting ATPase subunit B; Provision	97.38
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	97.38
COG1560		308	HtrB Lauroyl/myristoyl acyltransferase [Cell envel	97.38
TIGR01525		556	ATPase-IB_hvy heavy metal translocating P-type ATP	97.37
PRK10671		834	copA copper exporting ATPase; Provisional	97.29
TIGR01512		536	ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo	97.28
PRK14010		673	potassium-transporting ATPase subunit B; Provision	97.21
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	97.11
TIGR01524		867	ATPase-IIIB_Mg magnesium-translocating P-type ATPa	97.04
PF03279		295	Lip_A_acyltrans: Bacterial lipid A biosynthesis ac	96.94
PRK10976		266	putative hydrolase; Provisional	96.93
PRK10513		270	sugar phosphate phosphatase; Provisional	96.88
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	96.88
PRK10530		272	pyridoxal phosphate (PLP) phosphatase; Provisional	96.86
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	96.81
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	96.78
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	96.77
PRK06628		290	lipid A biosynthesis lauroyl acyltransferase; Prov	96.72
TIGR01482		225	SPP-subfamily Sucrose-phosphate phosphatase subfam	96.71
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	96.71
PRK06553		308	lipid A biosynthesis lauroyl acyltransferase; Prov	96.68
TIGR01487		215	SPP-like sucrose-phosphate phosphatase-like hydrol	96.64
PRK15126		272	thiamin pyrimidine pyrophosphate hydrolase; Provis	96.64
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	96.62
PRK06946		293	lipid A biosynthesis lauroyl acyltransferase; Prov	96.61
PRK10748		238	flavin mononucleotide phosphatase; Provisional	96.54
PRK10517		902	magnesium-transporting ATPase MgtA; Provisional	96.46
TIGR01523		1053	ATPase-IID_K-Na potassium and/or sodium efflux P-t	96.45
TIGR01517		941	ATPase-IIB_Ca plasma-membrane calcium-translocatin	96.45
TIGR01116		917	ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium	96.44
PRK15122		903	magnesium-transporting ATPase; Provisional	96.44
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	96.42
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	96.31
PRK01158		230	phosphoglycolate phosphatase; Provisional	96.31
PLN02887		580	hydrolase family protein	96.3
COG3700		237	AphA Acid phosphatase (class B) [General function	96.28
TIGR01647		755	ATPase-IIIA_H plasma-membrane proton-efflux P-type	96.28
PRK06860		309	lipid A biosynthesis lauroyl acyltransferase; Prov	96.25
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	96.23
PF08235		157	LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209	96.22
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	96.18
COG4087		152	Soluble P-type ATPase [General function prediction	96.16
TIGR00099		256	Cof-subfamily Cof subfamily of IIB subfamily of ha	96.04
TIGR01522		884	ATPase-IIA2_Ca golgi membrane calcium-translocatin	95.96
TIGR02208		305	lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl)	95.89
PRK08943		314	lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA ac	95.89
PRK05646		310	lipid A biosynthesis lauroyl acyltransferase; Prov	95.88
TIGR02207		303	lipid_A_htrB lipid A biosynthesis lauroyl (or palm	95.82
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	95.76
TIGR01106		997	ATPase-IIC_X-K sodium or proton efflux -- potassiu	95.75
COG2216		681	KdpB High-affinity K+ transport system, ATPase cha	95.66
TIGR02471		236	sucr_syn_bact_C sucrose phosphate synthase, sucros	95.64
PRK08706		289	lipid A biosynthesis lauroyl acyltransferase; Prov	95.63
PF03982		297	DAGAT: Diacylglycerol acyltransferase ; InterPro:	95.62
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	95.51
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	95.5
PRK08905		289	lipid A biosynthesis lauroyl acyltransferase; Vali	95.47
PRK08733		306	lipid A biosynthesis lauroyl acyltransferase; Prov	95.4
PRK08734		305	lipid A biosynthesis lauroyl acyltransferase; Prov	95.13
COG0474		917	MgtA Cation transport ATPase [Inorganic ion transp	95.11
TIGR01486		256	HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph	95.09
PLN02382		413	probable sucrose-phosphatase	95.06
TIGR01494		499	ATPase_P-type ATPase, P-type (transporting), HAD s	94.95
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	94.91
PRK05906		454	lipid A biosynthesis lauroyl acyltransferase; Prov	94.9
PRK08025		305	lipid A biosynthesis palmitoleoyl acyltransferase;	94.84
PTZ00174		247	phosphomannomutase; Provisional	94.72
PRK05645		295	lipid A biosynthesis lauroyl acyltransferase; Prov	94.24
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	94.08
PLN02811		220	hydrolase	93.97
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	93.91
TIGR01485		249	SPP_plant-cyano sucrose-6F-phosphate phosphohydrol	93.79
PF05822		246	UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter	93.61
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	93.35
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	93.17
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	93.09
TIGR01657		1054	P-ATPase-V P-type ATPase of unknown pump specifici	92.98
TIGR01484		204	HAD-SF-IIB HAD-superfamily hydrolase, subfamily II	92.81
KOG0202		972	consensus Ca2+ transporting ATPase [Inorganic ion	91.99
COG3769		274	Predicted hydrolase (HAD superfamily) [General fun	91.98
PF05116		247	S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter	91.67
COG5663		194	Uncharacterized conserved protein [Function unknow	91.2
TIGR01652		1057	ATPase-Plipid phospholipid-translocating P-type AT	90.67
PF08645		159	PNK3P: Polynucleotide kinase 3 phosphatase; InterP	90.66
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	90.55
PHA02530		300	pseT polynucleotide kinase; Provisional	88.51
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	87.8
KOG3109		244	consensus Haloacid dehalogenase-like hydrolase [Ge	87.75
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	87.69
TIGR01662		132	HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I	87.5
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	87.2
COG3176		292	Putative hemolysin [General function prediction on	86.94
PF11019		252	DUF2608: Protein of unknown function (DUF2608); In	86.68
PLN03190		1178	aminophospholipid translocase; Provisional	86.22
KOG4666		412	consensus Predicted phosphate acyltransferase, con	85.99
PTZ00174		247	phosphomannomutase; Provisional	85.53
PRK01158		230	phosphoglycolate phosphatase; Provisional	85.14
PLN02423		245	phosphomannomutase	85.06
TIGR01689		126	EcbF-BcbF capsule biosynthesis phosphatase. Due to	85.0
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	83.45
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	82.96
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	82.18
TIGR01656		147	Histidinol-ppas histidinol-phosphate phosphatase f	81.74
KOG0210		1051	consensus P-type ATPase [Inorganic ion transport a	81.55
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	81.49
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	80.69

>PLN02177 glycerol-3-phosphate acyltransferase	Back alignment and domain information

Probab=100.00  E-value=1.4e-95  Score=767.68  Aligned_cols=490  Identities=61%  Similarity=1.040  Sum_probs=442.9

Q ss_pred             cCCCCcccccccCCCcceEEEEecCCccccCCCcHHHHHHHHHHhcchHHHHHHHHhhHHHHHhhccccccHHHHHHHHH
Q 043920            4 SGFPSSVEKCSSIGREKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLIFA   83 (504)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~a~FD~DgTL~~~ds~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~   83 (504)
                      |-+.++.++|++.+++...++|||||||++++|++.+|.+++.+.+++.+.+.++..+|.+++.+....++..++.+++.
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~FDfDGTLt~~~s~f~~Fll~A~~~~~~~r~lllll~~P~~~l~~~~~~~~~~~~~l~~~   85 (497)
T PLN02177          6 SRRFEPISKCSSEGRSNQTVAADLDGTLLISRSAFPYYLLVALEAGSLLRALILLLSVPFVYFTYLFISESLAIKTFVFI   85 (497)
T ss_pred             cCCCCccccCCcccccccEEEEecCCcccCCCCccHHHHHHHcccchHHHHHHHHHHhHHHHHHHhcCCchhHHHHHHHH
Confidence            44566899999999999999999999999999999877766666566777776777778887655444555557788888


Q ss_pred             HhcCCCHHHHHHHHHHHcchhhhcccCHHHHHHHhhCCCEEEEecCcHHHHHHHHHhhcCCcEEEeeeEEE-eCCeeeee
Q 043920           84 SFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSCGKRCVLTANPRIMVEAFLKDFLAADLVLGTEIAT-YKGRATGL  162 (504)
Q Consensus        84 ~~~G~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~vvvSas~~~~v~~ia~~~Lg~d~vigt~l~~-~~g~~tG~  162 (504)
                      +++|++.+++++++++|+++++.+.+++++++.++++|+++|||||++.+|+|||+++||+|+|+||++++ .||++||+
T Consensus        86 ~f~G~~~~el~~~~r~~l~~f~~~~l~~~a~~~~~~~g~~vvVSASp~~~Vepfa~~~LGid~VIgTeLev~~~G~~TG~  165 (497)
T PLN02177         86 AFAGLKIRDIELVSRSVLPKFYAEDVHPETWRVFNSFGKRYIITASPRIMVEPFVKTFLGADKVLGTELEVSKSGRATGF  165 (497)
T ss_pred             HHcCCCHHHHHHHHHHHHHHHHHHhcCHHHHHHHHhCCCEEEEECCcHHHHHHHHHHcCCCCEEEecccEECcCCEEeee
Confidence            99999999999999999999888999999999999999888899999999999997658999999999999 59999999


Q ss_pred             EeCCCCCCchhHHHHHHHHhCCCCCeEEEeCCCCCHHHHhhcccCeeeCCCcchhccccccCCCceeeeCCCccCCcchh
Q 043920          163 VRDPGVLVGNKKADALLKAFGETQPEIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPIIFHDGRLVRKPAPL  242 (504)
Q Consensus       163 i~g~~~l~g~~Kv~~l~~~~~~~~~~~aygDS~~DlpmL~~a~~~~~Vnp~~~l~~~A~~~~~W~i~f~~~r~~~~~~~~  242 (504)
                      +.|+||.+|++|++++++.++....++|||||.+|+|||++|+++++||+++ ++.++++++..|+||||||++++|++.
T Consensus       166 i~g~~~c~Ge~Kv~rl~~~~g~~~~~~aYgDS~sD~plL~~a~e~y~V~~~~-~~~~~~~~~~~~~~fhdgrl~~~p~~~  244 (497)
T PLN02177        166 MKKPGVLVGDHKRDAVLKEFGDALPDLGLGDRETDHDFMSICKEGYMVPRTK-CEPLPRNKLLSPVIFHEGRLVQRPTPL  244 (497)
T ss_pred             ecCCCCCccHHHHHHHHHHhCCCCceEEEECCccHHHHHHhCCccEEeCCCC-CCcCCcccCCCceeeeCCcccCCCCHH
Confidence            9998644999999999988875434589999999999999999999999966 898999888899999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhHhHHHHhhhhcceEEEEcCCCCCCCCCCCCCCcEEEEecCCCCChHHHHHHhh
Q 043920          243 MALLIILWTPIGFFLACLRIAAGALLPMSTVYYAFWALGVRVIVKGTPPPAAKKSTGQTGVLFVCSHRTLLDPIFLSVAL  322 (504)
Q Consensus       243 ~~l~~~~~~P~g~~~~~~r~~~~~~l~~~~~~~~~~~~Gi~v~v~G~~~~~~~~~~~~~~~viVaNH~S~lD~~~l~~~~  322 (504)
                      ++|++++|+|+|++++++|+++++.+|.+|.+.+++++|++++|+|.+|+|...  .++++|+||||+|++|+++++.++
T Consensus       245 ~~l~~~~~~p~g~~l~~~r~~~~~~lp~~~~~~~~~~~Gv~v~v~G~e~~p~~~--~~~~~l~v~NHqS~lD~~~l~~al  322 (497)
T PLN02177        245 VALLTFLWMPIGFILSLLRVYLNIPLPERIARYNYKLLGIRLIVKGNPPPPPKK--GQPGVLFVCNHRTVLDPVVTAVAL  322 (497)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHcCcEEEEEcCCCCCccc--CCCCeEEEECCCCcchHHHHHHHc
Confidence            999999999999999999999999999999999999999999999999987210  147999999999999999999999


Q ss_pred             CCCccEEEecccchhhhhccCceeEeecCChhhHHHHHHHhhcCCEEEEcCceeeCCCccccccccccccCCeEEEEEEE
Q 043920          323 GRPIPTVTYSVSRLSEIISPIKAVRLSRDRATDASTIKKLLEEGDLAMCPEGTTCREPFLLRFSALFAELTDELVPVAMV  402 (504)
Q Consensus       323 ~~~~~~v~k~~~~~~~~~~~~g~i~i~R~~~~~~~~~~~~l~~G~l~IFPEGTrs~~~~l~~Fk~G~~~~~~pIvPV~i~  402 (504)
                      ++++.++++++..+++++..+++++++|++.++.+++++.+++|+++|||||||++++.+++||+||+++..|||||+|.
T Consensus       323 ~~~~~~v~~~~~~l~~~l~~i~~~~ldR~r~~~~~~~~~lL~~g~lvIFPEGTrs~~~~l~~Fk~~fa~l~~pIVPVAI~  402 (497)
T PLN02177        323 GRKISCVTYSISKFSELISPIKAVALSREREKDAANIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAIN  402 (497)
T ss_pred             CCCeEEEeehHHHHHHHHHhcCEEEEeCCChHHHHHHHHHHhcCCEEECcCcCCCCCCCcchHHHHHHHHCCcEEEEEEE
Confidence            98899999887778899999999999999877777788889999999999999999999999999998888999999999


Q ss_pred             ccccCccccccCCCCCCccccccccCCCeEEEEEecCcCCccccCCCCCHHHHHHHHHHHHHHHcCCCcCCCCHHHHHHH
Q 043920          403 NRMSMFHGTTARGWKGMDPFYFFMNPCPAYEVTFLNKLPMELTCGSGKSSHEVANYIQRVIAATLSYESTRFTRKDKYRA  482 (504)
Q Consensus       403 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~v~V~~l~pi~~~~~~~~~~~~~~la~~v~~~i~~~l~~~~t~~t~~dk~~~  482 (504)
                      ++..++.+++.++++++|++|++++|++.++|+||+|++++.-|..+++..|+|++||+.|+++|++++|++|++|||++
T Consensus       403 ~~~~~f~~~t~~~~~~~d~~~~~~~p~~~y~V~fL~~l~~~~~~~~~~~~~evAn~Vq~~i~~~lg~~~t~~tr~dk~~~  482 (497)
T PLN02177        403 TKQSMFHGTTVRGYKLLDPYFVFMNPRPTYEITFLNQLPKELTCKGGKSPIEVANYIQRVLAGTLGFECTNLTRKDKYAI  482 (497)
T ss_pred             cccccccccccccceecchhhhhcCCCceEEEEECCCCChhhcccCCCCHHHHHHHHHHHHHHhhCceeccccHHHHHHH
Confidence            98889998888999999999999999999999999999998644358999999999999999999999999999999999


Q ss_pred             hcCCCcccccCCCC
Q 043920          483 LAGNDGTVVEKPFI  496 (504)
Q Consensus       483 ~~~~~~~~~~~~~~  496 (504)
                      ||||||.|+.++..
T Consensus       483 l~gn~g~v~~~~~~  496 (497)
T PLN02177        483 LAGTDGRVPSKKEK  496 (497)
T ss_pred             hcCCCccccCCCCC
Confidence            99999999877653

>PLN02499 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>PLN02588 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>KOG2848 consensus 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>cd07991 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like	Back alignment and domain information

>PRK15018 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>PLN02833 glycerol acyltransferase family protein	Back alignment and domain information

>PLN02901 1-acyl-sn-glycerol-3-phosphate acyltransferase	Back alignment and domain information

>PTZ00261 acyltransferase; Provisional	Back alignment and domain information

>cd07992 LPLAT_AAK14816-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like	Back alignment and domain information

>cd07988 LPLAT_ABO13168-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168	Back alignment and domain information

>COG0204 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism]	Back alignment and domain information

>cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924	Back alignment and domain information

>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional	Back alignment and domain information

>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated	Back alignment and domain information

>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated	Back alignment and domain information

>PLN02783 diacylglycerol O-acyltransferase	Back alignment and domain information

>cd07987 LPLAT_MGAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like	Back alignment and domain information

>cd07993 LPLAT_DHAPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT-like	Back alignment and domain information

>PRK14014 putative acyltransferase; Provisional	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>TIGR00530 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransferases	Back alignment and domain information

>cd06551 LPLAT Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis	Back alignment and domain information

>PRK03355 glycerol-3-phosphate acyltransferase; Validated	Back alignment and domain information

>cd07985 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT	Back alignment and domain information

>cd07983 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>PF01553 Acyltransferase: Acyltransferase; InterPro: IPR002123 This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function []	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>PRK04974 glycerol-3-phosphate acyltransferase; Validated	Back alignment and domain information

>TIGR03703 plsB glycerol-3-phosphate O-acyltransferase	Back alignment and domain information

>cd07989 LPLAT_AGPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>PLN02510 probable 1-acyl-sn-glycerol-3-phosphate acyltransferase	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like	Back alignment and domain information

>PTZ00374 dihydroxyacetone phosphate acyltransferase; Provisional	Back alignment and domain information

>PLN02380 1-acyl-sn-glycerol-3-phosphate acyltransferase	Back alignment and domain information

>smart00563 PlsC Phosphate acyltransferases	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>PRK11915 glycerol-3-phosphate acyltransferase; Reviewed	Back alignment and domain information

>cd07984 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>KOG2847 consensus Phosphate acyltransferase [Lipid transport and metabolism]	Back alignment and domain information

>KOG1505 consensus Lysophosphatidic acid acyltransferase LPAAT and related acyltransferases [Lipid transport and metabolism]	Back alignment and domain information

>COG4359 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>KOG2898 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>COG2937 PlsB Glycerol-3-phosphate O-acyltransferase [Lipid metabolism]	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK08419 lipid A biosynthesis lauroyl acyltransferase; Reviewed	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase)	Back alignment and domain information

>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>KOG3729 consensus Mitochondrial glycerol-3-phosphate acyltransferase GPAT [Lipid transport and metabolism]	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>PLN02349 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>TIGR01497 kdpB K+-transporting ATPase, B subunit	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>KOG3730 consensus Acyl-CoA:dihydroxyactetone-phosphate acyltransferase DHAPAT [Lipid transport and metabolism]	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>COG2121 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>COG4030 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>PRK07920 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PRK01122 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>COG1560 HtrB Lauroyl/myristoyl acyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase	Back alignment and domain information

>PRK14010 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase	Back alignment and domain information

>PF03279 Lip_A_acyltrans: Bacterial lipid A biosynthesis acyltransferase; InterPro: IPR004960 Bacterial lipopolysachharides (LPS) are glycolipids that make up the outer monolayer of the outer membranes of most Gram-negative bacteria	Back alignment and domain information

>PRK10976 putative hydrolase; Provisional	Back alignment and domain information

>PRK10513 sugar phosphate phosphatase; Provisional	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>PRK06628 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>PRK06553 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal	Back alignment and domain information

>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>PRK06946 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>PRK10517 magnesium-transporting ATPase MgtA; Provisional	Back alignment and domain information

>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type	Back alignment and domain information

>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase	Back alignment and domain information

>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase	Back alignment and domain information

>PRK15122 magnesium-transporting ATPase; Provisional	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN02887 hydrolase family protein	Back alignment and domain information

>COG3700 AphA Acid phosphatase (class B) [General function prediction only]	Back alignment and domain information

>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase	Back alignment and domain information

>PRK06860 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins []	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>COG4087 Soluble P-type ATPase [General function prediction only]	Back alignment and domain information

>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase	Back alignment and domain information

>TIGR02208 lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase	Back alignment and domain information

>PRK08943 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase; Validated	Back alignment and domain information

>PRK05646 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>TIGR02207 lipid_A_htrB lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit	Back alignment and domain information

>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial	Back alignment and domain information

>PRK08706 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>PF03982 DAGAT: Diacylglycerol acyltransferase ; InterPro: IPR007130 The terminal step of triacylglycerol (TAG) formation is catalysed by the enzyme diacylglycerol acyltransferase (DAGAT) [, ]	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>PRK08905 lipid A biosynthesis lauroyl acyltransferase; Validated	Back alignment and domain information

>PRK08733 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>PRK08734 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

>PLN02382 probable sucrose-phosphatase	Back alignment and domain information

>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>PRK05906 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>PRK08025 lipid A biosynthesis palmitoleoyl acyltransferase; Reviewed	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>PRK05645 lipid A biosynthesis lauroyl acyltransferase; Provisional	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V)	Back alignment and domain information

>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []	Back alignment and domain information

>COG5663 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase	Back alignment and domain information

>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin []	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>COG3176 Putative hemolysin [General function prediction only]	Back alignment and domain information

>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria	Back alignment and domain information

>PLN03190 aminophospholipid translocase; Provisional	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN02423 phosphomannomutase	Back alignment and domain information

>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain	Back alignment and domain information

>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		504
3fvv_A		232	Uncharacterized protein; unknown function, structu	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Length = 232	Back alignment and structure

 Score = 57.8 bits (140), Expect = 1e-09
 Identities = 28/208 (13%), Positives = 52/208 (25%), Gaps = 19/208 (9%)

Query: 26  DMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESAGIQVLI---F 82
           D+D TLL   S +  +A      G                L+          +       
Sbjct: 10  DLDHTLLPLDSDY-QWADFLARTGRAGDPAEARRR--NDDLMERYNRGELTAEQAAEFML 66

Query: 83  ASFVGLRVTDIESVARAVLPKFYASDLHPESWRVFSSC---GKRCVL-TANPRIMVEAFL 138
                    ++ +     +       L  ++  V       G  C L TA    +    +
Sbjct: 67  GLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAP-I 125

Query: 139 KDFLAADLVLGTEIATYKGRATGLVRDPGVLVGNKKADAL---LKAFGETQPE----IGL 191
                   ++ T+     GR TG +          K   +   L   G    +       
Sbjct: 126 ARAFGVQHLIATDPEYRDGRYTGRIEGT-PSFREGKVVRVNQWLAGMGLALGDFAESYFY 184

Query: 192 GDRQTDIPFMALCKEGYLVPSKPEVKAV 219
            D   D+P +            P ++ +
Sbjct: 185 SDSVNDVPLLEAVTRPIAANPSPGLREI 212

PyMOL of 3fvv

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		504
3fvv_A		232	Uncharacterized protein; unknown function, structu	99.94
1iuq_A		367	Glycerol-3-phosphate acyltransferase; open twisted	99.87
4as2_A		327	Phosphorylcholine phosphatase; hydrolase, HAD supe	99.87
4gxt_A		385	A conserved functionally unknown protein; structur	99.84
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	99.64
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	99.63
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	99.61
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	99.5
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	99.48
4ap9_A		201	Phosphoserine phosphatase; hydrolase, haloacid deh	99.43
3kd3_A		219	Phosphoserine phosphohydrolase-like protein; csgid	99.33
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.25
1rku_A		206	Homoserine kinase; phosphoserine phosphatase, phos	99.16
3cnh_A		200	Hydrolase family protein; NP_295428.1, predicted h	99.07
1nnl_A		225	L-3-phosphoserine phosphatase; PSP, HPSP, phospho-	99.03
3mmz_A		176	Putative HAD family hydrolase; structural genomics	99.0
1y8a_A		332	Hypothetical protein AF1437; structural genomics,	98.89
4fe3_A		297	Cytosolic 5'-nucleotidase 3; substrate complex, HA	98.88
3nuq_A		282	Protein SSM1, putative nucleotide phosphatase; sup	98.87
4ex6_A		237	ALNB; modified rossman fold, phosphatase, magnesiu	98.87
3um9_A		230	Haloacid dehalogenase, type II; haloacid dehalogen	98.85
2pib_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	98.85
3kzx_A		231	HAD-superfamily hydrolase, subfamily IA, variant;	98.84
3mn1_A		189	Probable YRBI family phosphatase; structural genom	98.81
2hsz_A		243	Novel predicted phosphatase; structural genomics,	98.8
2om6_A		235	Probable phosphoserine phosphatase; rossmann fold,	98.79
3mc1_A		226	Predicted phosphatase, HAD family; PSI2, NYSGXRC,	98.77
2no4_A		240	(S)-2-haloacid dehalogenase IVA; HAD superfamily,	98.76
3e58_A		214	Putative beta-phosphoglucomutase; structu genomics	98.76
3sd7_A		240	Putative phosphatase; structural genomics, haloaci	98.75
3ij5_A		211	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	98.73
1te2_A		226	Putative phosphatase; structural genomics, phospha	98.72
2hdo_A		209	Phosphoglycolate phosphatase; NP_784602.1, structu	98.7
1k1e_A		180	Deoxy-D-mannose-octulosonate 8-phosphate phosphat;	98.7
3umb_A		233	Dehalogenase-like hydrolase; 2.20A {Ralstonia sola	98.7
4eek_A		259	Beta-phosphoglucomutase-related protein; hydrolase	98.7
1zrn_A		232	L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud	98.69
3s6j_A		233	Hydrolase, haloacid dehalogenase-like family; stru	98.68
3d6j_A		225	Putative haloacid dehalogenase-like hydrolase; str	98.68
3m9l_A		205	Hydrolase, haloacid dehalogenase-like family; HAD	98.66
3skx_A		280	Copper-exporting P-type ATPase B; P1B-ATPase, ATP	98.65
2p9j_A		162	Hypothetical protein AQ2171; secsg, riken, PSI, st	98.63
3ddh_A		234	Putative haloacid dehalogenase-like family hydrol;	98.63
4dcc_A		229	Putative haloacid dehalogenase-like hydrolase; mag	98.62
2fi1_A		190	Hydrolase, haloacid dehalogenase-like family; stru	98.59
1qq5_A		253	Protein (L-2-haloacid dehalogenase); hydrolase; 1.	98.57
2hoq_A		241	Putative HAD-hydrolase PH1655; haloacid dehalogena	98.56
2nyv_A		222	Pgpase, PGP, phosphoglycolate phosphatase; structu	98.54
3nas_A		233	Beta-PGM, beta-phosphoglucomutase; PSI, structural	98.53
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	98.53
3e8m_A		164	Acylneuraminate cytidylyltransferase; 2-keto-3-deo	98.53
2go7_A		207	Hydrolase, haloacid dehalogenase-like family; stru	98.52
2fdr_A		229	Conserved hypothetical protein; SAD, structural ge	98.52
3iru_A		277	Phoshonoacetaldehyde hydrolase like protein; phosp	98.52
3ed5_A		238	YFNB; APC60080, bacillus subtilis subsp. subtilis	98.52
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	98.51
3qnm_A		240	Haloacid dehalogenase-like hydrolase; structural g	98.51
2hcf_A		234	Hydrolase, haloacid dehalogenase-like family; NP_6	98.51
3qxg_A		243	Inorganic pyrophosphatase; hydrolase, magnesium bi	98.48
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	98.47
2wf7_A		221	Beta-PGM, beta-phosphoglucomutase; transition stat	98.47
2hi0_A		240	Putative phosphoglycolate phosphatase; YP_619066.1	98.45
1swv_A		267	Phosphonoacetaldehyde hydrolase; HAD enzyme superf	98.43
2w43_A		201	Hypothetical 2-haloalkanoic acid dehalogenase; hyd	98.42
3dv9_A		247	Beta-phosphoglucomutase; structural genomics, APC6	98.41
3l5k_A		250	Protein GS1, haloacid dehalogenase-like hydrolase	98.4
3umc_A		254	Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru	98.38
2r8e_A		188	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	98.37
3dao_A		283	Putative phosphatse; structural genomics, joint ce	98.37
2ah5_A		210	COG0546: predicted phosphatases; MCSG, structural	98.37
2qlt_A		275	(DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac	98.36
3k1z_A		263	Haloacid dehalogenase-like hydrolase domain-conta	98.35
3u26_A		234	PF00702 domain protein; structural genomics, PSI-b	98.31
3kbb_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	98.3
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	98.28
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	98.27
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	98.24
2pke_A		251	Haloacid delahogenase-like family hydrolase; NP_63	98.24
2p11_A		231	Hypothetical protein; putative haloacid dehalogena	98.2
3umg_A		254	Haloacid dehalogenase; defluorinase, hydrolase; 2.	98.19
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	98.14
3smv_A		240	S-(-)-azetidine-2-carboxylate hydrolase; haloacid	98.14
2zg6_A		220	Putative uncharacterized protein ST2620, probable	98.12
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	98.1
3vay_A		230	HAD-superfamily hydrolase; rossmann fold, haloacid	98.08
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	98.08
3n07_A		195	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	98.02
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	97.99
1wr8_A		231	Phosphoglycolate phosphatase; alpha / beta core do	97.91
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	97.9
2yj3_A		263	Copper-transporting ATPase; hydrolase, P-type ATPa	97.03
1l6r_A		227	Hypothetical protein TA0175; structural genomics,	97.73
3rfu_A		736	Copper efflux ATPase; alpha helical, CPC, CXXC, AT	97.71
3j08_A		645	COPA, copper-exporting P-type ATPase A; copper tra	97.63
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	97.59
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	97.57
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	97.54
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	97.49
2c4n_A		250	Protein NAGD; nucleotide phosphatase, HAD superfam	97.43
3n1u_A		191	Hydrolase, HAD superfamily, subfamily III A; struc	97.42
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	97.39
4gib_A		250	Beta-phosphoglucomutase; rossmann fold, HAD-like,	97.37
3pct_A		260	Class C acid phosphatase; hydrolase, outer membran	97.31
3ixz_A		1034	Potassium-transporting ATPase alpha; ION pump, H+,	97.25
3ocu_A		262	Lipoprotein E; hydrolase, outer membrane; HET: NMN	97.24
2gmw_A		211	D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi	97.2
4g9b_A		243	Beta-PGM, beta-phosphoglucomutase; HAD, putative p	97.14
1mhs_A		920	Proton pump, plasma membrane ATPase; ION transport	97.09
2b82_A		211	APHA, class B acid phosphatase; DDDD acid phosphat	96.99
3ar4_A		995	Sarcoplasmic/endoplasmic reticulum calcium ATPase;	96.85
2zxe_A		1028	Na, K-ATPase alpha subunit; membrane protein, ION	96.85
2i33_A		258	Acid phosphatase; HAD superfamily, hydrolase; 1.57	96.76
2ho4_A		259	Haloacid dehalogenase-like hydrolase domain contai	96.65
3b8c_A		885	ATPase 2, plasma membrane-type; P-type ATPase, pro	96.55
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	96.46
2zos_A		249	MPGP, mannosyl-3-phosphoglycerate phosphatase; hal	96.18
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	96.08
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	96.02
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	96.01
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	95.94
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	95.85
1u02_A		239	Trehalose-6-phosphate phosphatase related protein;	95.7
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	95.26
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	95.18
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	95.1
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	95.09
1s2o_A		244	SPP, sucrose-phosphatase; phosphohydrolase, HAD su	95.02
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	94.67
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	94.48
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	94.44
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	94.37
2o2x_A		218	Hypothetical protein; structural genomics, joint c	94.2
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	94.05
2pr7_A		137	Haloacid dehalogenase/epoxide hydrolase family; NP	93.89
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	93.48
3qgm_A		268	P-nitrophenyl phosphatase (PHO2); structural genom	93.39
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	93.37
1nf2_A		268	Phosphatase; structural proteomics, HAD NEW fold,	93.16
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	92.86
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	92.49
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	92.15
3ib6_A		189	Uncharacterized protein; structural genomics, unkn	91.63
1xpj_A		126	Hypothetical protein; structural genomics, MCSG, p	90.39
2obb_A		142	Hypothetical protein; structural genomics, PSI-2,	90.1
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	89.8
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	89.44
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	89.12
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	88.15
3nvb_A		387	Uncharacterized protein; protein FKBH, protein fkb	87.53
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	87.46
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	87.14
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	85.61
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	83.78
3epr_A		264	Hydrolase, haloacid dehalogenase-like family; stru	83.77
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	83.31
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	83.2
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	82.42
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	82.18
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	82.06
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	82.01
2x4d_A		271	HLHPP, phospholysine phosphohistidine inorganic py	81.92
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	80.7
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	80.33
1yv9_A		264	Hydrolase, haloacid dehalogenase family; hypotheti	80.15

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis}	Back alignment and structure

Probab=99.94  E-value=6.2e-26  Score=216.68  Aligned_cols=211  Identities=13%  Similarity=0.137  Sum_probs=160.1

Q ss_pred             cceEEEEecCCccccCCCcHHHHHHHHHHhcch-HHHHHHHHhhHHHHHhhccccccH-HHHHHHHHHhcCCCHHHHHHH
Q 043920           19 EKHTVVADMDGTLLRGRSSFPYFALVAFEAGGI-LRLLFLLLASPIAGLLYYLVSESA-GIQVLIFASFVGLRVTDIESV   96 (504)
Q Consensus        19 ~~~~a~FD~DgTL~~~ds~~~~~~~~~~~~~~~-~~~~~~~~~~p~~~~~~~~~~~~~-~~~~~~~~~~~G~~~~~l~~~   96 (504)
                      ..++++||+||||++.++...|..+.... +.. ..... .......+..+..+..+. .+.+.....+.|.+.++++++
T Consensus         3 ~~k~viFDlDGTL~d~~~~~~~~~~~~~~-~~~~~~~~~-~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (232)
T 3fvv_A            3 TRRLALFDLDHTLLPLDSDYQWADFLART-GRAGDPAEA-RRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAW   80 (232)
T ss_dssp             CCEEEEECCBTTTBSSCHHHHHHHHHHHT-TSSSSHHHH-HHHHHHHHHHHHHTCSCHHHHHHHHHHHHHTSCHHHHHHH
T ss_pred             CCcEEEEeCCCCCcCCchHHHHHHHHHHc-CCCCccHHH-HHHHHHHHHHHHCCCCCHHHHHHHHHHHhcCCCHHHHHHH
Confidence            35799999999999999877665544321 111 01100 000111111121112222 144556667889999999999


Q ss_pred             HHHHcchhhhcccCHHHHH---HHhhCCCEE-EEecCcHHHHHHHHHhhcCCcEEEeeeEEEeCCeeeeeEeCCCCCCch
Q 043920           97 ARAVLPKFYASDLHPESWR---VFSSCGKRC-VLTANPRIMVEAFLKDFLAADLVLGTEIATYKGRATGLVRDPGVLVGN  172 (504)
Q Consensus        97 ~~~~~~~~~~~~~~~~~~~---~~~~~G~~v-vvSas~~~~v~~ia~~~Lg~d~vigt~l~~~~g~~tG~i~g~~~l~g~  172 (504)
                      .++++.+.+.+.++|++.+   +++++|..+ |+|++++.+++++++. +|+++++++.+.+++|.++|++.+++| .+.
T Consensus        81 ~~~~~~~~~~~~~~~g~~~~l~~l~~~g~~~~ivS~~~~~~~~~~~~~-~g~~~~~~~~~~~~~~~~~g~~~~~~~-~~~  158 (232)
T 3fvv_A           81 HEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARA-FGVQHLIATDPEYRDGRYTGRIEGTPS-FRE  158 (232)
T ss_dssp             HHHHHHHTTGGGCCHHHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHH-TTCCEEEECEEEEETTEEEEEEESSCS-STH
T ss_pred             HHHHHHHhhhhhcCHHHHHHHHHHHHCCCEEEEEeCCCHHHHHHHHHH-cCCCEEEEcceEEECCEEeeeecCCCC-cch
Confidence            9998887766678888765   678899776 6899999999999999 999999999999999999999998877 899


Q ss_pred             hHHHHHHHHhCCCC---C----eEEEeCCCCCHHHHhhcccCeeeCCCcchhccccccCCCcee-eeCCC
Q 043920          173 KKADALLKAFGETQ---P----EIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPII-FHDGR  234 (504)
Q Consensus       173 ~Kv~~l~~~~~~~~---~----~~aygDS~~DlpmL~~a~~~~~Vnp~~~l~~~A~~~~~W~i~-f~~~r  234 (504)
                      .|.+.+++++.+.+   +    .++||||.+|++|++.|+.+++|||++++++.|+ ++||+|+ |...|
T Consensus       159 ~K~~~~~~~~~~~~~~~~~~~~~~~vGDs~~D~~~~~~ag~~~~~~~~~~l~~~a~-~~~w~~~~~~~~~  227 (232)
T 3fvv_A          159 GKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQ-ARGWQVIDLFDHL  227 (232)
T ss_dssp             HHHHHHHHHHHHTTCCGGGSSEEEEEECCGGGHHHHHHSSEEEEESCCHHHHHHHH-HHTCEEECCC---
T ss_pred             HHHHHHHHHHHHcCCCcCchhheEEEeCCHhhHHHHHhCCCeEEECcCHHHHHHHH-HCCCcEeehhhhh
Confidence            99999988765444   2    5689999999999999999999999999999999 9999999 86544

PyMOL of 3fvv

>1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A	Back alignment and structure

>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A*	Back alignment and structure

>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii}	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp}	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae}	Back alignment and structure

>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A	Back alignment and structure

>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp}	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A	Back alignment and structure

>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1}	Back alignment and structure

>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A	Back alignment and structure

>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis}	Back alignment and structure

>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24	Back alignment and structure

>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A	Back alignment and structure

>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A*	Back alignment and structure

>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A	Back alignment and structure

>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP}	Back alignment and structure

>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A	Back alignment and structure

>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6	Back alignment and structure

>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0	Back alignment and structure

>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A*	Back alignment and structure

>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311}	Back alignment and structure

>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile}	Back alignment and structure

>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis}	Back alignment and structure

>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6	Back alignment and structure

>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6	Back alignment and structure

>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A*	Back alignment and structure

>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum}	Back alignment and structure

>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A	Back alignment and structure

>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A	Back alignment and structure

>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A*	Back alignment and structure

>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A*	Back alignment and structure

>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus}	Back alignment and structure

>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A	Back alignment and structure

>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3	Back alignment and structure

>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A	Back alignment and structure

>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii}	Back alignment and structure

>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A	Back alignment and structure

>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis}	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A*	Back alignment and structure

>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6	Back alignment and structure

>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0	Back alignment and structure

>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A	Back alignment and structure

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp}	Back alignment and structure

>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6	Back alignment and structure

>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A	Back alignment and structure

>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii}	Back alignment and structure

>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A	Back alignment and structure

>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A	Back alignment and structure

>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus}	Back alignment and structure

>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens}	Back alignment and structure

>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa}	Back alignment and structure

>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A*	Back alignment and structure

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale}	Back alignment and structure

>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens}	Back alignment and structure

>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A	Back alignment and structure

>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8}	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0	Back alignment and structure

>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV}	Back alignment and structure

>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans}	Back alignment and structure

>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii}	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas}	Back alignment and structure

>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV}	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae}	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A*	Back alignment and structure

>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A	Back alignment and structure

>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp}	Back alignment and structure

>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14	Back alignment and structure

>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile}	Back alignment and structure

>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida}	Back alignment and structure

>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A	Back alignment and structure

>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A	Back alignment and structure

>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A*	Back alignment and structure

>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli}	Back alignment and structure

>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1	Back alignment and structure

>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A	Back alignment and structure

>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ...	Back alignment and structure

>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A	Back alignment and structure

>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A	Back alignment and structure

>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A	Back alignment and structure

>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana}	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A	Back alignment and structure

>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15	Back alignment and structure

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A*	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A	Back alignment and structure

>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A*	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10	Back alignment and structure

>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A	Back alignment and structure

>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes}	Back alignment and structure

>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18	Back alignment and structure

>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A*	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A	Back alignment and structure

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis}	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A*	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens}	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		504
d1nnla_		217	Phosphoserine phosphatase {Human (Homo sapiens) [T	99.85
d1iuqa_		367	Glycerol-3-phosphate (1)-acyltransferase {Cushaw s	99.73
d1j97a_		210	Phosphoserine phosphatase {Archaeon Methanococcus	99.67
d2feaa1		226	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.58
d1rkua_		206	Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta	99.37
d2bdua1		291	Cytosolic 5'-nucleotidase III {Mouse (Mus musculus	99.14
d1s2oa1		244	Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc	98.74
d1te2a_		218	Phosphatase YniC {Escherichia coli [TaxId: 562]}	98.38
d2hdoa1		207	Phosphoglycolate phosphatase {Lactobacillus planta	98.24
d2ah5a1		210	predicted phosphatase SP0104 {Streptococcus pneumo	98.14
d2hsza1		224	Phosphoglycolate phosphatase Gph {Haemophilus somn	98.12
d2go7a1		204	Hypothetical protein SP2064 {Streptococcus pneumon	98.1
d2fi1a1		187	Putative hydrolase SP0805 {Streptococcus pneumonia	97.93
d2b8ea1		135	Cation-transporting ATPase {Archaeon Archaeoglobus	97.93
d2hcfa1		228	Hypothetical protein CT1708 {Chlorobium tepidum [T	97.88
d1swva_		257	Phosphonoacetaldehyde hydrolase {Bacillus cereus [	97.83
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	97.78
d1y8aa1		308	Hypothetical protein AF1437 {Archaeon Archaeoglobu	97.69
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	97.67
d1o08a_		221	beta-Phosphoglucomutase {Lactococcus lactis [TaxId	97.66
d1x42a1		230	Hypothetical protein PH0459 {Archaeon Pyrococcus h	97.57
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	97.56
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	97.5
d2gfha1		247	N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m	97.41
d2fdra1		222	Hypothetical protein Atu0790 {Agrobacterium tumefa	97.37
d1u7pa_		164	Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu	97.35
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	97.31
d1rlma_		269	Sugar phosphatase SupH (YbiV) {Escherichia coli [T	97.16
d1nrwa_		285	Hypothetical protein YwpJ {Bacillus subtilis [TaxI	97.11
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	97.05
d1k1ea_		177	Probable phosphatase YrbI {Haemophilus influenzae,	96.99
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	96.92
d1wpga2		168	Calcium ATPase, catalytic domain P {Rabbit (Orycto	96.85
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	96.71
d1wzca1		243	Putative mannosyl-3-phosphoglycerate phosphatase M	96.7
d2rbka1		260	Sugar-phosphate phosphatase BT4131 {Bacteroides th	96.69
d1rkqa_		271	Hypothetical protein YidA {Escherichia coli [TaxId	96.62
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	96.58
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	96.32
d2b30a1		283	PFL1270w orthologue {Plasmodium vivax [TaxId: 5855	96.3
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	96.12
d1u02a_		229	Trehalose-6-phosphate phosphatase related protein	95.66
d2fuea1		244	Phosphomannomutase 1 {Human (Homo sapiens) [TaxId:	95.27
d2g80a1		225	Protein UTR4 {Baker's yeast (Saccharomyces cerevis	94.22
d1qyia_		380	Hypothetical protein MW1667 (SA1546) {Staphylococc	94.06
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	91.78
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	91.52
d1rkqa_		271	Hypothetical protein YidA {Escherichia coli [TaxId	91.09
d2b82a1		209	Class B acid phosphatase, AphA {Escherichia coli [	90.79
d2fuea1		244	Phosphomannomutase 1 {Human (Homo sapiens) [TaxId:	89.49
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	89.04
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	86.63
d2c4na1		250	NagD {Escherichia coli [TaxId: 562]}	86.6
d1nrwa_		285	Hypothetical protein YwpJ {Bacillus subtilis [TaxI	86.06
d2rbka1		260	Sugar-phosphate phosphatase BT4131 {Bacteroides th	85.23
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	84.44
d2b30a1		283	PFL1270w orthologue {Plasmodium vivax [TaxId: 5855	84.13
d1wzca1		243	Putative mannosyl-3-phosphoglycerate phosphatase M	83.37
d1vjra_		261	Hypothetical protein TM1742 {Thermotoga maritima [	83.03
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	82.1
d1rlma_		269	Sugar phosphatase SupH (YbiV) {Escherichia coli [T	81.92
d1u02a_		229	Trehalose-6-phosphate phosphatase related protein	81.78
d1yv9a1		253	Putative hydrolase EF1188 {Enterococcus faecalis [	80.72
d2fpwa1		161	Histidine biosynthesis bifunctional protein HisB,	80.25
d1wvia_		253	Putative phosphatase SMU.1415c {Streptococcus muta	80.09

>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphoserine phosphatase
domain: Phosphoserine phosphatase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=3.4e-22  Score=188.14  Aligned_cols=193  Identities=15%  Similarity=0.076  Sum_probs=133.6

Q ss_pred             cceEEEEecCCccccCCCcHHHHHHHHHHhcchHHHHHHHHhhHHHHHhhccccccH--HHHHHHHHHhcCCCHHHHHHH
Q 043920           19 EKHTVVADMDGTLLRGRSSFPYFALVAFEAGGILRLLFLLLASPIAGLLYYLVSESA--GIQVLIFASFVGLRVTDIESV   96 (504)
Q Consensus        19 ~~~~a~FD~DgTL~~~ds~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~--~~~~~~~~~~~G~~~~~l~~~   96 (504)
                      .++.++|||||||+++++. ..+.... ......+.+        .. .+..+..+.  .+++ ....++|...+.++.+
T Consensus         9 ~~~aV~FD~DGTLi~~e~~-~~l~~~~-g~~~~~~~~--------~~-~~~~g~~~~~~~~~~-~~~~~~~~~~~~~~~~   76 (217)
T d1nnla_           9 SADAVCFDVDSTVIREEGI-DELAKIC-GVEDAVSEM--------TR-RAMGGAVPFKAALTE-RLALIQPSREQVQRLI   76 (217)
T ss_dssp             HCSEEEEETBTTTBSSCHH-HHHHHHT-TCTTTC---------------------CHHHHHHH-HHHHHCCCHHHHHHHH
T ss_pred             CCCEEEEcCccccCCccHH-HHHHHHc-CChHHHHHH--------HH-HHHcCCCCHHHHHHH-HHHhcccchHHHHHHH
Confidence            5678899999999999873 3332111 000001100        00 000011111  1222 2346778766655544


Q ss_pred             HHHHcchhhhcccCHHH---HHHHhhCCCEE-EEecCcHHHHHHHHHhhcCCc--EEEeeeEEEe-CCeeeeeEeCCCCC
Q 043920           97 ARAVLPKFYASDLHPES---WRVFSSCGKRC-VLTANPRIMVEAFLKDFLAAD--LVLGTEIATY-KGRATGLVRDPGVL  169 (504)
Q Consensus        97 ~~~~~~~~~~~~~~~~~---~~~~~~~G~~v-vvSas~~~~v~~ia~~~Lg~d--~vigt~l~~~-~g~~tG~i~g~~~l  169 (504)
                      .+.-      ..++|.+   +++|+++|+++ ||||+++.+++++++. ||+|  +++|+++.++ +|.+||...+.++.
T Consensus        77 ~~~~------~~l~pg~~~~i~~lk~~G~~~~ivS~~~~~~v~~i~~~-lgi~~~~v~an~~~~~~~G~~~g~~~~~p~~  149 (217)
T d1nnla_          77 AEQP------PHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASK-LNIPATNVFANRLKFYFNGEYAGFDETQPTA  149 (217)
T ss_dssp             HHSC------CCBCTTHHHHHHHHHHTTCEEEEEEEEEHHHHHHHHHH-TTCCGGGEEEECEEECTTSCEEEECTTSGGG
T ss_pred             Hhhc------cccCHHHHHHHHHHHhCCCEEEEECCCchHHHHHHHHH-hCCcccceeeeeeeeeehhccccceeeeeee
Confidence            3321      2255655   55889999877 5899999999999999 9996  6999999987 89999988877666


Q ss_pred             CchhHHHHHHHHhCCCCC--eEEEeCCCCCHHHHhhcccCeeeCCCcchhccccccCCCcee-ee
Q 043920          170 VGNKKADALLKAFGETQP--EIGLGDRQTDIPFMALCKEGYLVPSKPEVKAVTCDKLPKPII-FH  231 (504)
Q Consensus       170 ~g~~Kv~~l~~~~~~~~~--~~aygDS~~DlpmL~~a~~~~~Vnp~~~l~~~A~~~~~W~i~-f~  231 (504)
                      .+.+|++.++++..+.++  .++||||.+|++|++.|+.++++|+++.++.+++ +..|.|. |.
T Consensus       150 ~~~~K~~~v~~~~~~~~~~~~~~vGDs~~Di~~~~~ag~~va~~~~~~~~~~~~-~ad~~i~~f~  213 (217)
T d1nnla_         150 ESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKD-NAKWYITDFV  213 (217)
T ss_dssp             STTHHHHHHHHHHHHHCCSCEEEEESSHHHHTTTTTSSEEEEECSSCCCHHHHH-HCSEEESCGG
T ss_pred             ccchHHHHHHHHHhccCccccEEEEeCHhhHHHHHhCCceEEECCCHHHHHHHH-hCCCEeCCHH
Confidence            788999999887543332  5799999999999999999999999999888888 8889875 43

PyMOL of d1nnla_

>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]}	Back information, alignment and structure

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}	Back information, alignment and structure

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure