BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 043931
(161 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ULS|H Chain H, Crystal Structure Of Fab12
pdb|3ULS|B Chain B, Crystal Structure Of Fab12
pdb|3ULU|D Chain D, Structure Of Quaternary Complex Of Human Tlr3ecd With
Three Fabs (Form1)
pdb|3ULV|D Chain D, Structure Of Quaternary Complex Of Human Tlr3ecd With
Three Fabs (Form2)
Length = 226
Score = 27.7 bits (60), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%)
Query: 2 ETPSRHLPVLKRMSKLGKKANNFATGVKEHVRLAPKITETVKGKLSL 48
++P R L L + K K NN+A VK + + P +T K + SL
Sbjct: 41 QSPGRGLEWLGIIQKRSKWYNNYAVSVKSRITINP---DTSKNQFSL 84
>pdb|1JG4|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O-
Methyltransferase With S-Adenosylmethionine
pdb|1JG3|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl)
O-Methyltransferase With Adenosine & Vyp(Isp)ha
Substrate
pdb|1JG3|B Chain B, Crystal Structure Of L-Isoaspartyl (D-Aspartyl)
O-Methyltransferase With Adenosine & Vyp(Isp)ha
Substrate
pdb|1JG2|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O-
Methyltransferase With Adenosine
pdb|1JG1|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O-
Methyltransferase With S-Adenosyl-L-Homocysteine
Length = 235
Score = 26.2 bits (56), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 13/42 (30%), Positives = 26/42 (61%)
Query: 35 APKITETVKGKLSLGAKIIQVGGVERIFKQLFSVKEGENLLK 76
APKI E + +L +G K+I G ++++L V++ ++ +K
Sbjct: 168 APKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIK 209
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.136 0.390
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,280,512
Number of Sequences: 62578
Number of extensions: 147248
Number of successful extensions: 404
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 403
Number of HSP's gapped (non-prelim): 4
length of query: 161
length of database: 14,973,337
effective HSP length: 91
effective length of query: 70
effective length of database: 9,278,739
effective search space: 649511730
effective search space used: 649511730
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)