Query         044024
Match_columns 296
No_of_seqs    27 out of 29
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 10:44:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044024.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044024hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01465 GRIP:  GRIP domain;  I  58.3      10 0.00022   27.0   2.4   25  226-251     9-33  (46)
  2 PF00023 Ank:  Ankyrin repeat H  44.2      19 0.00041   22.5   1.8   21  127-147    12-32  (33)
  3 PF03765 CRAL_TRIO_N:  CRAL/TRI  34.0      33 0.00071   23.9   1.9   24  225-248    30-54  (55)
  4 smart00755 Grip golgin-97, Ran  25.0      65  0.0014   23.2   2.2   23  226-250     8-30  (46)
  5 PF15611 EH_Signature:  EH_Sign  20.1      96  0.0021   28.7   2.8   50  187-236   199-251 (389)
  6 PF13490 zf-HC2:  Putative zinc  14.6 1.4E+02   0.003   19.1   1.8   30  224-253     3-32  (36)
  7 PF09507 CDC27:  DNA polymerase  13.5      49  0.0011   30.8  -0.7   22  228-249     3-26  (430)
  8 COG5567 Predicted small peripl  13.4 2.3E+02  0.0049   22.1   2.9   33  242-276    10-42  (58)
  9 PF06870 RNA_pol_I_A49:  A49-li  12.2      77  0.0017   30.0   0.2   21  235-256   329-349 (385)
 10 PF01042 Ribonuc_L-PSP:  Endori  11.0   2E+02  0.0044   22.7   2.2   42  109-152    25-70  (121)

No 1  
>PF01465 GRIP:  GRIP domain;  InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi []. The GRIP domain contains a completely conserved tyrosine residue.; GO: 0005515 protein binding, 0000042 protein targeting to Golgi; PDB: 1R4A_H 1UPT_B.
Probab=58.26  E-value=10  Score=27.00  Aligned_cols=25  Identities=24%  Similarity=0.546  Sum_probs=18.9

Q ss_pred             hhHHHHHHhccCCcchhhHHhhhhhc
Q 044024          226 KSIVFRWLASKLDPSSANGVLRALSN  251 (296)
Q Consensus       226 K~VVlrwLa~KL~p~~An~~lR~LSn  251 (296)
                      ||||++||..+= ++....+++.|+.
T Consensus         9 KNvl~~fl~~~~-~~~~~~llpvi~t   33 (46)
T PF01465_consen    9 KNVLLQFLESRE-PSEREQLLPVIAT   33 (46)
T ss_dssp             HHHHHHHHTTSS----HHHHHHHHHH
T ss_pred             HHHHHHHhcCCc-hhhHHHHHHHHHH
Confidence            899999999985 7788888888763


No 2  
>PF00023 Ank:  Ankyrin repeat Hereditary spherocytosis;  InterPro: IPR002110  The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers []. The repeat has been found in proteins of diverse function such as transcriptional initiators, cell-cycle regulators, cytoskeletal, ion transporters and signal transducers. The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it.  The conserved fold of the ankyrin repeat unit is known from several crystal and solution structures [, , , ]. Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90o angle. The repeats stack together to form an L-shaped structure [, ].; GO: 0005515 protein binding; PDB: 1D9S_A 1NFI_F 1IKN_D 1WDY_A 1OT8_C 1QYM_A 1TR4_A 1UOH_A 1N11_A 1K1A_A ....
Probab=44.22  E-value=19  Score=22.48  Aligned_cols=21  Identities=29%  Similarity=0.374  Sum_probs=17.0

Q ss_pred             hhHHHHHHHHHhcCccccccc
Q 044024          127 HCLSDFEKILETQGANRNLKT  147 (296)
Q Consensus       127 ~C~SDi~~iL~sqGAn~~l~~  147 (296)
                      +--.|+.++|.++||+-++.+
T Consensus        12 ~~~~~~v~~Ll~~ga~~~~~d   32 (33)
T PF00023_consen   12 RGHPDIVKLLLKHGADINARD   32 (33)
T ss_dssp             TTCHHHHHHHHHTTSCTTCBC
T ss_pred             HHHHHHHHHHHHCcCCCCCCC
Confidence            336799999999999987653


No 3  
>PF03765 CRAL_TRIO_N:  CRAL/TRIO, N-terminal domain;  InterPro: IPR008273 This entry defines the N-terminal of various retinaldehyde/retinal-binding proteins that may be functional components of the visual cycle. Cellular retinaldehyde-binding protein (CRALBP) carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes []. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains []. Trio is a multifunctional protein that integrates and amplifies signals involved in coordinating actin remodeling, which is necessary for cell migration and growth. Other members of the family are transfer proteins that include, guanine nucleotide exchange factor that may function as an effector of RAC1, phosphatidylinositol/phosphatidylcholine transfer protein that is required for the transport of secretory proteins from the golgi complex and alpha-tocopherol transfer protein that enhances the transfer of the ligand between separate membranes.; PDB: 1OIZ_A 1R5L_A 1OIP_A 3HX3_A 3HY5_A 1AUA_A 3Q8G_A 3B7Q_B 3B7Z_A 3B7N_A ....
Probab=34.02  E-value=33  Score=23.92  Aligned_cols=24  Identities=29%  Similarity=0.445  Sum_probs=20.0

Q ss_pred             chhHHHHHH-hccCCcchhhHHhhh
Q 044024          225 CKSIVFRWL-ASKLDPSSANGVLRA  248 (296)
Q Consensus       225 CK~VVlrwL-a~KL~p~~An~~lR~  248 (296)
                      -.++++||| |+|.+-+.|.+||+.
T Consensus        30 ~d~~llRFLRARkf~v~~A~~mL~~   54 (55)
T PF03765_consen   30 DDNFLLRFLRARKFDVEKAFKMLKK   54 (55)
T ss_dssp             SHHHHHHHHHHTTT-HHHHHHHHHH
T ss_pred             CHHHHHHHHHHccCCHHHHHHHHHh
Confidence            449999999 799999999999974


No 4  
>smart00755 Grip golgin-97, RanBP2alpha,Imh1p and p230/golgin-245.
Probab=24.99  E-value=65  Score=23.24  Aligned_cols=23  Identities=17%  Similarity=0.455  Sum_probs=17.6

Q ss_pred             hhHHHHHHhccCCcchhhHHhhhhh
Q 044024          226 KSIVFRWLASKLDPSSANGVLRALS  250 (296)
Q Consensus       226 K~VVlrwLa~KL~p~~An~~lR~LS  250 (296)
                      |||+++||..|=..  ...+++.|+
T Consensus         8 KNVll~fl~~~e~~--r~~ll~vi~   30 (46)
T smart00755        8 KNVLLQFLTLRESE--RETLLKVIS   30 (46)
T ss_pred             HHHHHHHhccCcch--HHHHHHHHH
Confidence            89999999988653  566666654


No 5  
>PF15611 EH_Signature:  EH_Signature domain
Probab=20.05  E-value=96  Score=28.75  Aligned_cols=50  Identities=20%  Similarity=0.270  Sum_probs=32.7

Q ss_pred             chhHHh-HHHHHHHHHHHHHHHhccCCCCC--CCCCcccccchhHHHHHHhcc
Q 044024          187 PVKECC-QQVCQNAILDAARKIAMDGMVSM--PENSTRIDDCKSIVFRWLASK  236 (296)
Q Consensus       187 PvkECC-~~vCQ~AI~eAA~~Is~~~~~~~--~~~s~~v~DCK~VVlrwLa~K  236 (296)
                      +..+|= .+.++.+|+|.++.+.++..-.-  ..=...-.+++++|.+||+++
T Consensus       199 ~~~~~~~~~~~~~~l~~~~l~~~GdPr~~~~~~~W~~v~e~a~~~v~~Wl~~~  251 (389)
T PF15611_consen  199 RYIDRSPDEPVHEALRDLLLAIWGDPRLPSSQPNWSGVSEEARQMVRRWLSKE  251 (389)
T ss_pred             HHHhcCccchhhHHHHHHHHHHhCCCCCCccccchhhcCHHHHHHHHHHHHHH
Confidence            333333 45788899999988777421111  112346679999999999876


No 6  
>PF13490 zf-HC2:  Putative zinc-finger; PDB: 2Z2S_F 2Q1Z_B 3HUG_T.
Probab=14.58  E-value=1.4e+02  Score=19.13  Aligned_cols=30  Identities=17%  Similarity=0.460  Sum_probs=21.6

Q ss_pred             cchhHHHHHHhccCCcchhhHHhhhhhcCc
Q 044024          224 DCKSIVFRWLASKLDPSSANGVLRALSNCK  253 (296)
Q Consensus       224 DCK~VVlrwLa~KL~p~~An~~lR~LSnCk  253 (296)
                      +.+..+..|+-+.|++.....+-.-|..|.
T Consensus         3 ~~~~~l~~y~dg~L~~~~~~~~~~HL~~C~   32 (36)
T PF13490_consen    3 EVRELLSAYLDGELSPEERARLEAHLASCP   32 (36)
T ss_dssp             --HHHHHHHHCT-S-HHHHHHHHHHHCT-H
T ss_pred             HHHHHHHHHHcCCCCHHHHHHHHHHHHcCH
Confidence            446678899999999999999888888873


No 7  
>PF09507 CDC27:  DNA polymerase subunit Cdc27;  InterPro: IPR019038  This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterised by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif. ; GO: 0006260 DNA replication, 0005634 nucleus; PDB: 1U76_B 3E0J_B.
Probab=13.50  E-value=49  Score=30.79  Aligned_cols=22  Identities=23%  Similarity=0.634  Sum_probs=16.0

Q ss_pred             HHHHHHhccCCc--chhhHHhhhh
Q 044024          228 IVFRWLASKLDP--SSANGVLRAL  249 (296)
Q Consensus       228 VVlrwLa~KL~p--~~An~~lR~L  249 (296)
                      |=|||||+.|+-  ..|+.||...
T Consensus         3 VTYk~LSr~l~ihvn~AK~~L~ef   26 (430)
T PF09507_consen    3 VTYKWLSRELGIHVNQAKQMLYEF   26 (430)
T ss_dssp             EEHHHHHHHHT--HHHHHHHHHHH
T ss_pred             eeHHHHHHHhCCCHHHHHHHHHHH
Confidence            559999998865  5788887643


No 8  
>COG5567 Predicted small periplasmic lipoprotein [Cell motility and secretion]
Probab=13.37  E-value=2.3e+02  Score=22.12  Aligned_cols=33  Identities=24%  Similarity=0.274  Sum_probs=23.6

Q ss_pred             hhHHhhhhhcCcCCcccccCCCCCCCCCccccccc
Q 044024          242 ANGVLRALSNCKVNKASKLPARPTAKPSQATAGFQ  276 (296)
Q Consensus       242 An~~lR~LSnCkVNkvCPL~F~d~~~~s~~~ag~q  276 (296)
                      |-.+|-.|.+|-.-+  ||.||+-.|.++--++-|
T Consensus        10 ala~l~sLA~CG~KG--PLy~Ppadk~a~~D~~~q   42 (58)
T COG5567          10 ALATLFSLAGCGLKG--PLYFPPADKNAPPDQQTQ   42 (58)
T ss_pred             HHHHHHHHHhcccCC--CccCChhhccCCcccccc
Confidence            344555999998776  999999888666444433


No 9  
>PF06870 RNA_pol_I_A49:  A49-like RNA polymerase I associated factor ;  InterPro: IPR009668  Saccharomyces cerevisiae A49 is a specific subunit associated with RNA polymerase I (Pol I) in eukaryotes. Pol I maintains transcription activities in A49 deletion mutants. However, such mutants are deficient in transcription activity at low temperatures. Deletion analysis of the fusion yeast homologue indicates that only the C-terminal two thirds are required for function. Transcript analysis has demonstrated that A49 is maximising transcription of ribosomal DNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus; PDB: 3NFG_A 3NFH_B.
Probab=12.21  E-value=77  Score=30.00  Aligned_cols=21  Identities=43%  Similarity=0.695  Sum_probs=15.8

Q ss_pred             ccCCcchhhHHhhhhhcCcCCc
Q 044024          235 SKLDPSSANGVLRALSNCKVNK  256 (296)
Q Consensus       235 ~KL~p~~An~~lR~LSnCkVNk  256 (296)
                      =|+++....+.||.| ||+|.+
T Consensus       329 Lkl~~~~l~~~~r~L-GC~v~~  349 (385)
T PF06870_consen  329 LKLSPKKLTQYFREL-GCKVKK  349 (385)
T ss_dssp             HT--HHHHHHHHHHT-T-EEEE
T ss_pred             hCCCHHHHHHHHHHh-CCEecc
Confidence            378899999999998 799988


No 10 
>PF01042 Ribonuc_L-PSP:  Endoribonuclease L-PSP;  InterPro: IPR006175  This domain is found in endoribonuclease, that is active on single-stranded mRNA and inhibits protein synthesis by cleavage of mRNA []. Previously it was thought to inhibit protein synthesis initiation []. This endoribonuclease may also be involved in the regulation of purine biosynthesis []. ; PDB: 3GTZ_B 3V4D_E 1J7H_A 3R0P_D 2IG8_A 1QD9_B 3L7Q_E 3VCZ_A 3QUW_A 2EWC_K ....
Probab=11.04  E-value=2e+02  Score=22.73  Aligned_cols=42  Identities=24%  Similarity=0.461  Sum_probs=0.0

Q ss_pred             hhccCC--ccce-ecc-ccchhhhHHHHHHHHHhcCcccccccccccc
Q 044024          109 GQYSKY--SGML-SLN-TTNAQHCLSDFEKILETQGANRNLKTICSIH  152 (296)
Q Consensus       109 Gq~Sk~--s~~L-aLn-~t~A~~C~SDi~~iL~sqGAn~~l~~iCSv~  152 (296)
                      ||...+  +|.+ .-+ ...+..+|..|+.+|.+.|++  +.++.+++
T Consensus        25 Gq~~~d~~~~~~~~~~~~~Q~~~~l~ni~~~L~~~G~~--~~dvv~~~   70 (121)
T PF01042_consen   25 GQVGIDPATGQVVPGDIEEQTRQALDNIERILAAAGAS--LDDVVKVT   70 (121)
T ss_dssp             EEESBCTTTSSBSSSSHHHHHHHHHHHHHHHHHHTTS---GGGEEEEE
T ss_pred             eeCCcCCCCCcCCCCCHHHHHHHHHHhhhhhhhcCCCc--ceeEeeee


Done!