Citrus Sinensis ID: 044053

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MDSSTQSTVFNVPKLKLSSSSGHLNMPVIGLGCAVDKSDTDALKLAVLEAIKLGYRHFDTAAMYGTEKALGEAIAEALRLGLVSSREQLFITSKLWCQNAHRDHVIPALKKSLSALQMEYLDLYLVHLPISSKPGEVGFPVPKEDLLPMDYRGVWEAMEESQMLGLTKSIGLSNFSCKKIETILTFATIPPSINQVEMHPVWQQRKLIEFCKAKGIIVTAYSPLGAVGKIYGSNQVLENEALKEIAKAHGKTVAQVSLRWIVEQGATVVVKSLNLERMKQNLGIFDWKLTDDDYDKINQIPQHRLIPSDFWVSPQGPFKTLEELWDD
cccccccccccccEEEECcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccc
*************KLKLSSSSGHLNMPVIGLGCAVDKSDTDALKLAVLEAIKLGYRHFDTAAMYGTEKALGEAIAEALRLGLVSSREQLFITSKLWCQNAHRDHVIPALKKSLSALQMEYLDLYLVHLPISSKPGEVGFPVPKEDLLPMDYRGVWEAMEESQMLGLTKSIGLSNFSCKKIETILTFATIPPSINQVEMHPVWQQRKLIEFCKAKGIIVTAYSPLGAVGKIYGSNQVLENEALKEIAKAHGKTVAQVSLRWIVEQGATVVVKSLNLERMKQNLGIFDWKLTDDDYDKINQIPQHRLIPSDFWVSPQGPFKTLEELWDD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSTQSTVFNVPKLKLSSSSGHLNMPVIGLGCAVDKSDTDALKLAVLEAIKLGYRHFDTAAMYGTEKALGEAIAEALRLGLVSSREQLFITSKLWCQNAHRDHVIPALKKSLSALQMEYLDLYLVHLPISSKPGEVGFPVPKEDLLPMDYRGVWEAMEESQMLGLTKSIGLSNFSCKKIETILTFATIPPSINQVEMHPVWQQRKLIEFCKAKGIIVTAYSPLGAVGKIYGSNQVLENEALKEIAKAHGKTVAQVSLRWIVEQGATVVVKSLNLERMKQNLGIFDWKLTDDDYDKINQIPQHRLIPSDFWVSPQGPFKTLEELWDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alcohol dehydrogenase [NADP(+)] A Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs.probableQ6AZW2
NADPH-dependent codeinone reductase 1-3 Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.probableQ9SQ68
NAD(P)H-dependent D-xylose reductase Reduces D-xylose into xylitol. Has a preference for NADPH, but can also utilize NADH as cosubstrate.probableP31867

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H7U, chain A
Confidence level:very confident
Coverage over the Query: 11-327
View the alignment between query and template
View the model in PyMOL