Query         044065
Match_columns 81
No_of_seqs    27 out of 29
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 11:09:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044065.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044065hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10868 DUF2667:  Protein of u  97.2 0.00042   9E-09   46.9   3.4   66    6-79      4-77  (90)
  2 PF01097 Defensin_2:  Arthropod  79.5     1.1 2.5E-05   25.3   1.2   27   51-80      7-34  (34)
  3 PF09680 Tiny_TM_bacill:  Prote  62.6     7.2 0.00016   21.0   1.8   15    9-23      6-20  (24)
  4 cd00107 Knot1 The "knottin" fo  56.5      12 0.00026   20.0   2.1   26   53-80      7-33  (33)
  5 PF11395 DUF2873:  Protein of u  56.1      13 0.00029   22.3   2.4   18    7-24     12-29  (43)
  6 PF12113 SVM_signal:  SVM prote  55.7     9.9 0.00021   21.8   1.7   21    3-23      5-25  (33)
  7 TIGR03042 PS_II_psbQ_bact phot  50.5      17 0.00036   26.2   2.6   23    6-29      2-24  (142)
  8 PF07127 Nodulin_late:  Late no  49.9      27 0.00058   20.6   3.0   12    1-13      1-12  (54)
  9 PHA02291 hypothetical protein   48.9      17 0.00036   26.3   2.4   21    1-22      1-21  (132)
 10 PF14865 Macin:  Macin; PDB: 2K  46.5      15 0.00032   23.5   1.6   26   53-80     22-59  (59)
 11 TIGR01781 Trep_dent_lipo Trepo  44.9      15 0.00033   30.8   1.8   20    1-20      1-20  (412)
 12 PF12911 OppC_N:  N-terminal TM  42.4      23 0.00051   20.1   1.9   17    3-19     14-30  (56)
 13 PHA02680 ORF090 IMV phosphoryl  39.1      24 0.00053   24.2   1.9   18    6-23     48-65  (91)
 14 PF07423 DUF1510:  Protein of u  37.9      26 0.00057   26.6   2.1   19    5-23     12-30  (217)
 15 PF04202 Mfp-3:  Foot protein 3  37.3      23  0.0005   23.3   1.5   13    7-19      2-14  (71)
 16 smart00505 Knot1 Knottins. Kno  37.0      36 0.00077   18.6   2.1   25   54-80     19-44  (45)
 17 TIGR01732 tiny_TM_bacill conse  36.8      36 0.00078   18.6   2.0   14    9-22      8-21  (26)
 18 PF05663 DUF809:  Protein of un  36.7      31 0.00066   24.8   2.2   16    5-20     21-36  (138)
 19 PF11812 DUF3333:  Domain of un  36.2      30 0.00066   24.8   2.1   21    8-29     24-44  (155)
 20 COG5567 Predicted small peripl  35.3      40 0.00087   21.5   2.3   18    7-24      3-20  (58)
 21 PF10917 DUF2708:  Protein of u  34.9      15 0.00032   22.3   0.3   15    6-20      1-15  (43)
 22 PF08138 Sex_peptide:  Sex pept  34.1      13 0.00029   23.5   0.0   17    6-22      1-17  (56)
 23 COG4744 Uncharacterized conser  33.5      34 0.00073   24.6   1.9   14    7-20     33-46  (121)
 24 PF07333 SLR1-BP:  S locus-rela  31.8      34 0.00073   20.2   1.5   28   53-80     25-55  (58)
 25 PRK14710 hypothetical protein;  31.4      36 0.00079   23.0   1.7   16    4-19      9-24  (86)
 26 PF15102 TMEM154:  TMEM154 prot  30.8      37  0.0008   24.8   1.8   15    7-21     61-75  (146)
 27 PRK00059 prsA peptidylprolyl i  30.4      38 0.00083   25.4   1.9   20    6-25      5-24  (336)
 28 TIGR02184 Myco_arth_vir_N Myco  30.1      38 0.00083   19.4   1.4   19    3-21      6-24  (33)
 29 TIGR02747 TraV type IV conjuga  29.0      50  0.0011   23.9   2.2   30   14-44      9-39  (144)
 30 PF00451 Toxin_2:  Scorpion sho  27.7      36 0.00078   19.0   1.0   24   53-80      7-32  (32)
 31 PF07438 DUF1514:  Protein of u  27.5      61  0.0013   21.1   2.2   14    8-21      4-17  (66)
 32 TIGR02209 ftsL_broad cell divi  27.2      64  0.0014   19.6   2.2   12    7-18      2-13  (85)
 33 PRK11060 rod shape-determining  26.6      62  0.0013   23.3   2.4   22    1-22      1-25  (162)
 34 COG4808 Uncharacterized protei  25.7      56  0.0012   24.3   2.0   21    6-26      5-25  (152)
 35 PF02950 Conotoxin:  Conotoxin;  25.1      24 0.00052   21.1   0.0   14    7-20      2-15  (75)
 36 PHA02909 hypothetical protein;  25.0      68  0.0015   21.0   2.1   13    8-20     35-47  (72)
 37 cd00053 EGF Epidermal growth f  24.9      57  0.0012   15.5   1.4   16   65-80     11-26  (36)
 38 PF12606 RELT:  Tumour necrosis  24.4      80  0.0017   19.2   2.2   12    8-19      6-17  (50)
 39 PRK10523 lipoprotein involved   24.0      73  0.0016   24.6   2.4   22    7-28      4-25  (234)
 40 PF15284 PAGK:  Phage-encoded v  23.5      75  0.0016   20.4   2.0   14    7-20      3-16  (61)
 41 PF07403 DUF1505:  Protein of u  23.2      79  0.0017   22.3   2.3   10   12-21      4-13  (114)
 42 PF09125 COX2-transmemb:  Cytoc  23.0   1E+02  0.0022   18.2   2.4   15    7-21     15-29  (38)
 43 PF13124 DUF3963:  Protein of u  22.8      82  0.0018   18.7   2.0   15    7-21     23-37  (40)
 44 PF08194 DIM:  DIM protein;  In  22.6      61  0.0013   18.8   1.4   13    6-18      1-13  (36)
 45 PHA03055 Hypothetical protein;  22.2   1E+02  0.0022   20.6   2.6   22    1-23      1-22  (79)
 46 PLN03207 stomagen; Provisional  21.7 1.1E+02  0.0024   21.7   2.8   23    6-28     11-33  (113)
 47 PF12173 BacteriocIIc_cy:  Bact  21.0      93   0.002   21.4   2.2   17    6-22     12-28  (91)
 48 smart00272 END Endothelin.      20.8      57  0.0012   17.7   0.9    9   53-61     10-18  (26)
 49 PHA03164 hypothetical protein;  20.3      56  0.0012   22.3   1.0   19    4-22     53-71  (88)

No 1  
>PF10868 DUF2667:  Protein of unknown function (DUF2667);  InterPro: IPR022618  This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana. 
Probab=97.20  E-value=0.00042  Score=46.94  Aligned_cols=66  Identities=30%  Similarity=0.573  Sum_probs=45.0

Q ss_pred             chhhHHHHHHHHHHHhhh--hcccCCCcccCCCCCcccCCCCCCCCCCCccchHHHhhcC---CCccceeCCC---Ccce
Q 044065            6 TKVFSFIILAVLLLTIIN--CNEVSASKCCRNHPQLGNCVKGKDDQPNTGKCWKYCTTEC---KGCICKPVKS---EHHC   77 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~~--c~~~~~~~CC~~hp~~G~C~~~~DD~~n~~kCn~wC~~~C---kGG~CK~~~~---~h~C   77 (81)
                      +||.+|||++|+.|||+.  =.+++..+.|.  --+|.|.+.  +    ++||++|.+-.   .||+|.+.+.   ...|
T Consensus         4 lk~st~~ilvvvclsiLLisp~eV~G~~~cd--~~~G~C~~~--~----~~C~~~Ck~~~~~y~GG~C~~~~~~~~~~~C   75 (90)
T PF10868_consen    4 LKLSTFVILVVVCLSILLISPTEVDGRLKCD--SPFGACTPF--S----SDCNEPCKKFGSNYYGGQCVPVGPPPGDGVC   75 (90)
T ss_pred             eEEEeeehhHHHHHHHHccccceeCCeEccC--cccccCCch--H----HHHHHHHHhhccCCCCceeccCCCCCCCcEE
Confidence            577777777777666442  12223344564  379999997  3    69999999877   7999998755   3455


Q ss_pred             ee
Q 044065           78 HC   79 (81)
Q Consensus        78 HC   79 (81)
                      -|
T Consensus        76 ~C   77 (90)
T PF10868_consen   76 YC   77 (90)
T ss_pred             EE
Confidence            44


No 2  
>PF01097 Defensin_2:  Arthropod defensin;  InterPro: IPR001542 Arthropod defensins are a family of insect and scorpion cysteine-rich antibacterial peptides, primarily active against Gram-positive bacteria [, , , , ]. All these peptides range in length from 38 to 51 amino acids. There are six conserved cysteines all involved in intrachain disulphide bonds. A schematic representation of peptides from the arthropod defensin family is shown below.  +----------------------------+ | | xxCxxxxxxxxxxxxxxCxxxCxxxxxxxxxCxxxxxCxCxx | | | | +---|---------------+ | +-----------------+ 'C': conserved cysteine involved in a disulphide bond.   Although low level sequence similarities have been reported [] between the arthropod defensins and mammalian defensins, the topological arrangement of the disulphide bonds as well as the tertiary structure [] are completely different in the two families.; GO: 0006952 defense response; PDB: 1FJN_A 1ICA_A 1L4V_A 2LLD_A 3E7R_L 3E7U_X 1ZFU_A 2B68_A 2NZ3_A 2NY8_X ....
Probab=79.48  E-value=1.1  Score=25.30  Aligned_cols=27  Identities=26%  Similarity=0.662  Sum_probs=22.2

Q ss_pred             CCccchHHHhh-cCCCccceeCCCCcceeec
Q 044065           51 NTGKCWKYCTT-ECKGCICKPVKSEHHCHCM   80 (81)
Q Consensus        51 n~~kCn~wC~~-~CkGG~CK~~~~~h~CHCy   80 (81)
                      |+..|..-|++ +-+||+|..   +.+|.||
T Consensus         7 n~~~C~~hC~~~g~~GGyC~~---~~vC~Cr   34 (34)
T PF01097_consen    7 NHSACAAHCLSIGYRGGYCNG---KGVCVCR   34 (34)
T ss_dssp             TCHHHHHHHHHHTCSEEEEET---TSCEEEE
T ss_pred             CHHHHHHHHHHhCCcceeCCC---CCEEEeC
Confidence            44689999976 559999996   8899997


No 3  
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=62.57  E-value=7.2  Score=21.03  Aligned_cols=15  Identities=33%  Similarity=0.791  Sum_probs=7.4

Q ss_pred             hHHHHHHHHHHHhhh
Q 044065            9 FSFIILAVLLLTIIN   23 (81)
Q Consensus         9 ~sf~l~~vl~ls~~~   23 (81)
                      |+++++++++|.|+.
T Consensus         6 FalivVLFILLiIvG   20 (24)
T PF09680_consen    6 FALIVVLFILLIIVG   20 (24)
T ss_pred             chhHHHHHHHHHHhc
Confidence            444444555554544


No 4  
>cd00107 Knot1 The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments. Members include plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins, and arthropod defensins.
Probab=56.45  E-value=12  Score=19.99  Aligned_cols=26  Identities=27%  Similarity=0.607  Sum_probs=17.0

Q ss_pred             ccchHHHhhc-CCCccceeCCCCcceeec
Q 044065           53 GKCWKYCTTE-CKGCICKPVKSEHHCHCM   80 (81)
Q Consensus        53 ~kCn~wC~~~-CkGG~CK~~~~~h~CHCy   80 (81)
                      ..|++.|.+. =++|+|...  +..|.|+
T Consensus         7 ~~C~~~Ck~~g~~~G~C~~~--~~~C~C~   33 (33)
T cd00107           7 SYCDKECKKKGASGGYCYGQ--GLACWCY   33 (33)
T ss_pred             hhHHHHHhHcCCCccEeCCC--CCeEEeC
Confidence            3677777763 378999753  3457664


No 5  
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=56.11  E-value=13  Score=22.29  Aligned_cols=18  Identities=28%  Similarity=0.543  Sum_probs=12.7

Q ss_pred             hhhHHHHHHHHHHHhhhh
Q 044065            7 KVFSFIILAVLLLTIINC   24 (81)
Q Consensus         7 ~v~sf~l~~vl~ls~~~c   24 (81)
                      -|.||.|++|++..||-|
T Consensus        12 c~l~~llflv~imliif~   29 (43)
T PF11395_consen   12 CFLSFLLFLVIIMLIIFW   29 (43)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            367888888886666655


No 6  
>PF12113 SVM_signal:  SVM protein signal sequence;  InterPro: IPR021970  This domain is presumed to be a signal peptide sequence found in Sequence-variable mosaic (SVM) proteins []. It is found in phytoplasmas. This presumed signal sequence is about 30 amino acids in length. 
Probab=55.69  E-value=9.9  Score=21.79  Aligned_cols=21  Identities=24%  Similarity=0.384  Sum_probs=17.3

Q ss_pred             cccchhhHHHHHHHHHHHhhh
Q 044065            3 QSQTKVFSFIILAVLLLTIIN   23 (81)
Q Consensus         3 ~~~~~v~sf~l~~vl~ls~~~   23 (81)
                      ++|.++++++|+..|=|.+|.
T Consensus         5 knq~~ii~i~Lf~~LGL~fI~   25 (33)
T PF12113_consen    5 KNQFKIINIFLFIFLGLFFIT   25 (33)
T ss_pred             hhchhhhhhHHHHHHHHHhee
Confidence            578999999999999776653


No 7  
>TIGR03042 PS_II_psbQ_bact photosystem II protein PsbQ. This protein through the member sll1638 from Synechocystis sp. PCC 6803, was shown to be part of the cyanobacteria photosystem II. It is homologous to (but quite diverged from) the chloroplast PsbQ protein, called oxygen-evolving enhancer protein 3 (OEE3). We designate this cyanobacteria protein PsbQ by homology.
Probab=50.55  E-value=17  Score=26.24  Aligned_cols=23  Identities=17%  Similarity=0.528  Sum_probs=17.4

Q ss_pred             chhhHHHHHHHHHHHhhhhcccCC
Q 044065            6 TKVFSFIILAVLLLTIINCNEVSA   29 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~~c~~~~~   29 (81)
                      .+++||+|+++++| |..|-+..+
T Consensus         2 r~~~s~~Lv~~~~~-Lvsc~~p~~   24 (142)
T TIGR03042         2 RSLASLLLVLLLTF-LVSCSGPAA   24 (142)
T ss_pred             hhHHHHHHHHHHHH-HHHcCCCcc
Confidence            57899999998888 666755443


No 8  
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=49.88  E-value=27  Score=20.57  Aligned_cols=12  Identities=33%  Similarity=0.301  Sum_probs=7.0

Q ss_pred             CCcccchhhHHHH
Q 044065            1 MAQSQTKVFSFII   13 (81)
Q Consensus         1 ma~~~~~v~sf~l   13 (81)
                      ||+- .|++...+
T Consensus         1 Ma~i-lKFvY~mI   12 (54)
T PF07127_consen    1 MAKI-LKFVYAMI   12 (54)
T ss_pred             Cccc-hhhHHHHH
Confidence            7777 66555443


No 9  
>PHA02291 hypothetical protein
Probab=48.91  E-value=17  Score=26.29  Aligned_cols=21  Identities=24%  Similarity=0.567  Sum_probs=15.5

Q ss_pred             CCcccchhhHHHHHHHHHHHhh
Q 044065            1 MAQSQTKVFSFIILAVLLLTII   22 (81)
Q Consensus         1 ma~~~~~v~sf~l~~vl~ls~~   22 (81)
                      |.++ ..+|.+.+++||+++|.
T Consensus         1 MS~K-~~iFYiL~~~VL~~si~   21 (132)
T PHA02291          1 MSRK-ASIFYILVVIVLAFSIS   21 (132)
T ss_pred             CCcc-hhhHHHHHHHHHHHHHH
Confidence            4444 77888888889888763


No 10 
>PF14865 Macin:  Macin; PDB: 2K35_A 2LN8_A.
Probab=46.52  E-value=15  Score=23.47  Aligned_cols=26  Identities=27%  Similarity=0.788  Sum_probs=16.3

Q ss_pred             ccchHHHhhcC---CCccceeCC---------CCcceeec
Q 044065           53 GKCWKYCTTEC---KGCICKPVK---------SEHHCHCM   80 (81)
Q Consensus        53 ~kCn~wC~~~C---kGG~CK~~~---------~~h~CHCy   80 (81)
                      ..|+.+|.  |   .||.|.+..         ..-+|+||
T Consensus        22 ~sC~~~Ck--c~G~~gG~C~~~pS~C~l~~~~~~~qC~C~   59 (59)
T PF14865_consen   22 KSCNDRCK--CLGHDGGECVLSPSNCPLSRLDKAWQCQCY   59 (59)
T ss_dssp             -CCHHHHH--TTT-SEEEEEE-CCG-S-TT-TT-EEEEEE
T ss_pred             hHhhHHHH--HcCCCCCceEeCCCCCcccccccceeeeeC
Confidence            46777777  5   889987542         33478886


No 11 
>TIGR01781 Trep_dent_lipo Treponema denticola clustered lipoprotein. This model represents a family of six predicted lipoproteins from a region of about 20 tandemly arranged genes in the Treponema denticola genome. Two other neighboring genes share the lipoprotein signal peptide region but do not show more extensive homology. The function of this locus is unknown.
Probab=44.91  E-value=15  Score=30.78  Aligned_cols=20  Identities=35%  Similarity=0.615  Sum_probs=17.4

Q ss_pred             CCcccchhhHHHHHHHHHHH
Q 044065            1 MAQSQTKVFSFIILAVLLLT   20 (81)
Q Consensus         1 ma~~~~~v~sf~l~~vl~ls   20 (81)
                      |-+.++|++-+.+||||+||
T Consensus         1 mkkdklklifil~la~llfs   20 (412)
T TIGR01781         1 MKKDKLKLIFILMLAVLLFS   20 (412)
T ss_pred             CCccceeehHHHHHHHHHhh
Confidence            67778999999999999996


No 12 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=42.36  E-value=23  Score=20.09  Aligned_cols=17  Identities=35%  Similarity=0.641  Sum_probs=11.4

Q ss_pred             cccchhhHHHHHHHHHH
Q 044065            3 QSQTKVFSFIILAVLLL   19 (81)
Q Consensus         3 ~~~~~v~sf~l~~vl~l   19 (81)
                      ++++-++++++++++++
T Consensus        14 ~nk~a~~gl~il~~~vl   30 (56)
T PF12911_consen   14 RNKLAVIGLIILLILVL   30 (56)
T ss_pred             hCchHHHHHHHHHHHHH
Confidence            35567777777776655


No 13 
>PHA02680 ORF090 IMV phosphorylated membrane protein; Provisional
Probab=39.11  E-value=24  Score=24.21  Aligned_cols=18  Identities=44%  Similarity=0.521  Sum_probs=14.4

Q ss_pred             chhhHHHHHHHHHHHhhh
Q 044065            6 TKVFSFIILAVLLLTIIN   23 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~~   23 (81)
                      ..+++|+|-+|++|.+.+
T Consensus        48 lSii~FIlG~vl~lGili   65 (91)
T PHA02680         48 LSVTCFIVGAVLLLGLFV   65 (91)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            457899999999998654


No 14 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=37.88  E-value=26  Score=26.62  Aligned_cols=19  Identities=37%  Similarity=0.408  Sum_probs=11.7

Q ss_pred             cchhhHHHHHHHHHHHhhh
Q 044065            5 QTKVFSFIILAVLLLTIIN   23 (81)
Q Consensus         5 ~~~v~sf~l~~vl~ls~~~   23 (81)
                      +.+|+=++|.+|++|-|++
T Consensus        12 ~N~iLNiaI~IV~lLIiiv   30 (217)
T PF07423_consen   12 TNKILNIAIGIVSLLIIIV   30 (217)
T ss_pred             hhhhHHHHHHHHHHHHHHH
Confidence            3566667777777665443


No 15 
>PF04202 Mfp-3:  Foot protein 3;  InterPro: IPR007328 Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels.
Probab=37.30  E-value=23  Score=23.35  Aligned_cols=13  Identities=31%  Similarity=0.483  Sum_probs=9.3

Q ss_pred             hhhHHHHHHHHHH
Q 044065            7 KVFSFIILAVLLL   19 (81)
Q Consensus         7 ~v~sf~l~~vl~l   19 (81)
                      +-+|++.|++|||
T Consensus         2 nn~Si~VLlaLvL   14 (71)
T PF04202_consen    2 NNLSIAVLLALVL   14 (71)
T ss_pred             CchhHHHHHHHHH
Confidence            4467777777777


No 16 
>smart00505 Knot1 Knottins. Knottins, representing plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins and arthropod defensins.
Probab=37.03  E-value=36  Score=18.64  Aligned_cols=25  Identities=32%  Similarity=0.878  Sum_probs=16.4

Q ss_pred             cchHHHhhc-CCCccceeCCCCcceeec
Q 044065           54 KCWKYCTTE-CKGCICKPVKSEHHCHCM   80 (81)
Q Consensus        54 kCn~wC~~~-CkGG~CK~~~~~h~CHCy   80 (81)
                      .|++.|.+. =+||+|+..  +..|.|+
T Consensus        19 ~C~~~C~~~g~~~G~C~~~--~~~C~C~   44 (45)
T smart00505       19 LCAKLCKKKGAKGGYCRGT--TRRCFCY   44 (45)
T ss_pred             HhHHHhhhcCCCCCCcCCc--CCceEee
Confidence            577777663 368999753  3467775


No 17 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=36.85  E-value=36  Score=18.61  Aligned_cols=14  Identities=36%  Similarity=0.852  Sum_probs=6.4

Q ss_pred             hHHHHHHHHHHHhh
Q 044065            9 FSFIILAVLLLTII   22 (81)
Q Consensus         9 ~sf~l~~vl~ls~~   22 (81)
                      |++++++.++|-|+
T Consensus         8 f~livVLFILLIIi   21 (26)
T TIGR01732         8 FALIVVLFILLVIV   21 (26)
T ss_pred             hHHHHHHHHHHHHh
Confidence            34444444455443


No 18 
>PF05663 DUF809:  Protein of unknown function (DUF809);  InterPro: IPR008527 This family consists of several proteins of unknown function Raphanus sativus (Radish) and Brassica napus (Rape).
Probab=36.66  E-value=31  Score=24.84  Aligned_cols=16  Identities=44%  Similarity=0.744  Sum_probs=12.5

Q ss_pred             cchhhHHHHHHHHHHH
Q 044065            5 QTKVFSFIILAVLLLT   20 (81)
Q Consensus         5 ~~~v~sf~l~~vl~ls   20 (81)
                      +..|+||+|++-|+..
T Consensus        21 kvsvisffllayllma   36 (138)
T PF05663_consen   21 KVSVISFFLLAYLLMA   36 (138)
T ss_pred             eeehHHHHHHHHHHHH
Confidence            4679999999977653


No 19 
>PF11812 DUF3333:  Domain of unknown function (DUF3333);  InterPro: IPR024573 This N-terminal domain is functionally uncharacterised and it is found in proteins annotated as putative phosphate ABC transporter permease proteins. This presumed domain is typically between 116 to 159 amino acids in length.
Probab=36.19  E-value=30  Score=24.84  Aligned_cols=21  Identities=24%  Similarity=0.521  Sum_probs=14.3

Q ss_pred             hhHHHHHHHHHHHhhhhcccCC
Q 044065            8 VFSFIILAVLLLTIINCNEVSA   29 (81)
Q Consensus         8 v~sf~l~~vl~ls~~~c~~~~~   29 (81)
                      +++++++++|+.||+. .||.+
T Consensus        24 ~~~l~fL~~ll~sI~~-~G~~A   44 (155)
T PF11812_consen   24 AIALAFLVILLFSIVS-KGYPA   44 (155)
T ss_pred             HHHHHHHHHHHHHHHh-cchhh
Confidence            4666777777777775 66654


No 20 
>COG5567 Predicted small periplasmic lipoprotein [Cell motility and secretion]
Probab=35.35  E-value=40  Score=21.48  Aligned_cols=18  Identities=22%  Similarity=0.591  Sum_probs=11.4

Q ss_pred             hhhHHHHHHHHHHHhhhh
Q 044065            7 KVFSFIILAVLLLTIINC   24 (81)
Q Consensus         7 ~v~sf~l~~vl~ls~~~c   24 (81)
                      ++|+-.+++++++||..|
T Consensus         3 ~~~~s~~ala~l~sLA~C   20 (58)
T COG5567           3 NVFKSLLALATLFSLAGC   20 (58)
T ss_pred             hHHHHHHHHHHHHHHHhc
Confidence            455555556666688776


No 21 
>PF10917 DUF2708:  Protein of unknown function (DUF2708);  InterPro: IPR024415 This entry represents fungus-induced proteins which may have role in hypoxia response[].
Probab=34.95  E-value=15  Score=22.26  Aligned_cols=15  Identities=27%  Similarity=0.660  Sum_probs=10.6

Q ss_pred             chhhHHHHHHHHHHH
Q 044065            6 TKVFSFIILAVLLLT   20 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls   20 (81)
                      |.|.|.++|++|.+|
T Consensus         1 MN~YsvfvFaiLais   15 (43)
T PF10917_consen    1 MNVYSVFVFAILAIS   15 (43)
T ss_pred             CceeeehHHHHhhhh
Confidence            456777777777764


No 22 
>PF08138 Sex_peptide:  Sex peptide (SP) family;  InterPro: IPR012608 This family consists of Sex Peptides (SP) that are found in Drosophila. On mating, Drosophila females decreases her remating rate and increases her egg-laying rate due, in part, to the transfer of SP from the male to the female. SP are found in seminal fluids transferred from the male to the female during mating. The male seminal fluid proteins are referred to as accessory gland proteins (Acps). The SP is one of the most interesting Acps and plays an important role in reproduction [].; GO: 0005179 hormone activity, 0046008 regulation of female receptivity, post-mating, 0005576 extracellular region; PDB: 2LAQ_A.
Probab=34.10  E-value=13  Score=23.50  Aligned_cols=17  Identities=41%  Similarity=0.563  Sum_probs=0.0

Q ss_pred             chhhHHHHHHHHHHHhh
Q 044065            6 TKVFSFIILAVLLLTII   22 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~   22 (81)
                      ||+.+|+|++++++.+.
T Consensus         1 Mk~p~~llllvlllGla   17 (56)
T PF08138_consen    1 MKTPIFLLLLVLLLGLA   17 (56)
T ss_dssp             -----------------
T ss_pred             CcchHHHHHHHHHHHHH
Confidence            56777778777777653


No 23 
>COG4744 Uncharacterized conserved protein [Function unknown]
Probab=33.52  E-value=34  Score=24.57  Aligned_cols=14  Identities=36%  Similarity=0.636  Sum_probs=10.2

Q ss_pred             hhhHHHHHHHHHHH
Q 044065            7 KVFSFIILAVLLLT   20 (81)
Q Consensus         7 ~v~sf~l~~vl~ls   20 (81)
                      -|||.+|+++|++|
T Consensus        33 mVfsva~LI~lv~S   46 (121)
T COG4744          33 MVFSVALLIALVMS   46 (121)
T ss_pred             HHHHHHHHHHHHHh
Confidence            46777777777776


No 24 
>PF07333 SLR1-BP:  S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP);  InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins. Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein [].  This entry also includes defensin-like proteins. The function of these proteins is uncharacterised.
Probab=31.82  E-value=34  Score=20.17  Aligned_cols=28  Identities=29%  Similarity=0.778  Sum_probs=17.9

Q ss_pred             ccchHHHhhcC-CC-cccee-CCCCcceeec
Q 044065           53 GKCWKYCTTEC-KG-CICKP-VKSEHHCHCM   80 (81)
Q Consensus        53 ~kCn~wC~~~C-kG-G~CK~-~~~~h~CHCy   80 (81)
                      +.|...|...= .+ |.|.+ ..+...|.|+
T Consensus        25 ~~C~~~C~~k~~g~~G~C~~~~~~~~~C~C~   55 (58)
T PF07333_consen   25 QDCRSLCKKKYKGGVGTCIPKPKGPKQCLCT   55 (58)
T ss_pred             HHHHHHHHHHcCCCceEeccCCCCCCeeEEE
Confidence            35555555444 34 78998 5667788884


No 25 
>PRK14710 hypothetical protein; Provisional
Probab=31.42  E-value=36  Score=22.98  Aligned_cols=16  Identities=31%  Similarity=0.671  Sum_probs=13.2

Q ss_pred             ccchhhHHHHHHHHHH
Q 044065            4 SQTKVFSFIILAVLLL   19 (81)
Q Consensus         4 ~~~~v~sf~l~~vl~l   19 (81)
                      |+|.+|-|+++++++|
T Consensus         9 skm~ififaiii~v~l   24 (86)
T PRK14710          9 SKMIIFIFAIIIIVVL   24 (86)
T ss_pred             hHHHHHHHHHHHHHHH
Confidence            4588889998888887


No 26 
>PF15102 TMEM154:  TMEM154 protein family
Probab=30.82  E-value=37  Score=24.79  Aligned_cols=15  Identities=27%  Similarity=0.700  Sum_probs=8.6

Q ss_pred             hhhHHHHHHHHHHHh
Q 044065            7 KVFSFIILAVLLLTI   21 (81)
Q Consensus         7 ~v~sf~l~~vl~ls~   21 (81)
                      .++..|||++|+|++
T Consensus        61 IlIP~VLLvlLLl~v   75 (146)
T PF15102_consen   61 ILIPLVLLVLLLLSV   75 (146)
T ss_pred             EeHHHHHHHHHHHHH
Confidence            455656666666654


No 27 
>PRK00059 prsA peptidylprolyl isomerase; Provisional
Probab=30.41  E-value=38  Score=25.38  Aligned_cols=20  Identities=20%  Similarity=0.685  Sum_probs=15.8

Q ss_pred             chhhHHHHHHHHHHHhhhhc
Q 044065            6 TKVFSFIILAVLLLTIINCN   25 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~~c~   25 (81)
                      .|+++++|+.+|+|++..|.
T Consensus         5 ~~~~~~~~~~~l~~~~~gc~   24 (336)
T PRK00059          5 KKLVASLLVGVFIFSAVGCN   24 (336)
T ss_pred             HHHHHHHHHHHHHHhhcccc
Confidence            67888888888888876664


No 28 
>TIGR02184 Myco_arth_vir_N Mycoplasma virulence family signal region. This model represents the N-terminal region, including a probable signal sequence or signal anchor which in most instances has four consecutive Lys residues before the hydrophobic stretch, of a family of large, virulence-associated proteins in Mycoplasma arthritidis and smaller proteins in Mycoplasma capricolum.
Probab=30.08  E-value=38  Score=19.40  Aligned_cols=19  Identities=21%  Similarity=0.537  Sum_probs=15.0

Q ss_pred             cccchhhHHHHHHHHHHHh
Q 044065            3 QSQTKVFSFIILAVLLLTI   21 (81)
Q Consensus         3 ~~~~~v~sf~l~~vl~ls~   21 (81)
                      +++.++.-|+|++.|+-|+
T Consensus         6 KKKnkIl~~al~a~l~~S~   24 (33)
T TIGR02184         6 KKKNKIATLVIVTSLLTSL   24 (33)
T ss_pred             hhhhheehHHHHHHHHHhh
Confidence            4568899999999887764


No 29 
>TIGR02747 TraV type IV conjugative transfer system lipoprotein TraV. The TraV protein is a component of conjugative type IV secretion systems. TraV is an outer membrane lipoprotein and is believed to interact with the secretin TraK. The alignment contains three conserved cysteines in the N-terminal half.
Probab=29.03  E-value=50  Score=23.95  Aligned_cols=30  Identities=17%  Similarity=0.534  Sum_probs=18.4

Q ss_pred             HHHHHHHhhhh-cccCCCcccCCCCCcccCCC
Q 044065           14 LAVLLLTIINC-NEVSASKCCRNHPQLGNCVK   44 (81)
Q Consensus        14 ~~vl~ls~~~c-~~~~~~~CC~~hp~~G~C~~   44 (81)
                      +++.+| |-.| ++.+..-=|+.--+||.|.+
T Consensus         9 ~~~~al-LtGCsag~~~~f~C~~~~~~~~C~t   39 (144)
T TIGR02747         9 IACVAF-LTGCSAGCNSNFSCEGTGGWGTCAT   39 (144)
T ss_pred             HHHHHH-hhcccCCCCCCccccCCCCCCcccc
Confidence            333444 6678 66665555666667777766


No 30 
>PF00451 Toxin_2:  Scorpion short toxin, BmKK2;  InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans. Among these peptides there is a family of short toxins (30 to 40 residues) [, ] including charybdotoxin, kaliotoxin [], noxiustoxin [] and iberiotoxin [, ]. Charybdotoxin consists of a single polypeptide chain and is a potent, selective inhibitor of calcium-activated potassium channels in pituitary and aortic smooth muscle cells - the toxin reversibly blocks channel activity by interacting at the external pore of the channel protein[]. The tertiary structure of the toxins comprises a 3-stranded beta-sheet and a short helix, and is stabilised by a number of disulphide bridges [] as shown in the following schematic representation:  +---------------------+ | | | | xxxxxxxCxxxxxCxxxCxxxxxxxxxxxCxxxxCxCxxx | | | | | +----------------+ | +----------------------+ 'C': conserved cysteine involved in a disulphide bond.  ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1TSK_A 2PTA_A 1BIG_A 3ODV_A 2UVS_A 2KTX_A 1XSW_A 1KTX_A 1WMT_A 1PNH_A ....
Probab=27.71  E-value=36  Score=18.97  Aligned_cols=24  Identities=29%  Similarity=1.005  Sum_probs=17.1

Q ss_pred             ccchHHHhhc--CCCccceeCCCCcceeec
Q 044065           53 GKCWKYCTTE--CKGCICKPVKSEHHCHCM   80 (81)
Q Consensus        53 ~kCn~wC~~~--CkGG~CK~~~~~h~CHCy   80 (81)
                      .+||.-|...  +.-|-|-    ...|+||
T Consensus         7 ~~C~~~Ck~~~g~~~gKCm----N~kC~Cy   32 (32)
T PF00451_consen    7 KDCWPPCKKATGCLNGKCM----NGKCKCY   32 (32)
T ss_dssp             HHHHHHHHHHTSSSEEEEE----TTEEEEE
T ss_pred             hHHHHHhhhhhCCCCCCcc----CCCceeC
Confidence            3688888765  6667666    6678887


No 31 
>PF07438 DUF1514:  Protein of unknown function (DUF1514);  InterPro: IPR009999 This entry is represented by Bacteriophage phi PVL, Orf60. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several Staphylococcus aureus and related bacteriophage proteins of around 65 residues in length. The function of this family is unknown.
Probab=27.53  E-value=61  Score=21.11  Aligned_cols=14  Identities=21%  Similarity=0.629  Sum_probs=10.0

Q ss_pred             hhHHHHHHHHHHHh
Q 044065            8 VFSFIILAVLLLTI   21 (81)
Q Consensus         8 v~sf~l~~vl~ls~   21 (81)
                      ++|++|.++|+.+|
T Consensus         4 iiSIvLai~lLI~l   17 (66)
T PF07438_consen    4 IISIVLAIALLISL   17 (66)
T ss_pred             hHHHHHHHHHHHHH
Confidence            56777777777765


No 32 
>TIGR02209 ftsL_broad cell division protein FtsL. This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the Pfam model pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species.
Probab=27.22  E-value=64  Score=19.56  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=5.1

Q ss_pred             hhhHHHHHHHHH
Q 044065            7 KVFSFIILAVLL   18 (81)
Q Consensus         7 ~v~sf~l~~vl~   18 (81)
                      +.+.++|+++++
T Consensus         2 ~~l~~~l~~~v~   13 (85)
T TIGR02209         2 KKLYVLLLLAIL   13 (85)
T ss_pred             chHHHHHHHHHH
Confidence            334444444443


No 33 
>PRK11060 rod shape-determining protein MreD; Provisional
Probab=26.58  E-value=62  Score=23.30  Aligned_cols=22  Identities=32%  Similarity=0.495  Sum_probs=14.8

Q ss_pred             CCcccch---hhHHHHHHHHHHHhh
Q 044065            1 MAQSQTK---VFSFIILAVLLLTII   22 (81)
Q Consensus         1 ma~~~~~---v~sf~l~~vl~ls~~   22 (81)
                      ||+++.+   ++.+-++++++|+++
T Consensus         1 ~~~~~~~~~~~I~ls~~vAl~L~i~   25 (162)
T PRK11060          1 MASYRSRGRWVIWLSFLIALVLQIM   25 (162)
T ss_pred             CCccccCccHHHHHHHHHHHHHHhC
Confidence            7777554   666667777777664


No 34 
>COG4808 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.72  E-value=56  Score=24.27  Aligned_cols=21  Identities=29%  Similarity=0.797  Sum_probs=16.5

Q ss_pred             chhhHHHHHHHHHHHhhhhcc
Q 044065            6 TKVFSFIILAVLLLTIINCNE   26 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~~c~~   26 (81)
                      .+.+|.+++++|++||..|-+
T Consensus         5 ~kl~~~~~alil~~sl~gCgd   25 (152)
T COG4808           5 NKLFSLVVALVLVFSLAGCGD   25 (152)
T ss_pred             HHHHHHHHHHHHHHHhhhcCc
Confidence            467888888889998877743


No 35 
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=25.10  E-value=24  Score=21.14  Aligned_cols=14  Identities=57%  Similarity=0.759  Sum_probs=0.0

Q ss_pred             hhhHHHHHHHHHHH
Q 044065            7 KVFSFIILAVLLLT   20 (81)
Q Consensus         7 ~v~sf~l~~vl~ls   20 (81)
                      |+-..+|+|||+|+
T Consensus         2 KLt~vliVavLllt   15 (75)
T PF02950_consen    2 KLTCVLIVAVLLLT   15 (75)
T ss_dssp             --------------
T ss_pred             CcchHHHHHHHHHH
Confidence            33334455555554


No 36 
>PHA02909 hypothetical protein; Provisional
Probab=25.04  E-value=68  Score=20.96  Aligned_cols=13  Identities=31%  Similarity=0.851  Sum_probs=8.6

Q ss_pred             hhHHHHHHHHHHH
Q 044065            8 VFSFIILAVLLLT   20 (81)
Q Consensus         8 v~sf~l~~vl~ls   20 (81)
                      .+||+|+.++.||
T Consensus        35 mvsfilfviifls   47 (72)
T PHA02909         35 MVSFILFVIIFLS   47 (72)
T ss_pred             HHHHHHHHHHHHH
Confidence            4677777766554


No 37 
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at  least  one  is  present  in  most EGF-like domains; a subset of these bind calcium.
Probab=24.85  E-value=57  Score=15.48  Aligned_cols=16  Identities=25%  Similarity=0.623  Sum_probs=10.4

Q ss_pred             CccceeCCCCcceeec
Q 044065           65 GCICKPVKSEHHCHCM   80 (81)
Q Consensus        65 GG~CK~~~~~h~CHCy   80 (81)
                      ++.|....+...|+|.
T Consensus        11 ~~~C~~~~~~~~C~C~   26 (36)
T cd00053          11 GGTCVNTPGSYRCVCP   26 (36)
T ss_pred             CCEEecCCCCeEeECC
Confidence            4667766666777763


No 38 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=24.40  E-value=80  Score=19.18  Aligned_cols=12  Identities=33%  Similarity=0.357  Sum_probs=6.5

Q ss_pred             hhHHHHHHHHHH
Q 044065            8 VFSFIILAVLLL   19 (81)
Q Consensus         8 v~sf~l~~vl~l   19 (81)
                      ++|++++++|+.
T Consensus         6 iV~i~iv~~lLg   17 (50)
T PF12606_consen    6 IVSIFIVMGLLG   17 (50)
T ss_pred             HHHHHHHHHHHH
Confidence            456666555443


No 39 
>PRK10523 lipoprotein involved with copper homeostasis and adhesion; Provisional
Probab=24.02  E-value=73  Score=24.59  Aligned_cols=22  Identities=27%  Similarity=0.436  Sum_probs=14.6

Q ss_pred             hhhHHHHHHHHHHHhhhhcccC
Q 044065            7 KVFSFIILAVLLLTIINCNEVS   28 (81)
Q Consensus         7 ~v~sf~l~~vl~ls~~~c~~~~   28 (81)
                      |..-++|+++.+|+|+.|.+..
T Consensus         4 k~~~~~~~a~~l~~l~gC~~~~   25 (234)
T PRK10523          4 KAIITALAAAGLFTLMGCNNRA   25 (234)
T ss_pred             HHHHHHHHHHHHHHhhccCCcc
Confidence            4455666777788888875543


No 40 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=23.45  E-value=75  Score=20.36  Aligned_cols=14  Identities=29%  Similarity=0.437  Sum_probs=8.5

Q ss_pred             hhhHHHHHHHHHHH
Q 044065            7 KVFSFIILAVLLLT   20 (81)
Q Consensus         7 ~v~sf~l~~vl~ls   20 (81)
                      +|=|++|+++|+||
T Consensus         3 k~ksifL~l~~~Ls   16 (61)
T PF15284_consen    3 KFKSIFLALVFILS   16 (61)
T ss_pred             HHHHHHHHHHHHHH
Confidence            45566666666554


No 41 
>PF07403 DUF1505:  Protein of unknown function (DUF1505);  InterPro: IPR009981 This family consists of several uncharacterised Caenorhabditis elegans proteins of around 115 resides in length. Members of this family contain 6 highly conserved cysteine residues. The function of this family is unknown.
Probab=23.20  E-value=79  Score=22.29  Aligned_cols=10  Identities=40%  Similarity=0.564  Sum_probs=4.8

Q ss_pred             HHHHHHHHHh
Q 044065           12 IILAVLLLTI   21 (81)
Q Consensus        12 ~l~~vl~ls~   21 (81)
                      +++.||+|||
T Consensus         4 ~~~~vl~lsv   13 (114)
T PF07403_consen    4 FPSTVLLLSV   13 (114)
T ss_pred             hhhhHHHHHH
Confidence            3444555553


No 42 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=23.01  E-value=1e+02  Score=18.22  Aligned_cols=15  Identities=13%  Similarity=0.335  Sum_probs=9.3

Q ss_pred             hhhHHHHHHHHHHHh
Q 044065            7 KVFSFIILAVLLLTI   21 (81)
Q Consensus         7 ~v~sf~l~~vl~ls~   21 (81)
                      ...-|.|+++++|.+
T Consensus        15 ~Wi~F~l~mi~vFi~   29 (38)
T PF09125_consen   15 GWIAFALAMILVFIA   29 (38)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHH
Confidence            455667777776653


No 43 
>PF13124 DUF3963:  Protein of unknown function (DUF3963)
Probab=22.77  E-value=82  Score=18.73  Aligned_cols=15  Identities=33%  Similarity=0.742  Sum_probs=10.4

Q ss_pred             hhhHHHHHHHHHHHh
Q 044065            7 KVFSFIILAVLLLTI   21 (81)
Q Consensus         7 ~v~sf~l~~vl~ls~   21 (81)
                      --|.|+|+.|.+.||
T Consensus        23 it~cfal~vv~lvsl   37 (40)
T PF13124_consen   23 ITFCFALLVVVLVSL   37 (40)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            346788887777665


No 44 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=22.62  E-value=61  Score=18.77  Aligned_cols=13  Identities=31%  Similarity=0.421  Sum_probs=6.9

Q ss_pred             chhhHHHHHHHHH
Q 044065            6 TKVFSFIILAVLL   18 (81)
Q Consensus         6 ~~v~sf~l~~vl~   18 (81)
                      ||.+|+++++.|+
T Consensus         1 Mk~l~~a~~l~lL   13 (36)
T PF08194_consen    1 MKCLSLAFALLLL   13 (36)
T ss_pred             CceeHHHHHHHHH
Confidence            5666664444433


No 45 
>PHA03055 Hypothetical protein; Provisional
Probab=22.19  E-value=1e+02  Score=20.62  Aligned_cols=22  Identities=32%  Similarity=0.477  Sum_probs=16.8

Q ss_pred             CCcccchhhHHHHHHHHHHHhhh
Q 044065            1 MAQSQTKVFSFIILAVLLLTIIN   23 (81)
Q Consensus         1 ma~~~~~v~sf~l~~vl~ls~~~   23 (81)
                      ||.. .+++|++=+.+|++.+++
T Consensus         1 Ma~~-~~~~~~Ig~TlL~llMii   22 (79)
T PHA03055          1 MADA-ITVLTAIGITVLMLLMVI   22 (79)
T ss_pred             CCcc-hhHHHHHHHHHHHHHHHH
Confidence            7888 888888877777776544


No 46 
>PLN03207 stomagen; Provisional
Probab=21.73  E-value=1.1e+02  Score=21.70  Aligned_cols=23  Identities=22%  Similarity=0.174  Sum_probs=14.7

Q ss_pred             chhhHHHHHHHHHHHhhhhcccC
Q 044065            6 TKVFSFIILAVLLLTIINCNEVS   28 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~~c~~~~   28 (81)
                      .-.+-|+||..|+|.--++.++-
T Consensus        11 ~~~~lffLl~~llla~~v~qgsr   33 (113)
T PLN03207         11 RCLTLFFLLFFLLLGAYVIQGSR   33 (113)
T ss_pred             hhHHHHHHHHHHHHHHHHHhccc
Confidence            45566777777777766665543


No 47 
>PF12173 BacteriocIIc_cy:  Bacteriocin class IIc cyclic gassericin A-like;  InterPro: IPR020970  This class of bacteriocins was previously described as class V. The members include gassericin A, acidocin B and butyrovibriocin AR10, all of which are hydrophobic cyclical structures []. The N- and C-termini are covalently linked, and the circular molecule is resistant to several proteases and peptidases []. The immunity protein that protects Lactobacillus gasseri from the toxic effects of its bacteriocin, gassericin A, has been identified. It is found to be a small positively-charged hydrophobic peptide of 53 amino acids containing a putative transmembrane segment [] - a structure unlike that of the more common immunity proteins as found in PF08951 from PFAM. 
Probab=21.04  E-value=93  Score=21.35  Aligned_cols=17  Identities=41%  Similarity=0.665  Sum_probs=12.6

Q ss_pred             chhhHHHHHHHHHHHhh
Q 044065            6 TKVFSFIILAVLLLTII   22 (81)
Q Consensus         6 ~~v~sf~l~~vl~ls~~   22 (81)
                      .++.||+|.++|+..++
T Consensus        12 nki~~~~i~a~LvV~ll   28 (91)
T PF12173_consen   12 NKIESFCIWAVLVVALL   28 (91)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            57889998887776543


No 48 
>smart00272 END Endothelin.
Probab=20.80  E-value=57  Score=17.71  Aligned_cols=9  Identities=22%  Similarity=0.755  Sum_probs=7.6

Q ss_pred             ccchHHHhh
Q 044065           53 GKCWKYCTT   61 (81)
Q Consensus        53 ~kCn~wC~~   61 (81)
                      ..|+.||+-
T Consensus        10 k~C~~FCh~   18 (26)
T smart00272       10 KACAYFCHR   18 (26)
T ss_pred             hHHHHHhcc
Confidence            599999974


No 49 
>PHA03164 hypothetical protein; Provisional
Probab=20.33  E-value=56  Score=22.27  Aligned_cols=19  Identities=32%  Similarity=0.716  Sum_probs=12.0

Q ss_pred             ccchhhHHHHHHHHHHHhh
Q 044065            4 SQTKVFSFIILAVLLLTII   22 (81)
Q Consensus         4 ~~~~v~sf~l~~vl~ls~~   22 (81)
                      ++.|-|+|.+++-|..++|
T Consensus        53 nrRktftFlvLtgLaIamI   71 (88)
T PHA03164         53 NRRKTFTFLVLTGLAIAMI   71 (88)
T ss_pred             hhhheeehHHHHHHHHHHH
Confidence            4677788877765544433


Done!