BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044089
(521 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4IH4|A Chain A, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, Atd14
pdb|4IH4|B Chain B, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, Atd14
pdb|4IH4|C Chain C, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, Atd14
pdb|4IH4|D Chain D, Crystal Structure Of Arabidopsis Dwarf14 Orthologue, Atd14
Length = 267
Score = 29.3 bits (64), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
Query: 344 DLSNLPVTIGLYGFAYAGHSV--FPNIYSSMQEPKKFPFVLMISF 386
DL N+ ++G+ AY GHSV I +S++ P+ F +++I F
Sbjct: 78 DLLNIVDSLGIQNCAYVGHSVSAMIGIIASIRRPELFSKLILIGF 122
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,109,091
Number of Sequences: 62578
Number of extensions: 470652
Number of successful extensions: 816
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 816
Number of HSP's gapped (non-prelim): 1
length of query: 521
length of database: 14,973,337
effective HSP length: 103
effective length of query: 418
effective length of database: 8,527,803
effective search space: 3564621654
effective search space used: 3564621654
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)