Citrus Sinensis ID: 044127

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--

GSYGDVFQALDKKSGEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKEHEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSNLLVSKGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIMFEMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLRELSPSASRESISLISRLCSWNPHMRPTAAEALEHPFFRSCHFVPRS

ccEEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHcccccccEEEEccEEEcccEEEEEEEcccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccccccccccccccccccccccccHHcccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHccHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccccccccccccc

ccEEEEEEEEccccccEEEHHHHHHHHccccHcHHHHHHHHHHHccccccEccEEEEEEcccEEEEEEEcccEEcHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccEEcccccHHHEEEccccEEEccccccccccHHHHHccccccHHHccHHHHccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccHHHHcccccccccccHHHHcccccHHHHHHHHHHHcccccccccHHHHHccccHccccccccc

GSYGDVFQALDKKSGEFVAVKKLKKKIFSLdesrnlkeVKCLRkmnnhpnivKLRNLVKEHEDVFIVFEYMESDLLKLMKERagqnfsedEVRNLCFQVFQGLHymhrqgyfhrdlkpsnllvskgvikigdlgmvkeidsslpctdyvttrwyrapEVLLLSeiygpevdmwAMGAIMFEMLSFrilfpgknsaDQIYKICQvigsptedswplgiqlasnldwkfpqmggvnlrelspsasrESISLISRLcswnphmrptaaealehpffrschfvprs

gsygdvfqaldkksgefvaVKKLkkkifsldesrnlkevkclrkmnnhpnivklrnlvKEHEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSNLLVSKGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIMFEMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLRELSPSASRESISLISRLCSWNPHMRPTAAEAlehpffrschfvprs

**************GEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKEHEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSNLLVSKGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIMFEMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNL***********ISLISRLCSWNPHMRPTAAEALEHPFFRSCHF****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		282	2.2.26 [Sep-21-2011]
Q6Z8C8		459	Cyclin-dependent kinase F	no	no	0.985	0.605	0.575	5e-95
Q84SN3		433	Cyclin-dependent kinase F	no	no	0.989	0.644	0.516	2e-84
Q04859		622	Serine/threonine-protein	yes	no	0.964	0.437	0.483	9e-82
P20793		622	Serine/threonine-protein	yes	no	0.964	0.437	0.48	1e-81
P20794		623	Serine/threonine-protein	yes	no	0.964	0.436	0.476	9e-81
Q9UPZ9		632	Serine/threonine-protein	no	no	0.975	0.435	0.467	1e-76
Q9JKV2		629	Serine/threonine-protein	no	no	0.975	0.437	0.478	2e-76
Q62726		629	Serine/threonine-protein	no	no	0.975	0.437	0.478	2e-76
P43294		443	Serine/threonine-protein	no	no	0.960	0.611	0.490	7e-76
Q55FJ6		507	Probable serine/threonine	yes	no	0.964	0.536	0.447	2e-72

>sp\|Q6Z8C8\|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1	Back alignment and function desciption

 Score =  347 bits (890), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 213/280 (76%), Gaps = 2/280 (0%)

Query: 1   GSYGDVFQALDKKSGEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKE 60
           G++G V++A++K++GE VAVKK+K+K +S +E  +L+EVK LR+MN HPNIVKL+ +++E
Sbjct: 13  GTFGSVWRAINKQNGEVVAVKKMKRKYYSFEECMSLREVKSLRRMN-HPNIVKLKEVIRE 71

Query: 61  HEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSN 120
           ++ ++ + EYME +L +LMK+R  + FSE EVRN CFQ+FQ L YMH++GYFHRDLKP N
Sbjct: 72  NDILYFIMEYMECNLYQLMKDRV-KPFSEAEVRNWCFQIFQALAYMHQRGYFHRDLKPEN 130

Query: 121 LLVSKGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIMF 180
           LLVSK VIK+ D G+ +E+ S  P T+YV+TRWYRAPEVLL S IY   VDMWAMGAIM 
Sbjct: 131 LLVSKDVIKLADFGLAREVTSVPPYTEYVSTRWYRAPEVLLQSSIYDSAVDMWAMGAIMA 190

Query: 181 EMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLRELSP 240
           E+L+   LFPG + AD+I KIC VIGSP E SWP G+ LA  + ++FPQ+ G  L E+  
Sbjct: 191 ELLTLHPLFPGTSEADEILKICNVIGSPDEQSWPQGLSLAETMKFQFPQVSGNQLAEVMT 250

Query: 241 SASRESISLISRLCSWNPHMRPTAAEALEHPFFRSCHFVP 280
           S S E++ LIS LCSW+P  RP AAE L+H FF+ C FVP
Sbjct: 251 SVSSEAVDLISSLCSWDPCKRPKAAEVLQHTFFQGCTFVP 290

Oryza sativa subsp. japonica (taxid: 39947)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 3

>sp\|Q84SN3\|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1	Back alignment and function description

>sp\|Q04859\|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2	Back alignment and function description

>sp\|P20793\|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2	Back alignment and function description

>sp\|P20794\|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2	Back alignment and function description

>sp\|Q9UPZ9\|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1	Back alignment and function description

>sp\|Q9JKV2\|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=2 SV=2	Back alignment and function description

>sp\|Q62726\|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1	Back alignment and function description

>sp\|P43294\|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2	Back alignment and function description

>sp\|Q55FJ6\|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		282
357484657		449	Serine/threonine protein kinase ICK [Med	0.992	0.623	0.617	1e-101
30684655		464	putative serine/threonine protein kinase	0.992	0.603	0.599	1e-100
18422554		499	conserved peptide upstream open reading	0.992	0.561	0.602	1e-100
15450860		499	serine/threonine-protein kinase Mak (mal	0.992	0.561	0.602	1e-100
18415242		461	putative serine/threonine protein kinase	0.992	0.607	0.599	1e-100
334188209		497	conserved peptide upstream open reading	0.992	0.563	0.602	1e-100
297800140		460	hypothetical protein ARALYDRAFT_492943 [	0.992	0.608	0.599	1e-100
359474639		452	PREDICTED: cyclin-dependent kinase F-4-l	0.992	0.619	0.609	2e-99
224074450		453	predicted protein [Populus trichocarpa]	0.992	0.618	0.606	2e-99
255557681		455	mak, putative [Ricinus communis] gi\|2235	0.985	0.610	0.592	3e-99

>gi\|357484657\|ref\|XP_003612616.1\| Serine/threonine protein kinase ICK [Medicago truncatula] gi\|355513951\|gb\|AES95574.1\| Serine/threonine protein kinase ICK [Medicago truncatula]	Back alignment and taxonomy information

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/282 (61%), Positives = 226/282 (80%), Gaps = 2/282 (0%)

Query: 1   GSYGDVFQALDKKSGEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKE 60
           G++G V++A+ K++GE VA+KK+KKK +S +E  NL+EVK LRKMN HPNIVKL+ +++E
Sbjct: 13  GTFGSVWRAISKQTGEVVAIKKMKKKYYSWEECVNLREVKSLRKMN-HPNIVKLKEVIRE 71

Query: 61  HEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSN 120
            + ++ VFEYME +L +LMK+R  + FSE E+RN CFQVFQGL YMH++GYFHRDLKP N
Sbjct: 72  SDILYFVFEYMECNLYQLMKDRE-KLFSEGEIRNWCFQVFQGLAYMHQRGYFHRDLKPEN 130

Query: 121 LLVSKGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIMF 180
           LLV+K VIKI D G+ +EI+S  P T+YV+TRWYRAPEVLL S IY  +VDMWAMGAIM 
Sbjct: 131 LLVTKDVIKIADFGLAREINSQPPYTEYVSTRWYRAPEVLLQSYIYSSKVDMWAMGAIMA 190

Query: 181 EMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLRELSP 240
           E+ S R LFPG + AD+IYKIC VIG+PT DSW  G++LA +++++FPQ+ GVNL  L P
Sbjct: 191 ELFSLRPLFPGASEADEIYKICGVIGNPTTDSWADGLKLARDINYQFPQLAGVNLSALIP 250

Query: 241 SASRESISLISRLCSWNPHMRPTAAEALEHPFFRSCHFVPRS 282
           SAS  +ISLI  LCSW+P  RPTA+EAL+HPFF+SC ++P S
Sbjct: 251 SASDHAISLIQSLCSWDPCKRPTASEALQHPFFQSCFYIPPS 292

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|30684655\|ref\|NP_849407.1\| putative serine/threonine protein kinase [Arabidopsis thaliana] gi\|332658742\|gb\|AEE84142.1\| putative serine/threonine protein kinase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|18422554\|ref\|NP_568646.1\| conserved peptide upstream open reading frame 24 [Arabidopsis thaliana] gi\|24899765\|gb\|AAN65097.1\| serine/threonine-protein kinase Mak (male germ cell-associated kinase)-like protein [Arabidopsis thaliana] gi\|332007866\|gb\|AED95249.1\| conserved peptide upstream open reading frame 24 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|15450860\|gb\|AAK96701.1\| serine/threonine-protein kinase Mak (male germ cell-associated kinase)-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|18415242\|ref\|NP_567574.1\| putative serine/threonine protein kinase [Arabidopsis thaliana] gi\|13430556\|gb\|AAK25900.1\|AF360190_1 putative kinase [Arabidopsis thaliana] gi\|14532760\|gb\|AAK64081.1\| putative kinase [Arabidopsis thaliana] gi\|332658741\|gb\|AEE84141.1\| putative serine/threonine protein kinase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334188209\|ref\|NP_001190473.1\| conserved peptide upstream open reading frame 24 [Arabidopsis thaliana] gi\|332007867\|gb\|AED95250.1\| conserved peptide upstream open reading frame 24 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297800140\|ref\|XP_002867954.1\| hypothetical protein ARALYDRAFT_492943 [Arabidopsis lyrata subsp. lyrata] gi\|297313790\|gb\|EFH44213.1\| hypothetical protein ARALYDRAFT_492943 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|359474639\|ref\|XP_002265359.2\| PREDICTED: cyclin-dependent kinase F-4-like [Vitis vinifera] gi\|296088459\|emb\|CBI37450.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224074450\|ref\|XP_002304373.1\| predicted protein [Populus trichocarpa] gi\|222841805\|gb\|EEE79352.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255557681\|ref\|XP_002519870.1\| mak, putative [Ricinus communis] gi\|223540916\|gb\|EEF42474.1\| mak, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		282
TAIR\|locus:2134746		464	AT4G19110 [Arabidopsis thalian	0.992	0.603	0.599	1.6e-93
TAIR\|locus:2163583		499	AT5G45430 [Arabidopsis thalian	0.992	0.561	0.602	2.7e-93
UNIPROTKB\|F1RV90		624	MAK "Uncharacterized protein"	0.964	0.435	0.48	1.5e-76
MGI\|MGI:96913		622	Mak "male germ cell-associated	0.964	0.437	0.483	1.9e-76
RGD\|3036		622	Mak "male germ cell-associated	0.964	0.437	0.48	2.4e-76
UNIPROTKB\|P20793		622	Mak "Serine/threonine-protein	0.964	0.437	0.48	2.4e-76
UNIPROTKB\|P20794		623	MAK "Serine/threonine-protein	0.964	0.436	0.476	1e-75
UNIPROTKB\|Q8IXN4		457	MAK "MAK protein" [Homo sapien	0.964	0.595	0.476	1e-75
UNIPROTKB\|E1BDG4		623	MAK "Uncharacterized protein"	0.964	0.436	0.476	1.7e-75
UNIPROTKB\|Q2YDJ7		382	MAK "Uncharacterized protein"	0.964	0.712	0.476	1.7e-75

TAIR\|locus:2134746 AT4G19110 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 931 (332.8 bits), Expect = 1.6e-93, P = 1.6e-93
 Identities = 169/282 (59%), Positives = 230/282 (81%)

Query:     1 GSYGDVFQALDKKSGEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKE 60
             G++G V++A++K++GE VA+KK+KKK +S DE  NL+EVK LR+MN HPNIVKL+ +++E
Sbjct:    13 GTFGSVWRAINKQTGEVVAIKKMKKKYYSWDECINLREVKSLRRMN-HPNIVKLKEVIRE 71

Query:    61 HEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSN 120
             ++ ++ VFEYME +L +LMK+R  + F+E +++N CFQVFQGL YMH++GYFHRDLKP N
Sbjct:    72 NDILYFVFEYMECNLYQLMKDRQ-KLFAEADIKNWCFQVFQGLSYMHQRGYFHRDLKPEN 130

Query:   121 LLVSKGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIMF 180
             LLVSK +IKI D G+ +E++SS P T+YV+TRWYRAPEVLL S +Y  +VDMWAMGAIM 
Sbjct:   131 LLVSKDIIKIADFGLAREVNSSPPFTEYVSTRWYRAPEVLLQSYVYTSKVDMWAMGAIMA 190

Query:   181 EMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLRELSP 240
             E+LS R +FPG + AD+IYKIC VIG+PTE++W  G+ LA+ ++++FPQ+ GV L  L P
Sbjct:   191 ELLSLRPIFPGASEADEIYKICSVIGTPTEETWLEGLNLANTINYQFPQLPGVPLSSLMP 250

Query:   241 SASRESISLISRLCSWNPHMRPTAAEALEHPFFRSCHFVPRS 282
             SAS ++I+LI RLCSW+P  RPTAAE L+HPFF+SC +VP S
Sbjct:   251 SASEDAINLIERLCSWDPSSRPTAAEVLQHPFFQSCFYVPPS 292

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0005737 "cytoplasm" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0006487 "protein N-linked glycosylation" evidence=RCA

GO:0045727 "positive regulation of translation" evidence=RCA

TAIR\|locus:2163583 AT5G45430 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RV90 MAK "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:96913 Mak "male germ cell-associated kinase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|3036 Mak "male germ cell-associated kinase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P20793 Mak "Serine/threonine-protein kinase MAK" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P20794 MAK "Serine/threonine-protein kinase MAK" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IXN4 MAK "MAK protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BDG4 MAK "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2YDJ7 MAK "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.7.11.1	LOW CONFIDENCE prediction!
3rd Layer	2.7.11	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	AT4G19110	protein kinase, putative; protein kinase, putative; FUNCTIONS IN- protein serine/threonine kinase activity, protein kinase activity, kinase activity, ATP binding; INVOLVED IN- protein amino acid phosphorylation; LOCATED IN- cellular_component unknown; EXPRESSED IN- sperm cell, male gametophyte, pollen tube; EXPRESSED DURING- L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s- Protein kinase, ATP binding site (InterPro-IPR017441), Protein kinase, core (InterPro-IPR000719), Serine/threonine protein kinase (InterPro-IPR002290), Serine/threonine protein kinase-rel [...] (464 aa)
		(Arabidopsis thaliana)
Predicted Functional Partners:
	AT1G27480	lecithin-cholesterol acyltransferase family protein / LACT family protein; lecithin-cholesterol [...] (432 aa)		•	0.508
	AT3G18160	peroxin-3 family protein; peroxin-3 family protein; FUNCTIONS IN- molecular_function unknown; I [...] (376 aa)	•		0.417
	AT5G06270	unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (122 aa)		•	0.406

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		282
cd07830		283	cd07830, STKc_MAK_like, Catalytic domain of Male g	1e-143
cd07829		282	cd07829, STKc_CDK_like, Catalytic domain of Cyclin	1e-103
cd05118		283	cd05118, STKc_CMGC, Catalytic domain of CMGC famil	1e-102
cd07831		282	cd07831, STKc_MOK, Catalytic domain of the Serine/	1e-92
cd07834		330	cd07834, STKc_MAPK, Catalytic domain of the Serine	3e-92
cd07840		287	cd07840, STKc_CDK9_like, Catalytic domain of Cycli	4e-88
cd07843		293	cd07843, STKc_CDC2L1, Catalytic domain of the Seri	5e-87
smart00220		254	smart00220, S_TKc, Serine/Threonine protein kinase	1e-86
cd07852		337	cd07852, STKc_MAPK15, Catalytic domain of the Seri	2e-84
cd07841		298	cd07841, STKc_CDK7, Catalytic domain of the Serine	5e-81
pfam00069		260	pfam00069, Pkinase, Protein kinase domain	4e-79
cd07832		286	cd07832, STKc_CCRK, Catalytic domain of the Serine	5e-79
cd07838		287	cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc	3e-76
cd07855		334	cd07855, STKc_ERK5, Catalytic domain of the Serine	2e-73
cd07833		288	cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep	3e-73
cd07849		336	cd07849, STKc_ERK1_2_like, Catalytic domain of Ext	3e-71
cd07835		283	cd07835, STKc_CDK1_like, Catalytic domain of Cycli	6e-71
cd07851		343	cd07851, STKc_p38, Catalytic domain of the Serine/	1e-69
cd07845		309	cd07845, STKc_CDK10, Catalytic domain of the Serin	6e-68
cd07837		295	cd07837, STKc_CdkB_plant, Catalytic domain of the	1e-66
cd07860		284	cd07860, STKc_CDK2_3, Catalytic domain of the Seri	3e-66
cd07836		284	cd07836, STKc_Pho85, Catalytic domain of the Serin	9e-66
cd07866		311	cd07866, STKc_BUR1, Catalytic domain of the Serine	1e-65
cd07858		337	cd07858, STKc_TEY_MAPK_plant, Catalytic domain of	2e-64
cd07842		316	cd07842, STKc_CDK8_like, Catalytic domain of Cycli	3e-63
cd07861		285	cd07861, STKc_CDK1_euk, Catalytic domain of the Se	4e-62
PTZ00024		335	PTZ00024, PTZ00024, cyclin-dependent protein kinas	1e-61
cd07879		342	cd07879, STKc_p38delta_MAPK13, Catalytic domain of	2e-61
PLN00009		294	PLN00009, PLN00009, cyclin-dependent kinase A; Pro	1e-60
cd00180		215	cd00180, PKc, Catalytic domain of Protein Kinases	7e-60
cd07864		302	cd07864, STKc_CDK12, Catalytic domain of the Serin	1e-59
cd07844		291	cd07844, STKc_PCTAIRE_like, Catalytic domain of PC	8e-59
cd07880		343	cd07880, STKc_p38gamma_MAPK12, Catalytic domain of	6e-58
cd07839		284	cd07839, STKc_CDK5, Catalytic domain of the Serine	5e-57
cd07859		338	cd07859, STKc_TDY_MAPK_plant, Catalytic domain of	1e-56
cd07857		332	cd07857, STKc_MPK1, Catalytic domain of the Serine	1e-55
cd07847		286	cd07847, STKc_CDKL1_4, Catalytic domain of the Ser	4e-55
cd07863		288	cd07863, STKc_CDK4, Catalytic domain of the Serine	3e-54
cd07872		309	cd07872, STKc_PCTAIRE2, Catalytic domain of the Se	1e-53
cd07877		345	cd07877, STKc_p38alpha_MAPK14, Catalytic domain of	1e-53
cd07871		288	cd07871, STKc_PCTAIRE3, Catalytic domain of the Se	7e-53
cd06606		260	cd06606, STKc_MAPKKK, Catalytic domain of the Prot	2e-52
cd07846		286	cd07846, STKc_CDKL2_3, Catalytic domain of the Ser	3e-52
cd07856		328	cd07856, STKc_Sty1_Hog1, Catalytic domain of the S	3e-52
cd07873		301	cd07873, STKc_PCTAIRE1, Catalytic domain of the Se	1e-51
cd07854		342	cd07854, STKc_MAPK4_6, Catalytic domain of the Ser	4e-51
cd07878		343	cd07878, STKc_p38beta_MAPK11, Catalytic domain of	8e-51
cd07870		291	cd07870, STKc_PFTAIRE2, Catalytic domain of the Se	1e-50
cd07865		310	cd07865, STKc_CDK9, Catalytic domain of the Serine	2e-50
cd07862		290	cd07862, STKc_CDK6, Catalytic domain of the Serine	3e-49
cd08215		258	cd08215, STKc_Nek, Catalytic domain of the Protein	3e-49
cd07853		372	cd07853, STKc_NLK, Catalytic domain of the Serine/	8e-47
COG0515		384	COG0515, SPS1, Serine/threonine protein kinase [Ge	6e-46
cd07869		303	cd07869, STKc_PFTAIRE1, Catalytic domain of the Se	8e-45
cd06627		254	cd06627, STKc_Cdc7_like, Catalytic domain of Cell	1e-44
cd05123		250	cd05123, STKc_AGC, Catalytic domain of AGC family	1e-44
cd07850		353	cd07850, STKc_JNK, Catalytic domain of the Serine/	1e-42
cd05122		253	cd05122, PKc_STE, Catalytic domain of STE family P	1e-42
cd07848		287	cd07848, STKc_CDKL5, Catalytic domain of the Serin	3e-42
PTZ00036		440	PTZ00036, PTZ00036, glycogen synthase kinase; Prov	3e-40
cd07876		359	cd07876, STKc_JNK2, Catalytic domain of the Serine	3e-40
cd07874		355	cd07874, STKc_JNK3, Catalytic domain of the Serine	3e-39
smart00221		258	smart00221, STYKc, Protein kinase; unclassified sp	1e-38
smart00219		257	smart00219, TyrKc, Tyrosine kinase, catalytic doma	2e-37
cd06623		264	cd06623, PKc_MAPKK_plant_like, Catalytic domain of	2e-37
cd07875		364	cd07875, STKc_JNK1, Catalytic domain of the Serine	1e-36
cd05581		280	cd05581, STKc_PDK1, Catalytic domain of the Protei	1e-36
cd08217		265	cd08217, STKc_Nek2, Catalytic domain of the Protei	1e-35
cd06632		258	cd06632, STKc_MEKK1_plant, Catalytic domain of the	1e-34
cd07868		317	cd07868, STKc_CDK8, Catalytic domain of the Serine	1e-34
cd07867		317	cd07867, STKc_CDC2L6, Catalytic domain of Serine/T	3e-34
cd06629		272	cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o	7e-33
cd06626		264	cd06626, STKc_MEKK4, Catalytic domain of the Prote	7e-33
cd05572		262	cd05572, STKc_cGK_PKG, Catalytic domain of the Pro	3e-32
cd05579		265	cd05579, STKc_MAST_like, Catalytic domain of Micro	7e-32
cd08530		256	cd08530, STKc_CNK2-like, Catalytic domain of the P	7e-32
cd08225		257	cd08225, STKc_Nek5, Catalytic domain of the Protei	8e-32
cd00192		262	cd00192, PTKc, Catalytic domain of Protein Tyrosin	1e-31
cd06628		267	cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o	3e-31
pfam07714		258	pfam07714, Pkinase_Tyr, Protein tyrosine kinase	3e-31
cd06614		286	cd06614, STKc_PAK, Catalytic domain of the Protein	7e-31
cd05573		350	cd05573, STKc_ROCK_NDR_like, Catalytic domain of R	9e-31
cd05570		318	cd05570, STKc_PKC, Catalytic domain of the Protein	1e-30
cd06613		262	cd06613, STKc_MAP4K3_like, Catalytic domain of Mit	4e-30
cd05580		290	cd05580, STKc_PKA, Catalytic domain of the Protein	6e-30
cd06612		256	cd06612, STKc_MST1_2, Catalytic domain of the Prot	3e-29
cd08218		256	cd08218, STKc_Nek1, Catalytic domain of the Protei	3e-29
cd06648		285	cd06648, STKc_PAK_II, Catalytic domain of the Prot	4e-29
cd06607		307	cd06607, STKc_TAO, Catalytic domain of the Protein	5e-29
cd06605		265	cd06605, PKc_MAPKK, Catalytic domain of the dual-s	6e-29
cd08221		256	cd08221, STKc_Nek9, Catalytic domain of the Protei	1e-28
cd05611		260	cd05611, STKc_Rim15_like, Catalytic domain of fung	3e-28
cd08529		256	cd08529, STKc_FA2-like, Catalytic domain of the Pr	6e-28
cd06630		268	cd06630, STKc_MEKK1, Catalytic domain of the Prote	1e-27
cd05571		323	cd05571, STKc_PKB, Catalytic domain of the Protein	2e-27
cd05578		258	cd05578, STKc_Yank1, Catalytic domain of the Prote	2e-27
cd08224		267	cd08224, STKc_Nek6_Nek7, Catalytic domain of the P	1e-26
cd05601		330	cd05601, STKc_CRIK, Catalytic domain of the Protei	2e-26
cd08222		260	cd08222, STKc_Nek11, Catalytic domain of the Prote	2e-26
cd08220		256	cd08220, STKc_Nek8, Catalytic domain of the Protei	3e-26
cd05044		269	cd05044, PTKc_c-ros, Catalytic domain of the Prote	3e-26
cd05591		321	cd05591, STKc_nPKC_epsilon, Catalytic domain of th	3e-26
cd08223		257	cd08223, STKc_Nek4, Catalytic domain of the Protei	4e-26
cd05600		333	cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun	5e-26
cd08219		255	cd08219, STKc_Nek3, Catalytic domain of the Protei	1e-25
cd08528		269	cd08528, STKc_Nek10, Catalytic domain of the Prote	5e-25
cd05590		320	cd05590, STKc_nPKC_eta, Catalytic domain of the Pr	1e-24
cd06625		263	cd06625, STKc_MEKK3_like, Catalytic domain of MAP/	4e-24
cd06657		292	cd06657, STKc_PAK4, Catalytic domain of the Protei	5e-24
cd06609		274	cd06609, STKc_MST3_like, Catalytic domain of Mamma	6e-24
cd06617		283	cd06617, PKc_MKK3_6, Catalytic domain of the dual-	1e-23
cd05584		323	cd05584, STKc_p70S6K, Catalytic domain of the Prot	2e-23
cd05588		329	cd05588, STKc_aPKC, Catalytic domain of the Protei	2e-23
PLN00034		353	PLN00034, PLN00034, mitogen-activated protein kina	2e-23
cd05618		329	cd05618, STKc_aPKC_iota, Catalytic domain of the P	3e-23
cd06616		288	cd06616, PKc_MKK4, Catalytic domain of the dual-sp	3e-23
cd05589		324	cd05589, STKc_PKN, Catalytic domain of the Protein	4e-23
cd05575		323	cd05575, STKc_SGK, Catalytic domain of the Protein	4e-23
cd06634		308	cd06634, STKc_TAO2, Catalytic domain of the Protei	8e-23
cd06633		313	cd06633, STKc_TAO3, Catalytic domain of the Protei	1e-22
cd05595		323	cd05595, STKc_PKB_beta, Catalytic domain of the Pr	2e-22
cd06610		267	cd06610, STKc_OSR1_SPAK, Catalytic domain of the P	2e-22
cd05593		328	cd05593, STKc_PKB_gamma, Catalytic domain of the P	3e-22
cd05603		321	cd05603, STKc_SGK2, Catalytic domain of the Protei	3e-22
cd05619		316	cd05619, STKc_nPKC_theta, Catalytic domain of the	3e-22
cd05577		277	cd05577, STKc_GRK, Catalytic domain of the Protein	5e-22
cd06608		275	cd06608, STKc_myosinIII_like, Catalytic domain of	6e-22
cd05594		325	cd05594, STKc_PKB_alpha, Catalytic domain of the P	8e-22
cd06658		292	cd06658, STKc_PAK5, Catalytic domain of the Protei	9e-22
cd05592		316	cd05592, STKc_nPKC_theta_delta, Catalytic domain o	2e-21
cd05587		324	cd05587, STKc_cPKC, Catalytic domain of the Protei	3e-21
cd06624		268	cd06624, STKc_ASK, Catalytic domain of the Protein	5e-21
cd06659		297	cd06659, STKc_PAK6, Catalytic domain of the Protei	5e-21
cd05059		256	cd05059, PTKc_Tec_like, Catalytic domain of Tec-li	6e-21
cd05599		364	cd05599, STKc_NDR_like, Catalytic domain of Nuclea	6e-21
cd05036		277	cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro	9e-21
cd05041		251	cd05041, PTKc_Fes_like, Catalytic domain of Fes-li	9e-21
cd05615		323	cd05615, STKc_cPKC_alpha, Catalytic domain of the	1e-20
cd06635		317	cd06635, STKc_TAO1, Catalytic domain of the Protei	1e-20
cd06644		292	cd06644, STKc_STK10_LOK, Catalytic domain of the P	2e-20
cd05582		318	cd05582, STKc_RSK_N, N-terminal catalytic domain o	2e-20
cd05617		327	cd05617, STKc_aPKC_zeta, Catalytic domain of the P	2e-20
cd05039		256	cd05039, PTKc_Csk_like, Catalytic domain of C-term	4e-20
cd05604		325	cd05604, STKc_SGK3, Catalytic domain of the Protei	4e-20
cd06645		267	cd06645, STKc_MAP4K3, Catalytic domain of the Prot	5e-20
cd05114		256	cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro	5e-20
cd06653		264	cd06653, STKc_MEKK3_like_1, Catalytic domain of MA	5e-20
cd08229		267	cd08229, STKc_Nek7, Catalytic domain of the Protei	6e-20
cd05574		316	cd05574, STKc_phototropin_like, Catalytic domain o	8e-20
cd06611		280	cd06611, STKc_SLK_like, Catalytic domain of Ste20-	8e-20
cd05072		261	cd05072, PTKc_Lyn, Catalytic domain of the Protein	1e-19
cd05034		261	cd05034, PTKc_Src_like, Catalytic domain of Src ki	1e-19
cd05079		284	cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma	1e-19
cd05586		330	cd05586, STKc_Sck1_like, Catalytic domain of Suppr	1e-19
cd05033		266	cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec	1e-19
cd06647		293	cd06647, STKc_PAK_I, Catalytic domain of the Prote	1e-19
cd05612		291	cd05612, STKc_PRKX_like, Catalytic domain of PRKX-	2e-19
cd05605		285	cd05605, STKc_GRK4_like, Catalytic domain of G pro	2e-19
PHA03209		357	PHA03209, PHA03209, serine/threonine kinase US3; P	2e-19
cd05602		325	cd05602, STKc_SGK1, Catalytic domain of the Protei	2e-19
PTZ00263		329	PTZ00263, PTZ00263, protein kinase A catalytic sub	2e-19
cd06655		296	cd06655, STKc_PAK2, Catalytic domain of the Protei	2e-19
cd05068		261	cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re	4e-19
cd05632		285	cd05632, STKc_GRK5, Catalytic domain of the Protei	6e-19
cd06917		277	cd06917, STKc_NAK1_like, Catalytic domain of Funga	8e-19
cd06622		286	cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of	9e-19
cd05616		323	cd05616, STKc_cPKC_beta, Catalytic domain of the P	1e-18
cd05067		260	cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro	1e-18
cd05113		256	cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro	2e-18
cd06656		297	cd06656, STKc_PAK3, Catalytic domain of the Protei	2e-18
cd05073		260	cd05073, PTKc_Hck, Catalytic domain of the Protein	3e-18
cd06618		296	cd06618, PKc_MKK7, Catalytic domain of the dual-sp	3e-18
cd05148		261	cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro	3e-18
cd06654		296	cd06654, STKc_PAK1, Catalytic domain of the Protei	3e-18
cd05050		288	cd05050, PTKc_Musk, Catalytic domain of the Protei	4e-18
cd05049		280	cd05049, PTKc_Trk, Catalytic domain of the Protein	4e-18
cd05576		237	cd05576, STKc_RPK118_like, Catalytic domain of the	5e-18
cd06646		267	cd06646, STKc_MAP4K5, Catalytic domain of the Prot	6e-18
cd05052		263	cd05052, PTKc_Abl, Catalytic domain of the Protein	6e-18
cd06643		282	cd06643, STKc_SLK, Catalytic domain of the Protein	7e-18
cd06638		286	cd06638, STKc_myosinIIIA, Catalytic domain of the	7e-18
PTZ00283		496	PTZ00283, PTZ00283, serine/threonine protein kinas	1e-17
cd05038		284	cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai	1e-17
cd06640		277	cd06640, STKc_MST4, Catalytic domain of the Protei	1e-17
cd05070		260	cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro	1e-17
cd08228		267	cd08228, STKc_Nek6, Catalytic domain of the Protei	2e-17
PTZ00267		478	PTZ00267, PTZ00267, NIMA-related protein kinase; P	2e-17
cd05620		316	cd05620, STKc_nPKC_delta, Catalytic domain of the	3e-17
cd06636		282	cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr	3e-17
cd05607		277	cd05607, STKc_GRK7, Catalytic domain of the Protei	3e-17
cd05112		256	cd05112, PTKc_Itk, Catalytic domain of the Protein	3e-17
cd06637		272	cd06637, STKc_TNIK, Catalytic domain of the Protei	4e-17
cd06651		266	cd06651, STKc_MEKK3, Catalytic domain of the Prote	5e-17
cd05063		268	cd05063, PTKc_EphR_A2, Catalytic domain of the Pro	5e-17
cd05060		257	cd05060, PTKc_Syk_like, Catalytic domain of Spleen	5e-17
cd06650		333	cd06650, PKc_MEK1, Catalytic domain of the dual-sp	7e-17
cd05048		283	cd05048, PTKc_Ror, Catalytic Domain of the Protein	9e-17
PTZ00266		1021	PTZ00266, PTZ00266, NIMA-related protein kinase; P	1e-16
cd06621		287	cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of	1e-16
cd05055		302	cd05055, PTKc_PDGFR, Catalytic domain of the Prote	2e-16
cd05596		370	cd05596, STKc_ROCK, Catalytic domain of the Protei	2e-16
cd05621		370	cd05621, STKc_ROCK2, Catalytic domain of the Prote	2e-16
cd05084		252	cd05084, PTKc_Fes, Catalytic domain of the Protein	3e-16
cd06652		265	cd06652, STKc_MEKK2, Catalytic domain of the Prote	3e-16
PHA03390		267	PHA03390, pk1, serine/threonine-protein kinase 1;	5e-16
cd06615		308	cd06615, PKc_MEK, Catalytic domain of the dual-spe	6e-16
cd06631		265	cd06631, STKc_YSK4, Catalytic domain of the Protei	7e-16
cd05066		267	cd05066, PTKc_EphR_A, Catalytic domain of the Prot	7e-16
cd05069		260	cd05069, PTKc_Yes, Catalytic domain of the Protein	1e-15
cd06641		277	cd06641, STKc_MST3, Catalytic domain of the Protei	1e-15
cd05046		275	cd05046, PTK_CCK4, Pseudokinase domain of the Prot	1e-15
cd06639		291	cd06639, STKc_myosinIIIB, Catalytic domain of the	2e-15
cd05609		305	cd05609, STKc_MAST, Catalytic domain of the Protei	2e-15
cd05080		283	cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma	2e-15
cd05053		293	cd05053, PTKc_FGFR, Catalytic domain of the Protei	2e-15
cd05082		256	cd05082, PTKc_Csk, Catalytic domain of the Protein	3e-15
cd05630		285	cd05630, STKc_GRK6, Catalytic domain of the Protei	3e-15
cd05629		377	cd05629, STKc_NDR_like_fungal, Catalytic domain of	4e-15
cd05085		250	cd05085, PTKc_Fer, Catalytic domain of the Protein	4e-15
TIGR03903		1266	TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas	4e-15
cd05065		269	cd05065, PTKc_EphR_B, Catalytic domain of the Prot	5e-15
cd05614		332	cd05614, STKc_MSK2_N, N-terminal catalytic domain	6e-15
cd05631		285	cd05631, STKc_GRK4, Catalytic domain of the Protei	7e-15
cd05622		371	cd05622, STKc_ROCK1, Catalytic domain of the Prote	7e-15
cd05583		288	cd05583, STKc_MSK_N, N-terminal catalytic domain o	7e-15
cd05585		312	cd05585, STKc_YPK1_like, Catalytic domain of Yeast	8e-15
cd05598		376	cd05598, STKc_LATS, Catalytic domain of the Protei	9e-15
cd06642		277	cd06642, STKc_STK25-YSK1, Catalytic domain of the	1e-14
cd05032		277	cd05032, PTKc_InsR_like, Catalytic domain of Insul	1e-14
cd05071		262	cd05071, PTKc_Src, Catalytic domain of the Protein	2e-14
cd05081		284	cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2)	2e-14
cd05613		290	cd05613, STKc_MSK1_N, N-terminal catalytic domain	2e-14
PHA03212		391	PHA03212, PHA03212, serine/threonine kinase US3; P	3e-14
cd05083		254	cd05083, PTKc_Chk, Catalytic domain of the Protein	3e-14
cd05633		279	cd05633, STKc_GRK3, Catalytic domain of the Protei	4e-14
cd06619		279	cd06619, PKc_MKK5, Catalytic domain of the dual-sp	5e-14
cd05101		304	cd05101, PTKc_FGFR2, Catalytic domain of the Prote	6e-14
cd05597		331	cd05597, STKc_DMPK_like, Catalytic domain of Myoto	8e-14
cd08216		314	cd08216, PK_STRAD, Pseudokinase domain of STE20-re	9e-14
cd05606		278	cd05606, STKc_beta_ARK, Catalytic domain of the Pr	9e-14
cd05624		331	cd05624, STKc_MRCK_beta, Catalytic domain of the P	1e-13
cd05089		297	cd05089, PTKc_Tie1, Catalytic domain of the Protei	1e-13
cd05040		257	cd05040, PTKc_Ack_like, Catalytic domain of the Pr	1e-13
cd05093		288	cd05093, PTKc_TrkB, Catalytic domain of the Protei	1e-13
cd05097		295	cd05097, PTKc_DDR_like, Catalytic domain of Discoi	1e-13
cd05608		280	cd05608, STKc_GRK1, Catalytic domain of the Protei	1e-13
PRK13184		932	PRK13184, pknD, serine/threonine-protein kinase; R	2e-13
cd05051		296	cd05051, PTKc_DDR, Catalytic domain of the Protein	2e-13
cd05623		332	cd05623, STKc_MRCK_alpha, Catalytic domain of the	2e-13
cd05092		280	cd05092, PTKc_TrkA, Catalytic domain of the Protei	2e-13
cd05094		291	cd05094, PTKc_TrkC, Catalytic domain of the Protei	3e-13
cd05090		283	cd05090, PTKc_Ror1, Catalytic domain of the Protei	5e-13
cd06649		331	cd06649, PKc_MEK2, Catalytic domain of the dual-sp	5e-13
PTZ00284		467	PTZ00284, PTZ00284, protein kinase; Provisional	1e-12
cd05088		303	cd05088, PTKc_Tie2, Catalytic domain of the Protei	1e-12
PHA03210		501	PHA03210, PHA03210, serine/threonine kinase US3; P	1e-12
cd05095		296	cd05095, PTKc_DDR2, Catalytic domain of the Protei	2e-12
cd05100		334	cd05100, PTKc_FGFR3, Catalytic domain of the Prote	2e-12
cd05061		288	cd05061, PTKc_InsR, Catalytic domain of the Protei	2e-12
cd05047		270	cd05047, PTKc_Tie, Catalytic domain of Tie Protein	3e-12
cd05098		307	cd05098, PTKc_FGFR1, Catalytic domain of the Prote	3e-12
cd05099		314	cd05099, PTKc_FGFR4, Catalytic domain of the Prote	5e-12
cd06620		284	cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of	6e-12
cd05116		257	cd05116, PTKc_Syk, Catalytic domain of the Protein	9e-12
cd05045		290	cd05045, PTKc_RET, Catalytic domain of the Protein	1e-11
cd05610		669	cd05610, STKc_MASTL, Catalytic domain of the Prote	2e-11
cd05626		381	cd05626, STKc_LATS2, Catalytic domain of the Prote	4e-11
cd05056		270	cd05056, PTKc_FAK, Catalytic domain of the Protein	5e-11
PTZ00426		340	PTZ00426, PTZ00426, cAMP-dependent protein kinase	6e-11
cd05087		269	cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t	1e-10
cd05628		363	cd05628, STKc_NDR1, Catalytic domain of the Protei	1e-10
cd05074		273	cd05074, PTKc_Tyro3, Catalytic domain of the Prote	2e-10
cd05627		360	cd05627, STKc_NDR2, Catalytic domain of the Protei	2e-10
cd05091		283	cd05091, PTKc_Ror2, Catalytic domain of the Protei	2e-10
PHA03211		461	PHA03211, PHA03211, serine/threonine kinase US3; P	3e-10
cd05057		279	cd05057, PTKc_EGFR_like, Catalytic domain of Epide	4e-10
cd05625		382	cd05625, STKc_LATS1, Catalytic domain of the Prote	4e-10
cd05115		257	cd05115, PTKc_Zap-70, Catalytic domain of the Prot	9e-10
cd08226		328	cd08226, PK_STRAD_beta, Pseudokinase domain of STE	1e-09
PHA03207		392	PHA03207, PHA03207, serine/threonine kinase US3; P	1e-09
cd05096		304	cd05096, PTKc_DDR1, Catalytic domain of the Protei	3e-09
cd05062		277	cd05062, PTKc_IGF-1R, Catalytic domain of the Prot	7e-09
cd05104		375	cd05104, PTKc_Kit, Catalytic domain of the Protein	2e-08
cd05064		266	cd05064, PTKc_EphR_A10, Catalytic domain of the Pr	3e-08
cd05035		273	cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li	3e-08
cd05105		400	cd05105, PTKc_PDGFR_alpha, Catalytic domain of the	4e-08
cd05103		343	cd05103, PTKc_VEGFR2, Catalytic domain of the Prot	8e-08
cd05042		269	cd05042, PTKc_Aatyk, Catalytic domain of the Prote	8e-08
smart00750		176	smart00750, KIND, kinase non-catalytic C-lobe doma	2e-07
cd08227		327	cd08227, PK_STRAD_alpha, Pseudokinase domain of ST	3e-07
cd05054		337	cd05054, PTKc_VEGFR, Catalytic domain of the Prote	4e-07
cd05106		374	cd05106, PTKc_CSF-1R, Catalytic domain of the Prot	4e-07
cd05102		338	cd05102, PTKc_VEGFR3, Catalytic domain of the Prot	5e-07
cd05111		279	cd05111, PTK_HER3, Pseudokinase domain of the Prot	7e-07
cd05108		316	cd05108, PTKc_EGFR, Catalytic domain of the Protei	3e-06
cd05086		268	cd05086, PTKc_Aatyk2, Catalytic domain of the Prot	4e-06
cd05043		280	cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece	7e-06
cd05109		279	cd05109, PTKc_HER2, Catalytic domain of the Protei	8e-06
cd05110		303	cd05110, PTKc_HER4, Catalytic domain of the Protei	1e-05
cd05107		401	cd05107, PTKc_PDGFR_beta, Catalytic domain of the	1e-05
PLN03224		507	PLN03224, PLN03224, probable serine/threonine prot	2e-05
cd05075		272	cd05075, PTKc_Axl, Catalytic domain of the Protein	7e-05
COG3642		204	COG3642, COG3642, Mn2+-dependent serine/threonine	1e-04
cd05058		262	cd05058, PTKc_Met_Ron, Catalytic domain of the Pro	1e-04
TIGR01982		437	TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase	3e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-04
COG0661		517	COG0661, AarF, Predicted unusual protein kinase [G	0.002

>gnl\|CDD\|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

 Score =  403 bits (1037), Expect = e-143
 Identities = 145/274 (52%), Positives = 205/274 (74%), Gaps = 1/274 (0%)

Query: 1   GSYGDVFQALDKKSGEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKE 60
           G++G V+ A +K++GE VA+KK+KKK +S +E  NL+EVK LRK+N HPNIVKL+ + +E
Sbjct: 10  GTFGSVYLARNKETGELVAIKKMKKKFYSWEECMNLREVKSLRKLNEHPNIVKLKEVFRE 69

Query: 61  HEDVFIVFEYMESDLLKLMKERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSN 120
           +++++ VFEYME +L +LMK+R G+ FSE  +R++ +Q+ QGL ++H+ G+FHRDLKP N
Sbjct: 70  NDELYFVFEYMEGNLYQLMKDRKGKPFSESVIRSIIYQILQGLAHIHKHGFFHRDLKPEN 129

Query: 121 LLVSK-GVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPEVLLLSEIYGPEVDMWAMGAIM 179
           LLVS   V+KI D G+ +EI S  P TDYV+TRWYRAPE+LL S  Y   VD+WA+G IM
Sbjct: 130 LLVSGPEVVKIADFGLAREIRSRPPYTDYVSTRWYRAPEILLRSTSYSSPVDIWALGCIM 189

Query: 180 FEMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLRELS 239
            E+ + R LFPG +  DQ+YKIC V+G+PT+  WP G +LAS L ++FPQ    +L +L 
Sbjct: 190 AELYTLRPLFPGSSEIDQLYKICSVLGTPTKQDWPEGYKLASKLGFRFPQFAPTSLHQLI 249

Query: 240 PSASRESISLISRLCSWNPHMRPTAAEALEHPFF 273
           P+AS E+I LI  +  W+P  RPTA++AL+HP+F
Sbjct: 250 PNASPEAIDLIKDMLRWDPKKRPTASQALQHPYF 283

Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertility. It functions as a coactivator of the androgen receptor in prostate cells. MRK, also called Intestinal Cell Kinase (ICK), is expressed ubiquitously, with highest expression in the ovary and uterus. A missense mutation in MRK causes endocrine-cerebro-osteodysplasia (ECO), suggesting that this protein plays an important role in the development of many organs. MAK and MRK may be involved in regulating cell cycle and cell fate. Ime2p is a meiosis-specific kinase that is important during meiotic initiation and during the later stages of meiosis. Mde3 functions downstream of the transcription factor Mei-4 which is essential for meiotic prophase I. Length = 283

>gnl\|CDD\|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>gnl\|CDD\|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>gnl\|CDD\|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>gnl\|CDD\|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>gnl\|CDD\|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>gnl\|CDD\|215690 pfam00069, Pkinase, Protein kinase domain	Back alignment and domain information

>gnl\|CDD\|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>gnl\|CDD\|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5	Back alignment and domain information

>gnl\|CDD\|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>gnl\|CDD\|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>gnl\|CDD\|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>gnl\|CDD\|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>gnl\|CDD\|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>gnl\|CDD\|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like	Back alignment and domain information

>gnl\|CDD\|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional	Back alignment and domain information

>gnl\|CDD\|173623 cd00180, PKc, Catalytic domain of Protein Kinases	Back alignment and domain information

>gnl\|CDD\|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>gnl\|CDD\|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>gnl\|CDD\|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>gnl\|CDD\|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1	Back alignment and domain information

>gnl\|CDD\|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>gnl\|CDD\|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>gnl\|CDD\|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>gnl\|CDD\|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>gnl\|CDD\|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>gnl\|CDD\|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1	Back alignment and domain information

>gnl\|CDD\|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>gnl\|CDD\|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6	Back alignment and domain information

>gnl\|CDD\|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase	Back alignment and domain information

>gnl\|CDD\|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>gnl\|CDD\|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>gnl\|CDD\|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>gnl\|CDD\|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase	Back alignment and domain information

>gnl\|CDD\|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase	Back alignment and domain information

>gnl\|CDD\|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase	Back alignment and domain information

>gnl\|CDD\|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>gnl\|CDD\|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>gnl\|CDD\|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2	Back alignment and domain information

>gnl\|CDD\|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>gnl\|CDD\|214568 smart00221, STYKc, Protein kinase; unclassified specificity	Back alignment and domain information

>gnl\|CDD\|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain	Back alignment and domain information

>gnl\|CDD\|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>gnl\|CDD\|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1	Back alignment and domain information

>gnl\|CDD\|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>gnl\|CDD\|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>gnl\|CDD\|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8	Back alignment and domain information

>gnl\|CDD\|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>gnl\|CDD\|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>gnl\|CDD\|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>gnl\|CDD\|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>gnl\|CDD\|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>gnl\|CDD\|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase	Back alignment and domain information

>gnl\|CDD\|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>gnl\|CDD\|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>gnl\|CDD\|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins	Back alignment and domain information

>gnl\|CDD\|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>gnl\|CDD\|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>gnl\|CDD\|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>gnl\|CDD\|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>gnl\|CDD\|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>gnl\|CDD\|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase	Back alignment and domain information

>gnl\|CDD\|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>gnl\|CDD\|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>gnl\|CDD\|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros	Back alignment and domain information

>gnl\|CDD\|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon	Back alignment and domain information

>gnl\|CDD\|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>gnl\|CDD\|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>gnl\|CDD\|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>gnl\|CDD\|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>gnl\|CDD\|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>gnl\|CDD\|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>gnl\|CDD\|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>gnl\|CDD\|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota	Back alignment and domain information

>gnl\|CDD\|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4	Back alignment and domain information

>gnl\|CDD\|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>gnl\|CDD\|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>gnl\|CDD\|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2	Back alignment and domain information

>gnl\|CDD\|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3	Back alignment and domain information

>gnl\|CDD\|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>gnl\|CDD\|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>gnl\|CDD\|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>gnl\|CDD\|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>gnl\|CDD\|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>gnl\|CDD\|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase	Back alignment and domain information

>gnl\|CDD\|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>gnl\|CDD\|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>gnl\|CDD\|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>gnl\|CDD\|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>gnl\|CDD\|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>gnl\|CDD\|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase	Back alignment and domain information

>gnl\|CDD\|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha	Back alignment and domain information

>gnl\|CDD\|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1	Back alignment and domain information

>gnl\|CDD\|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>gnl\|CDD\|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase	Back alignment and domain information

>gnl\|CDD\|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta	Back alignment and domain information

>gnl\|CDD\|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>gnl\|CDD\|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3	Back alignment and domain information

>gnl\|CDD\|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase	Back alignment and domain information

>gnl\|CDD\|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>gnl\|CDD\|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn	Back alignment and domain information

>gnl\|CDD\|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>gnl\|CDD\|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>gnl\|CDD\|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>gnl\|CDD\|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5	Back alignment and domain information

>gnl\|CDD\|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta	Back alignment and domain information

>gnl\|CDD\|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk	Back alignment and domain information

>gnl\|CDD\|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome	Back alignment and domain information

>gnl\|CDD\|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>gnl\|CDD\|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase	Back alignment and domain information

>gnl\|CDD\|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>gnl\|CDD\|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk	Back alignment and domain information

>gnl\|CDD\|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>gnl\|CDD\|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase	Back alignment and domain information

>gnl\|CDD\|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases	Back alignment and domain information

>gnl\|CDD\|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins	Back alignment and domain information

>gnl\|CDD\|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5	Back alignment and domain information

>gnl\|CDD\|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase	Back alignment and domain information

>gnl\|CDD\|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>gnl\|CDD\|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin	Back alignment and domain information

>gnl\|CDD\|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>gnl\|CDD\|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>gnl\|CDD\|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk	Back alignment and domain information

>gnl\|CDD\|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6	Back alignment and domain information

>gnl\|CDD\|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta	Back alignment and domain information

>gnl\|CDD\|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6	Back alignment and domain information

>gnl\|CDD\|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7	Back alignment and domain information

>gnl\|CDD\|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase	Back alignment and domain information

>gnl\|CDD\|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase	Back alignment and domain information

>gnl\|CDD\|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>gnl\|CDD\|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2	Back alignment and domain information

>gnl\|CDD\|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1	Back alignment and domain information

>gnl\|CDD\|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors	Back alignment and domain information

>gnl\|CDD\|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors	Back alignment and domain information

>gnl\|CDD\|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase	Back alignment and domain information

>gnl\|CDD\|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2	Back alignment and domain information

>gnl\|CDD\|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes	Back alignment and domain information

>gnl\|CDD\|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>gnl\|CDD\|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional	Back alignment and domain information

>gnl\|CDD\|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>gnl\|CDD\|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>gnl\|CDD\|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors	Back alignment and domain information

>gnl\|CDD\|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes	Back alignment and domain information

>gnl\|CDD\|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>gnl\|CDD\|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>gnl\|CDD\|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>gnl\|CDD\|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>gnl\|CDD\|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>gnl\|CDD\|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors	Back alignment and domain information

>gnl\|CDD\|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase	Back alignment and domain information

>gnl\|CDD\|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6	Back alignment and domain information

>gnl\|CDD\|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer	Back alignment and domain information

>gnl\|CDD\|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein	Back alignment and domain information

>gnl\|CDD\|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors	Back alignment and domain information

>gnl\|CDD\|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>gnl\|CDD\|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4	Back alignment and domain information

>gnl\|CDD\|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1	Back alignment and domain information

>gnl\|CDD\|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>gnl\|CDD\|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor	Back alignment and domain information

>gnl\|CDD\|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>gnl\|CDD\|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src	Back alignment and domain information

>gnl\|CDD\|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>gnl\|CDD\|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>gnl\|CDD\|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase	Back alignment and domain information

>gnl\|CDD\|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3	Back alignment and domain information

>gnl\|CDD\|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>gnl\|CDD\|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2	Back alignment and domain information

>gnl\|CDD\|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein	Back alignment and domain information

>gnl\|CDD\|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase	Back alignment and domain information

>gnl\|CDD\|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta	Back alignment and domain information

>gnl\|CDD\|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1	Back alignment and domain information

>gnl\|CDD\|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase	Back alignment and domain information

>gnl\|CDD\|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B	Back alignment and domain information

>gnl\|CDD\|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>gnl\|CDD\|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>gnl\|CDD\|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors	Back alignment and domain information

>gnl\|CDD\|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha	Back alignment and domain information

>gnl\|CDD\|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A	Back alignment and domain information

>gnl\|CDD\|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C	Back alignment and domain information

>gnl\|CDD\|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1	Back alignment and domain information

>gnl\|CDD\|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2	Back alignment and domain information

>gnl\|CDD\|140307 PTZ00284, PTZ00284, protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2	Back alignment and domain information

>gnl\|CDD\|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2	Back alignment and domain information

>gnl\|CDD\|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3	Back alignment and domain information

>gnl\|CDD\|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor	Back alignment and domain information

>gnl\|CDD\|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1	Back alignment and domain information

>gnl\|CDD\|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4	Back alignment and domain information

>gnl\|CDD\|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase	Back alignment and domain information

>gnl\|CDD\|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein	Back alignment and domain information

>gnl\|CDD\|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>gnl\|CDD\|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>gnl\|CDD\|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase	Back alignment and domain information

>gnl\|CDD\|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3	Back alignment and domain information

>gnl\|CDD\|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>gnl\|CDD\|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3	Back alignment and domain information

>gnl\|CDD\|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>gnl\|CDD\|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2	Back alignment and domain information

>gnl\|CDD\|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1	Back alignment and domain information

>gnl\|CDD\|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa	Back alignment and domain information

>gnl\|CDD\|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta	Back alignment and domain information

>gnl\|CDD\|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1	Back alignment and domain information

>gnl\|CDD\|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor	Back alignment and domain information

>gnl\|CDD\|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit	Back alignment and domain information

>gnl\|CDD\|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10	Back alignment and domain information

>gnl\|CDD\|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha	Back alignment and domain information

>gnl\|CDD\|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2	Back alignment and domain information

>gnl\|CDD\|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases	Back alignment and domain information

>gnl\|CDD\|214801 smart00750, KIND, kinase non-catalytic C-lobe domain	Back alignment and domain information

>gnl\|CDD\|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha	Back alignment and domain information

>gnl\|CDD\|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors	Back alignment and domain information

>gnl\|CDD\|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor	Back alignment and domain information

>gnl\|CDD\|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3	Back alignment and domain information

>gnl\|CDD\|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3	Back alignment and domain information

>gnl\|CDD\|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor	Back alignment and domain information

>gnl\|CDD\|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2	Back alignment and domain information

>gnl\|CDD\|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)	Back alignment and domain information

>gnl\|CDD\|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2	Back alignment and domain information

>gnl\|CDD\|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4	Back alignment and domain information

>gnl\|CDD\|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta	Back alignment and domain information

>gnl\|CDD\|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl	Back alignment and domain information

>gnl\|CDD\|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron	Back alignment and domain information

>gnl\|CDD\|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		282
KOG0661		538	consensus MAPK related serine/threonine protein ki	100.0
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	100.0
KOG0581		364	consensus Mitogen-activated protein kinase kinase	100.0
KOG0593		396	consensus Predicted protein kinase KKIAMRE [Genera	100.0
KOG0575		592	consensus Polo-like serine/threonine protein kinas	100.0
KOG0659		318	consensus Cdk activating kinase (CAK)/RNA polymera	100.0
KOG0600		560	consensus Cdc2-related protein kinase [Cell cycle	100.0
KOG0663		419	consensus Protein kinase PITSLRE and related kinas	100.0
KOG0598		357	consensus Ribosomal protein S6 kinase and related	100.0
KOG0595		429	consensus Serine/threonine-protein kinase involved	100.0
KOG0592		604	consensus 3-phosphoinositide-dependent protein kin	100.0
KOG0594		323	consensus Protein kinase PCTAIRE and related kinas	100.0
cd07871		288	STKc_PCTAIRE3 Catalytic domain of the Serine/Threo	100.0
KOG0583		370	consensus Serine/threonine protein kinase [Signal	100.0
KOG0658		364	consensus Glycogen synthase kinase-3 [Carbohydrate	100.0
KOG0660		359	consensus Mitogen-activated protein kinase [Signal	100.0
KOG0578		550	consensus p21-activated serine/threonine protein k	100.0
KOG0198		313	consensus MEKK and related serine/threonine protei	100.0
cd07869		303	STKc_PFTAIRE1 Catalytic domain of the Serine/Threo	100.0
KOG0588		786	consensus Serine/threonine protein kinase [Cell cy	100.0
cd07872		309	STKc_PCTAIRE2 Catalytic domain of the Serine/Threo	100.0
KOG0605		550	consensus NDR and related serine/threonine kinases	100.0
KOG0667		586	consensus Dual-specificity tyrosine-phosphorylatio	100.0
KOG0616		355	consensus cAMP-dependent protein kinase catalytic	100.0
KOG0582		516	consensus Ste20-like serine/threonine protein kina	100.0
KOG0033		355	consensus Ca2+/calmodulin-dependent protein kinase	100.0
cd07862		290	STKc_CDK6 Catalytic domain of the Serine/Threonine	100.0
KOG0599		411	consensus Phosphorylase kinase gamma subunit [Carb	100.0
cd07873		301	STKc_PCTAIRE1 Catalytic domain of the Serine/Threo	100.0
cd05571		323	STKc_PKB Catalytic domain of the Protein Serine/Th	100.0
cd07848		287	STKc_CDKL5 Catalytic domain of the Serine/Threonin	100.0
KOG0597		808	consensus Serine-threonine protein kinase FUSED [G	100.0
cd07863		288	STKc_CDK4 Catalytic domain of the Serine/Threonine	100.0
cd05612		291	STKc_PRKX_like Catalytic domain of PRKX-like Prote	100.0
KOG0192		362	consensus Tyrosine kinase specific for activated (	100.0
cd05631		285	STKc_GRK4 Catalytic domain of the Protein Serine/T	100.0
KOG0032		382	consensus Ca2+/calmodulin-dependent protein kinase	100.0
KOG0591		375	consensus NIMA (never in mitosis)-related G2-speci	100.0
PTZ00036		440	glycogen synthase kinase; Provisional	100.0
PTZ00263		329	protein kinase A catalytic subunit; Provisional	100.0
cd05590		320	STKc_nPKC_eta Catalytic domain of the Protein Seri	100.0
cd05585		312	STKc_YPK1_like Catalytic domain of Yeast Protein K	100.0
cd07859		338	STKc_TDY_MAPK_plant Catalytic domain of the Serine	100.0
cd07831		282	STKc_MOK Catalytic domain of the Serine/Threonine	100.0
cd05595		323	STKc_PKB_beta Catalytic domain of the Protein Seri	100.0
cd05593		328	STKc_PKB_gamma Catalytic domain of the Protein Ser	100.0
cd05591		321	STKc_nPKC_epsilon Catalytic domain of the Protein	100.0
KOG0694		694	consensus Serine/threonine protein kinase [Signal	100.0
cd05620		316	STKc_nPKC_delta Catalytic domain of the Protein Se	100.0
cd05570		318	STKc_PKC Catalytic domain of the Protein Serine/Th	100.0
cd07853		372	STKc_NLK Catalytic domain of the Serine/Threonine	100.0
cd07876		359	STKc_JNK2 Catalytic domain of the Serine/Threonine	100.0
cd05592		316	STKc_nPKC_theta_delta Catalytic domain of the Prot	100.0
cd05600		333	STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p-	100.0
PTZ00426		340	cAMP-dependent protein kinase catalytic subunit; P	100.0
cd05588		329	STKc_aPKC Catalytic domain of the Protein Serine/T	100.0
cd05608		280	STKc_GRK1 Catalytic domain of the Protein Serine/T	100.0
KOG0604		400	consensus MAP kinase-activated protein kinase 2 [S	100.0
cd07839		284	STKc_CDK5 Catalytic domain of the Serine/Threonine	100.0
cd05575		323	STKc_SGK Catalytic domain of the Protein Serine/Th	100.0
cd07861		285	STKc_CDK1_euk Catalytic domain of the Serine/Threo	100.0
cd05594		325	STKc_PKB_alpha Catalytic domain of the Protein Ser	100.0
cd07832		286	STKc_CCRK Catalytic domain of the Serine/Threonine	100.0
cd05619		316	STKc_nPKC_theta Catalytic domain of the Protein Se	100.0
cd07830		283	STKc_MAK_like Catalytic domain of Male germ cell-A	100.0
cd05573		350	STKc_ROCK_NDR_like Catalytic domain of ROCK- and N	100.0
cd05587		324	STKc_cPKC Catalytic domain of the Protein Serine/T	100.0
cd05628		363	STKc_NDR1 Catalytic domain of the Protein Serine/T	100.0
cd05618		329	STKc_aPKC_iota Catalytic domain of the Protein Ser	100.0
cd07875		364	STKc_JNK1 Catalytic domain of the Serine/Threonine	100.0
cd07844		291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	100.0
cd05586		330	STKc_Sck1_like Catalytic domain of Suppressor of l	100.0
cd06649		331	PKc_MEK2 Catalytic domain of the dual-specificity	100.0
PLN00009		294	cyclin-dependent kinase A; Provisional	100.0
cd07845		309	STKc_CDK10 Catalytic domain of the Serine/Threonin	100.0
cd05614		332	STKc_MSK2_N N-terminal catalytic domain of the Pro	100.0
KOG0610		459	consensus Putative serine/threonine protein kinase	100.0
cd07878		343	STKc_p38beta_MAPK11 Catalytic domain of the Serine	100.0
cd05607		277	STKc_GRK7 Catalytic domain of the Protein Serine/T	100.0
cd05616		323	STKc_cPKC_beta Catalytic domain of the Protein Ser	100.0
cd05605		285	STKc_GRK4_like Catalytic domain of G protein-coupl	100.0
cd05589		324	STKc_PKN Catalytic domain of the Protein Serine/Th	100.0
cd07860		284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	100.0
KOG4717		864	consensus Serine/threonine protein kinase [Signal	100.0
cd05599		364	STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel	100.0
cd05584		323	STKc_p70S6K Catalytic domain of the Protein Serine	100.0
cd05596		370	STKc_ROCK Catalytic domain of the Protein Serine/T	100.0
KOG0201		467	consensus Serine/threonine protein kinase [Signal	100.0
cd05601		330	STKc_CRIK Catalytic domain of the Protein Serine/T	100.0
cd05626		381	STKc_LATS2 Catalytic domain of the Protein Serine/	100.0
cd07868		317	STKc_CDK8 Catalytic domain of the Serine/Threonine	100.0
cd07874		355	STKc_JNK3 Catalytic domain of the Serine/Threonine	100.0
cd05604		325	STKc_SGK3 Catalytic domain of the Protein Serine/T	100.0
PHA03212		391	serine/threonine kinase US3; Provisional	100.0
cd07843		293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	100.0
cd05617		327	STKc_aPKC_zeta Catalytic domain of the Protein Ser	100.0
KOG0197		468	consensus Tyrosine kinases [Signal transduction me	100.0
PLN00034		353	mitogen-activated protein kinase kinase; Provision	100.0
cd05615		323	STKc_cPKC_alpha Catalytic domain of the Protein Se	100.0
cd05603		321	STKc_SGK2 Catalytic domain of the Protein Serine/T	100.0
cd05602		325	STKc_SGK1 Catalytic domain of the Protein Serine/T	100.0
cd05629		377	STKc_NDR_like_fungal Catalytic domain of Fungal Nu	100.0
cd05625		382	STKc_LATS1 Catalytic domain of the Protein Serine/	100.0
KOG0611		668	consensus Predicted serine/threonine protein kinas	100.0
cd07837		295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	100.0
cd05582		318	STKc_RSK_N N-terminal catalytic domain of the Prot	100.0
KOG0589		426	consensus Serine/threonine protein kinase [General	100.0
cd07836		284	STKc_Pho85 Catalytic domain of the Serine/Threonin	100.0
cd07867		317	STKc_CDC2L6 Catalytic domain of Serine/Threonine K	100.0
cd05598		376	STKc_LATS Catalytic domain of the Protein Serine/T	100.0
KOG0585		576	consensus Ca2+/calmodulin-dependent protein kinase	100.0
cd05621		370	STKc_ROCK2 Catalytic domain of the Protein Serine/	100.0
cd07870		291	STKc_PFTAIRE2 Catalytic domain of the Serine/Threo	100.0
cd07841		298	STKc_CDK7 Catalytic domain of the Serine/Threonine	100.0
KOG0662		292	consensus Cyclin-dependent kinase CDK5 [Intracellu	100.0
cd07835		283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	100.0
PTZ00284		467	protein kinase; Provisional	100.0
cd08227		327	PK_STRAD_alpha Pseudokinase domain of STE20-relate	100.0
cd07847		286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	100.0
cd05118		283	STKc_CMGC Catalytic domain of CMGC family Serine/T	100.0
cd05630		285	STKc_GRK6 Catalytic domain of the Protein Serine/T	100.0
cd05627		360	STKc_NDR2 Catalytic domain of the Protein Serine/T	100.0
KOG0580		281	consensus Serine/threonine protein kinase [Cell cy	100.0
cd05597		331	STKc_DMPK_like Catalytic domain of Myotonic Dystro	100.0
cd06650		333	PKc_MEK1 Catalytic domain of the dual-specificity	100.0
PHA03209		357	serine/threonine kinase US3; Provisional	100.0
cd05622		371	STKc_ROCK1 Catalytic domain of the Protein Serine/	100.0
cd05632		285	STKc_GRK5 Catalytic domain of the Protein Serine/T	100.0
PTZ00024		335	cyclin-dependent protein kinase; Provisional	100.0
cd06611		280	STKc_SLK_like Catalytic domain of Ste20-like kinas	100.0
cd06643		282	STKc_SLK Catalytic domain of the Protein Serine/Th	100.0
KOG0607		463	consensus MAP kinase-interacting kinase and relate	100.0
cd06644		292	STKc_STK10_LOK Catalytic domain of the Protein Ser	100.0
PTZ00267		478	NIMA-related protein kinase; Provisional	100.0
PF00069		260	Pkinase: Protein kinase domain Protein kinase; unc	100.0
cd07850		353	STKc_JNK Catalytic domain of the Serine/Threonine	100.0
cd05633		279	STKc_GRK3 Catalytic domain of the Protein Serine/T	100.0
cd07864		302	STKc_CDK12 Catalytic domain of the Serine/Threonin	100.0
cd07846		286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	100.0
cd07849		336	STKc_ERK1_2_like Catalytic domain of Extracellular	100.0
cd06625		263	STKc_MEKK3_like Catalytic domain of MAP/ERK kinase	100.0
cd06617		283	PKc_MKK3_6 Catalytic domain of the dual-specificit	100.0
cd06616		288	PKc_MKK4 Catalytic domain of the dual-specificity	100.0
cd07829		282	STKc_CDK_like Catalytic domain of Cyclin-Dependent	100.0
cd05611		260	STKc_Rim15_like Catalytic domain of fungal Rim15-l	100.0
cd07865		310	STKc_CDK9 Catalytic domain of the Serine/Threonine	100.0
cd07833		288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	100.0
cd07858		337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	100.0
KOG0666		438	consensus Cyclin C-dependent kinase CDK8 [Transcri	100.0
cd05102		338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	100.0
cd05623		332	STKc_MRCK_alpha Catalytic domain of the Protein Se	100.0
cd07840		287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	100.0
cd06655		296	STKc_PAK2 Catalytic domain of the Protein Serine/T	100.0
cd07834		330	STKc_MAPK Catalytic domain of the Serine/Threonine	100.0
PHA03207		392	serine/threonine kinase US3; Provisional	100.0
cd07866		311	STKc_BUR1 Catalytic domain of the Serine/Threonine	100.0
cd05572		262	STKc_cGK_PKG Catalytic domain of the Protein Serin	100.0
cd06609		274	STKc_MST3_like Catalytic domain of Mammalian Ste20	100.0
cd06917		277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	100.0
PHA03211		461	serine/threonine kinase US3; Provisional	100.0
cd05577		277	STKc_GRK Catalytic domain of the Protein Serine/Th	100.0
cd06612		256	STKc_MST1_2 Catalytic domain of the Protein Serine	100.0
cd05624		331	STKc_MRCK_beta Catalytic domain of the Protein Ser	100.0
cd07838		287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	100.0
cd06622		286	PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS	100.0
cd06637		272	STKc_TNIK Catalytic domain of the Protein Serine/T	100.0
cd05580		290	STKc_PKA Catalytic domain of the Protein Serine/Th	100.0
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	100.0
KOG0983		391	consensus Mitogen-activated protein kinase (MAPK)	100.0
KOG4279		1226	consensus Serine/threonine protein kinase [Signal	100.0
cd05574		316	STKc_phototropin_like Catalytic domain of Phototro	100.0
KOG4236		888	consensus Serine/threonine protein kinase PKC mu/P	100.0
cd06656		297	STKc_PAK3 Catalytic domain of the Protein Serine/T	100.0
cd06619		279	PKc_MKK5 Catalytic domain of the dual-specificity	100.0
cd07854		342	STKc_MAPK4_6 Catalytic domain of the Serine/Threon	100.0
cd06658		292	STKc_PAK5 Catalytic domain of the Protein Serine/T	100.0
cd07855		334	STKc_ERK5 Catalytic domain of the Serine/Threonine	100.0
cd08529		256	STKc_FA2-like Catalytic domain of the Protein Seri	100.0
cd06615		308	PKc_MEK Catalytic domain of the dual-specificity P	100.0
cd06624		268	STKc_ASK Catalytic domain of the Protein Serine/Th	100.0
cd06654		296	STKc_PAK1 Catalytic domain of the Protein Serine/T	100.0
cd06610		267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	100.0
KOG0596		677	consensus Dual specificity; serine/threonine and t	100.0
cd05606		278	STKc_beta_ARK Catalytic domain of the Protein Seri	100.0
cd06636		282	STKc_MAP4K4_6 Catalytic domain of the Protein Seri	100.0
cd07842		316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	100.0
cd06605		265	PKc_MAPKK Catalytic domain of the dual-specificity	100.0
cd06628		267	STKc_MAPKKK_Byr2_like Catalytic domain of fungal B	100.0
PTZ00266		1021	NIMA-related protein kinase; Provisional	100.0
PHA03390		267	pk1 serine/threonine-protein kinase 1; Provisional	100.0
cd05579		265	STKc_MAST_like Catalytic domain of Microtubule-ass	100.0
cd08220		256	STKc_Nek8 Catalytic domain of the Protein Serine/T	100.0
cd08216		314	PK_STRAD Pseudokinase domain of STE20-related kina	100.0
cd06645		267	STKc_MAP4K3 Catalytic domain of the Protein Serine	100.0
cd05578		258	STKc_Yank1 Catalytic domain of the Protein Serine/	100.0
cd06642		277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	100.0
PTZ00283		496	serine/threonine protein kinase; Provisional	100.0
cd06640		277	STKc_MST4 Catalytic domain of the Protein Serine/T	100.0
cd06639		291	STKc_myosinIIIB Catalytic domain of the Protein Se	100.0
cd06659		297	STKc_PAK6 Catalytic domain of the Protein Serine/T	100.0
cd06613		262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	100.0
cd06608		275	STKc_myosinIII_like Catalytic domain of Class III	100.0
PHA02988		283	hypothetical protein; Provisional	100.0
cd08223		257	STKc_Nek4 Catalytic domain of the Protein Serine/T	100.0
cd05084		252	PTKc_Fes Catalytic domain of the Protein Tyrosine	100.0
cd05064		266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	100.0
cd06631		265	STKc_YSK4 Catalytic domain of the Protein Serine/T	100.0
cd06646		267	STKc_MAP4K5 Catalytic domain of the Protein Serine	100.0
KOG0986		591	consensus G protein-coupled receptor kinase [Signa	100.0
KOG1989		738	consensus ARK protein kinase family [Signal transd	100.0
cd06630		268	STKc_MEKK1 Catalytic domain of the Protein Serine/	100.0
cd08226		328	PK_STRAD_beta Pseudokinase domain of STE20-related	100.0
cd05104		375	PTKc_Kit Catalytic domain of the Protein Tyrosine	100.0
cd06651		266	STKc_MEKK3 Catalytic domain of the Protein Serine/	100.0
cd07852		337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	100.0
cd07857		332	STKc_MPK1 Catalytic domain of the Serine/Threonine	100.0
cd06638		286	STKc_myosinIIIA Catalytic domain of the Protein Se	100.0
cd05106		374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	100.0
cd05609		305	STKc_MAST Catalytic domain of the Protein Serine/T	100.0
cd07879		342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	100.0
cd08221		256	STKc_Nek9 Catalytic domain of the Protein Serine/T	100.0
cd06632		258	STKc_MEKK1_plant Catalytic domain of the Protein S	100.0
cd07851		343	STKc_p38 Catalytic domain of the Serine/Threonine	100.0
cd06623		264	PKc_MAPKK_plant_like Catalytic domain of Plant dua	100.0
cd06648		285	STKc_PAK_II Catalytic domain of the Protein Serine	100.0
cd08218		256	STKc_Nek1 Catalytic domain of the Protein Serine/T	100.0
cd06618		296	PKc_MKK7 Catalytic domain of the dual-specificity	100.0
KOG0671		415	consensus LAMMER dual specificity kinases [Signal	100.0
cd06629		272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	100.0
cd06641		277	STKc_MST3 Catalytic domain of the Protein Serine/T	100.0
cd05096		304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	100.0
cd08217		265	STKc_Nek2 Catalytic domain of the Protein Serine/T	100.0
cd07856		328	STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre	100.0
cd08219		255	STKc_Nek3 Catalytic domain of the Protein Serine/T	100.0
KOG2345		302	consensus Serine/threonine protein kinase/TGF-beta	100.0
cd07877		345	STKc_p38alpha_MAPK14 Catalytic domain of the Serin	100.0
cd06657		292	STKc_PAK4 Catalytic domain of the Protein Serine/T	100.0
cd06652		265	STKc_MEKK2 Catalytic domain of the Protein Serine/	100.0
cd06607		307	STKc_TAO Catalytic domain of the Protein Serine/Th	100.0
KOG0574		502	consensus STE20-like serine/threonine kinase MST [	100.0
cd07880		343	STKc_p38gamma_MAPK12 Catalytic domain of the Serin	100.0
cd06633		313	STKc_TAO3 Catalytic domain of the Protein Serine/T	100.0
cd06621		287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	100.0
cd06647		293	STKc_PAK_I Catalytic domain of the Protein Serine/	100.0
cd05122		253	PKc_STE Catalytic domain of STE family Protein Kin	100.0
cd06614		286	STKc_PAK Catalytic domain of the Protein Serine/Th	100.0
PF07714		259	Pkinase_Tyr: Protein tyrosine kinase Protein kinas	100.0
KOG0577		948	consensus Serine/threonine protein kinase [Signal	100.0
cd05048		283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	100.0
cd06620		284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	100.0
cd05088		303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	100.0
cd06626		264	STKc_MEKK4 Catalytic domain of the Protein Serine/	100.0
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	100.0
cd08225		257	STKc_Nek5 Catalytic domain of the Protein Serine/T	100.0
cd05061		288	PTKc_InsR Catalytic domain of the Protein Tyrosine	100.0
cd08215		258	STKc_Nek Catalytic domain of the Protein Serine/Th	100.0
cd05089		297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	100.0
cd00192		262	PTKc Catalytic domain of Protein Tyrosine Kinases.	100.0
cd06606		260	STKc_MAPKKK Catalytic domain of the Protein Serine	100.0
cd05036		277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	100.0
cd05033		266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	100.0
KOG0586		596	consensus Serine/threonine protein kinase [General	100.0
cd05576		237	STKc_RPK118_like Catalytic domain of the Protein S	100.0
cd05123		250	STKc_AGC Catalytic domain of AGC family Protein Se	100.0
cd05054		337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	100.0
KOG0193		678	consensus Serine/threonine protein kinase RAF [Sig	100.0
cd05049		280	PTKc_Trk Catalytic domain of the Protein Tyrosine	100.0
cd06635		317	STKc_TAO1 Catalytic domain of the Protein Serine/T	100.0
KOG1006		361	consensus Mitogen-activated protein kinase (MAPK)	100.0
cd05047		270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	100.0
cd05052		263	PTKc_Abl Catalytic domain of the Protein Tyrosine	100.0
cd06634		308	STKc_TAO2 Catalytic domain of the Protein Serine/T	100.0
cd05581		280	STKc_PDK1 Catalytic domain of the Protein Serine/T	100.0
cd05115		257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	100.0
cd05114		256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	100.0
PHA03210		501	serine/threonine kinase US3; Provisional	100.0
KOG1026		774	consensus Nerve growth factor receptor TRKA and re	100.0
cd05113		256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	100.0
cd05053		293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	100.0
KOG0669		376	consensus Cyclin T-dependent kinase CDK9 [Cell cyc	100.0
KOG0584		632	consensus Serine/threonine protein kinase [General	100.0
cd05105		400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	100.0
cd05055		302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	100.0
cd05108		316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	100.0
cd05062		277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	100.0
cd05059		256	PTKc_Tec_like Catalytic domain of Tec-like Protein	100.0
cd08222		260	STKc_Nek11 Catalytic domain of the Protein Serine/	100.0
cd05085		250	PTKc_Fer Catalytic domain of the Protein Tyrosine	100.0
KOG0690		516	consensus Serine/threonine protein kinase [Signal	100.0
cd05077		262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	100.0
cd05090		283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	100.0
cd05091		283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	100.0
cd05041		251	PTKc_Fes_like Catalytic domain of Fes-like Protein	100.0
cd05060		257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	100.0
cd08530		256	STKc_CNK2-like Catalytic domain of the Protein Ser	100.0
cd06627		254	STKc_Cdc7_like Catalytic domain of Cell division c	100.0
KOG4721		904	consensus Serine/threonine protein kinase, contain	100.0
cd05093		288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	100.0
cd05078		258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	100.0
cd05613		290	STKc_MSK1_N N-terminal catalytic domain of the Pro	100.0
cd08228		267	STKc_Nek6 Catalytic domain of the Protein Serine/T	100.0
cd05065		269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	100.0
cd05063		268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	100.0
cd05066		267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	100.0
cd05109		279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	100.0
cd05076		274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	100.0
cd05032		277	PTKc_InsR_like Catalytic domain of Insulin Recepto	100.0
cd05148		261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	100.0
cd05101		304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	100.0
cd05099		314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	100.0
cd05098		307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	100.0
smart00219		258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	100.0
cd06653		264	STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina	100.0
cd05116		257	PTKc_Syk Catalytic domain of the Protein Tyrosine	100.0
KOG4250		732	consensus TANK binding protein kinase TBK1 [Signal	100.0
cd05107		401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	100.0
cd05045		290	PTKc_RET Catalytic domain of the Protein Tyrosine	100.0
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	100.0
cd05040		257	PTKc_Ack_like Catalytic domain of the Protein Tyro	100.0
cd05051		296	PTKc_DDR Catalytic domain of the Protein Tyrosine	100.0
cd05583		288	STKc_MSK_N N-terminal catalytic domain of the Prot	100.0
cd05111		279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	100.0
cd05097		295	PTKc_DDR_like Catalytic domain of Discoidin Domain	100.0
cd05103		343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	100.0
cd05072		261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	100.0
cd05094		291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	100.0
cd05042		269	PTKc_Aatyk Catalytic domain of the Protein Tyrosin	100.0
cd05058		262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	100.0
cd05087		269	PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein	100.0
cd05092		280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	100.0
KOG1095		1025	consensus Protein tyrosine kinase [Signal transduc	100.0
cd05068		261	PTKc_Frk_like Catalytic domain of Fyn-related kina	100.0
KOG1187		361	consensus Serine/threonine protein kinase [Signal	100.0
KOG1035		1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	100.0
cd05039		256	PTKc_Csk_like Catalytic domain of C-terminal Src k	100.0
cd05100		334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	100.0
cd08229		267	STKc_Nek7 Catalytic domain of the Protein Serine/T	100.0
cd05050		288	PTKc_Musk Catalytic domain of the Protein Tyrosine	100.0
cd05057		279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	100.0
cd05044		269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	100.0
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	100.0
cd05037		259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	100.0
cd05075		272	PTKc_Axl Catalytic domain of the Protein Tyrosine	100.0
cd05071		262	PTKc_Src Catalytic domain of the Protein Tyrosine	100.0
KOG0194		474	consensus Protein tyrosine kinase [Signal transduc	100.0
cd05095		296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	100.0
cd05035		273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	100.0
cd05079		284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	100.0
cd05080		283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	100.0
cd08528		269	STKc_Nek10 Catalytic domain of the Protein Serine/	100.0
cd05056		270	PTKc_FAK Catalytic domain of the Protein Tyrosine	100.0
cd05112		256	PTKc_Itk Catalytic domain of the Protein Tyrosine	100.0
cd08224		267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	100.0
cd05082		256	PTKc_Csk Catalytic domain of the Protein Tyrosine	100.0
KOG4645		1509	consensus MAPKKK (MAP kinase kinase kinase) SSK2 a	100.0
KOG1290		590	consensus Serine/threonine protein kinase [Signal	100.0
cd05070		260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	100.0
cd05034		261	PTKc_Src_like Catalytic domain of Src kinase-like	100.0
cd05069		260	PTKc_Yes Catalytic domain of the Protein Tyrosine	100.0
KOG0614		732	consensus cGMP-dependent protein kinase [Signal tr	100.0
cd05067		260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	100.0
cd05043		280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	100.0
cd05046		275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	100.0
cd05110		303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	100.0
KOG0668		338	consensus Casein kinase II, alpha subunit [Signal	100.0
smart00220		244	S_TKc Serine/Threonine protein kinases, catalytic	100.0
cd05086		268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	100.0
cd05081		284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	100.0
cd05083		254	PTKc_Chk Catalytic domain of the Protein Tyrosine	100.0
cd05073		260	PTKc_Hck Catalytic domain of the Protein Tyrosine	100.0
KOG0696		683	consensus Serine/threonine protein kinase [Signal	100.0
cd05610		669	STKc_MASTL Catalytic domain of the Protein Serine/	100.0
cd05038		284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	100.0
KOG0665		369	consensus Jun-N-terminal kinase (JNK) [Signal tran	100.0
KOG0664		449	consensus Nemo-like MAPK-related serine/threonine	100.0
KOG0587		953	consensus Traf2- and Nck-interacting kinase and re	100.0
KOG0670		752	consensus U4/U6-associated splicing factor PRP4 [R	100.0
KOG0196		996	consensus Tyrosine kinase, EPH (ephrin) receptor f	100.0
cd05074		273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	100.0
KOG4257		974	consensus Focal adhesion tyrosine kinase FAK, cont	100.0
KOG0608		1034	consensus Warts/lats-like serine threonine kinases	100.0
KOG0199		1039	consensus ACK and related non-receptor tyrosine ki	100.0
PHA02882		294	putative serine/threonine kinase; Provisional	100.0
KOG1151		775	consensus Tousled-like protein kinase [Signal tran	100.0
KOG1094		807	consensus Discoidin domain receptor DDR1 [Signal t	100.0
PLN03225		566	Serine/threonine-protein kinase SNT7; Provisional	100.0
KOG4278		1157	consensus Protein tyrosine kinase [Signal transduc	100.0
KOG0695		593	consensus Serine/threonine protein kinase [Signal	100.0
KOG0984		282	consensus Mitogen-activated protein kinase (MAPK)	100.0
KOG1027		903	consensus Serine/threonine protein kinase and endo	100.0
KOG1167		418	consensus Serine/threonine protein kinase of the C	100.0
PLN03224		507	probable serine/threonine protein kinase; Provisio	100.0
KOG0200		609	consensus Fibroblast/platelet-derived growth facto	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG1025		1177	consensus Epidermal growth factor receptor EGFR an	100.0
cd00180		215	PKc Catalytic domain of Protein Kinases. Protein K	100.0
KOG0576		829	consensus Mitogen-activated protein kinase kinase	100.0
KOG1024		563	consensus Receptor-like protein tyrosine kinase RY	100.0
KOG1345		378	consensus Serine/threonine kinase [Signal transduc	100.0
KOG1152		772	consensus Signal transduction serine/threonine kin	100.0
KOG3653		534	consensus Transforming growth factor beta/activin	100.0
PLN00181		793	protein SPA1-RELATED; Provisional	99.98
smart00221		225	STYKc Protein kinase; unclassified specificity. Ph	99.97
KOG2052		513	consensus Activin A type IB receptor, serine/threo	99.97
smart00750		176	KIND kinase non-catalytic C-lobe domain. It is an	99.97
KOG0590		601	consensus Checkpoint kinase and related serine/thr	99.96
KOG1164		322	consensus Casein kinase (serine/threonine/tyrosine	99.95
KOG1163		341	consensus Casein kinase (serine/threonine/tyrosine	99.93
COG0515		384	SPS1 Serine/threonine protein kinase [General func	99.93
PF14531		288	Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_	99.93
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	99.93
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.92
KOG1165		449	consensus Casein kinase (serine/threonine/tyrosine	99.92
KOG4158		598	consensus BRPK/PTEN-induced protein kinase [Signal	99.91
cd05147		190	RIO1_euk RIO kinase family; eukaryotic RIO1, catal	99.91
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	99.91
PRK09188		365	serine/threonine protein kinase; Provisional	99.9
KOG0606		1205	consensus Microtubule-associated serine/threonine	99.89
cd05145		190	RIO1_like RIO kinase family; RIO1, RIO3 and simila	99.88
PRK12274		218	serine/threonine protein kinase; Provisional	99.88
PRK10359		232	lipopolysaccharide core biosynthesis protein; Prov	99.88
KOG1023		484	consensus Natriuretic peptide receptor, guanylate	99.84
KOG1033		516	consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati	99.83
PRK10345		210	hypothetical protein; Provisional	99.82
smart00090		237	RIO RIO-like kinase.	99.82
KOG1166		974	consensus Mitotic checkpoint serine/threonine prot	99.81
PRK14879		211	serine/threonine protein kinase; Provisional	99.79
TIGR03724		199	arch_bud32 Kae1-associated kinase Bud32. Members o	99.77
KOG0601		524	consensus Cyclin-dependent kinase WEE1 [Cell cycle	99.75
KOG0590		601	consensus Checkpoint kinase and related serine/thr	99.74
PRK09605		535	bifunctional UGMP family protein/serine/threonine	99.73
cd05144		198	RIO2_C RIO kinase family; RIO2, C-terminal catalyt	99.73
cd05119		187	RIO RIO kinase family, catalytic domain. The RIO k	99.73
PRK01723		239	3-deoxy-D-manno-octulosonic-acid kinase; Reviewed	99.67
cd05120		155	APH_ChoK_like Aminoglycoside 3'-phosphotransferase	99.66
KOG1243		690	consensus Protein kinase [General function predict	99.6
KOG1266		458	consensus Protein kinase [Signal transduction mech	99.56
cd05146		197	RIO3_euk RIO kinase family; eukaryotic RIO3, catal	99.56
cd05151		170	ChoK Choline Kinase (ChoK). The ChoK subfamily is	99.53
KOG0601		524	consensus Cyclin-dependent kinase WEE1 [Cell cycle	99.52
TIGR01982		437	UbiB 2-polyprenylphenol 6-hydroxylase. This model	99.5
KOG0606		1205	consensus Microtubule-associated serine/threonine	99.47
COG3642		204	Mn2+-dependent serine/threonine protein kinase [Si	99.45
PRK04750		537	ubiB putative ubiquinone biosynthesis protein UbiB	99.42
KOG3741		655	consensus Poly(A) ribonuclease subunit [RNA proces	99.41
KOG2137		700	consensus Protein kinase [Signal transduction mech	99.33
PF01163		188	RIO1: RIO1 family; InterPro: IPR018934 Protein pho	99.32
KOG3087		229	consensus Serine/threonine protein kinase [General	99.3
COG4248		637	Uncharacterized protein with protein kinase and he	99.27
PRK15123		268	lipopolysaccharide core heptose(I) kinase RfaP; Pr	99.24
cd05154		223	ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an	99.21
PF06293		206	Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family;	99.04
PRK09902		216	hypothetical protein; Provisional	98.94
COG1718		268	RIO1 Serine/threonine protein kinase involved in c	98.93
COG0478		304	RIO-like serine/threonine protein kinase fused to	98.82
KOG0576		829	consensus Mitogen-activated protein kinase kinase	98.81
PF06176		229	WaaY: Lipopolysaccharide core biosynthesis protein	98.8
KOG1035		1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	98.79
COG0661		517	AarF Predicted unusual protein kinase [General fun	98.67
TIGR02172		226	Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou	98.6
cd05150		244	APH Aminoglycoside 3'-phosphotransferase (APH). Th	98.58
PF01636		239	APH: Phosphotransferase enzyme family This family	98.55
PLN02876		822	acyl-CoA dehydrogenase	98.38
COG2112		201	Predicted Ser/Thr protein kinase [Signal transduct	98.3
KOG1235		538	consensus Predicted unusual protein kinase [Genera	98.2
TIGR02721		256	ycfN_thiK thiamine kinase. Members of this family	98.16
cd05155		235	APH_ChoK_like_1 Uncharacterized bacterial proteins	98.16
cd05157		235	ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes.	98.13
PRK09550		401	mtnK methylthioribose kinase; Reviewed	97.94
cd05153		296	HomoserineK_II Homoserine Kinase, type II. Homoser	97.88
KOG1093		725	consensus Predicted protein kinase (contains TBC a	97.87
KOG2270		520	consensus Serine/threonine protein kinase involved	97.82
cd05156		302	ChoK_euk Choline Kinase (ChoK) in eukaryotes. The	97.73
PRK05231		319	homoserine kinase; Provisional	97.71
PF10707		199	YrbL-PhoP_reg: PhoP regulatory network protein Yrb	97.66
PF12260		188	PIP49_C: Protein-kinase domain of FAM69; InterPro:	97.66
TIGR00938		307	thrB_alt homoserine kinase, Neisseria type. Homose	97.61
PF13095		207	FTA2: Kinetochore Sim4 complex subunit FTA2	97.59
PLN02236		344	choline kinase	97.55
COG3173		321	Predicted aminoglycoside phosphotransferase [Gener	97.47
PTZ00384		383	choline kinase; Provisional	97.44
PLN02421		330	phosphotransferase, alcohol group as acceptor/kina	97.42
PF01633		211	Choline_kinase: Choline/ethanolamine kinase; Inter	97.29
cd05152		276	MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH	97.27
TIGR01767		370	MTRK 5-methylthioribose kinase. This enzyme is inv	97.17
PLN02756		418	S-methyl-5-thioribose kinase	96.91
TIGR02904		309	spore_ysxE spore coat protein YsxE. Members of thi	96.83
PTZ00296		442	choline kinase; Provisional	96.82
COG5072		488	ALK1 Serine/threonine kinase of the haspin family	96.79
PRK10593		297	hypothetical protein; Provisional	96.77
COG2334		331	Putative homoserine kinase type II (protein kinase	96.66
PRK12396		409	5-methylribose kinase; Reviewed	96.54
PRK06148		1013	hypothetical protein; Provisional	96.48
COG0510		269	ycfN Thiamine kinase and related kinases [Coenzyme	96.44
PRK11768		325	serine/threonine protein kinase; Provisional	96.41
PF07387		308	Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099	96.21
PF03881		288	Fructosamin_kin: Fructosamine kinase; InterPro: IP	96.2
TIGR02906		313	spore_CotS spore coat protein, CotS family. Member	96.06
KOG1826		2724	consensus Ras GTPase activating protein RasGAP/neu	96.05
KOG2268		465	consensus Serine/threonine protein kinase [Signal	95.81

>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=4.3e-62  Score=390.15  Aligned_cols=277  Identities=52%  Similarity=0.991  Sum_probs=265.9

Q ss_pred             CCcceEEEEEecCCCcEEEEEEccccccchHHHHHHHHHHHHHHhCCCCCeeeeccccccCC-cEEEEEecCCccHHHHH
Q 044127            1 GSYGDVFQALDKKSGEFVAVKKLKKKIFSLDESRNLKEVKCLRKMNNHPNIVKLRNLVKEHE-DVFIVFEYMESDLLKLM   79 (282)
Q Consensus         1 G~~g~Vy~~~~~~~~~~v~vK~~~~~~~~~~~~~~~~e~~~l~~~~~hp~i~~~~~~~~~~~-~~~lv~e~~~~~~l~~~   79 (282)
                      |.||.||+|+.+++|+.||||..++....-++...++|++.++++..||||+++.+++.+++ .+|+|||+|+..+++.+
T Consensus        21 GTfGsV~la~~~~~~~~VAIK~MK~Kf~s~ee~~nLREvksL~kln~hpniikL~Evi~d~~~~L~fVfE~Md~NLYqLm  100 (538)
T KOG0661|consen   21 GTFGSVYLAKSKETGELVAIKKMKKKFYSWEECMNLREVKSLRKLNPHPNIIKLKEVIRDNDRILYFVFEFMDCNLYQLM  100 (538)
T ss_pred             CcceeEEEeeecCCCceeeHHHHHhhhccHHHHHHHHHHHHHHhcCCCCcchhhHHHhhccCceEeeeHHhhhhhHHHHH
Confidence            89999999999999999999999998888888888999999999977999999999998887 99999999999999988


Q ss_pred             HHhcCCCCCHHHHHHHHHHHHHHHHHHHHcCccccCCCCCceeee-CCcEEEeecCcccccCCCCCCCCccccccccCch
Q 044127           80 KERAGQNFSEDEVRNLCFQVFQGLHYMHRQGYFHRDLKPSNLLVS-KGVIKIGDLGMVKEIDSSLPCTDYVTTRWYRAPE  158 (282)
Q Consensus        80 ~~~~~~~l~~~~~~~i~~qi~~~l~~Lh~~~~~H~dl~p~nili~-~~~~~l~df~~~~~~~~~~~~~~~~~~~~~~aPE  158 (282)
                      ..+ ++.|++..++.|+.||++||+|+|.+|+.|||+||+|||+. ...+||+|||+|+.+....+.+.++.|..|+|||
T Consensus       101 K~R-~r~fse~~irnim~QilqGL~hiHk~GfFHRDlKPENiLi~~~~~iKiaDFGLARev~SkpPYTeYVSTRWYRAPE  179 (538)
T KOG0661|consen  101 KDR-NRLFSESDIRNIMYQILQGLAHIHKHGFFHRDLKPENILISGNDVIKIADFGLAREVRSKPPYTEYVSTRWYRAPE  179 (538)
T ss_pred             hhc-CCcCCHHHHHHHHHHHHHHHHHHHhcCcccccCChhheEecccceeEecccccccccccCCCcchhhhcccccchH
Confidence            887 67899999999999999999999999999999999999999 7899999999999999998999999999999999


Q ss_pred             hhhccccCCCcchhHHHHHHHHHHHhCCCCCCCCCChHHHHHHHHHhCCCCCCCccccccccccCCccccCCCCCccccc
Q 044127          159 VLLLSEIYGPEVDMWAMGAIMFEMLSFRILFPGKNSADQIYKICQVIGSPTEDSWPLGIQLASNLDWKFPQMGGVNLREL  238 (282)
Q Consensus       159 ~~~~~~~~~~~~DiwslG~ll~~l~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (282)
                      ++.....|+.+.|+|++||+++|+.+-+..|.+.+..|++.++++.+|.|....|+.+..+....+..+++.....+..+
T Consensus       180 vLLrs~~Ys~pvD~wA~GcI~aEl~sLrPLFPG~sE~Dqi~KIc~VLGtP~~~~~~eg~~La~~mnf~~P~~~~~~l~~L  259 (538)
T KOG0661|consen  180 VLLRSGYYSSPVDMWAVGCIMAELYSLRPLFPGASEIDQIYKICEVLGTPDKDSWPEGYNLASAMNFRFPQVKPSPLKDL  259 (538)
T ss_pred             HhhhccccCCchHHHHHHHHHHHHHHhcccCCCCcHHHHHHHHHHHhCCCccccchhHHHHHHHhccCCCcCCCCChHHh
Confidence            99988889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCChhhHHHHHHHhCCCCCCCCCHHHHhcCcccccccC
Q 044127          239 SPSASRESISLISRLCSWNPHMRPTAAEALEHPFFRSCHF  278 (282)
Q Consensus       239 ~~~~~~~~~~li~~~l~~dp~~Rps~~~ll~~~~~~~~~~  278 (282)
                      ....+.++.++|.+||.+||.+||||+++|+||||+....
T Consensus       260 ~p~~s~~~~~li~~ll~WDP~kRpTA~~al~~pffq~~~~  299 (538)
T KOG0661|consen  260 LPNASSEAASLIERLLAWDPDKRPTASQALQHPFFQVGRA  299 (538)
T ss_pred             CcccCHHHHHHHHHHhcCCCccCccHHHHhcCcccccccc
Confidence            9999999999999999999999999999999999986544

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]	Back alignment and domain information

>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]	Back alignment and domain information

>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]	Back alignment and domain information

>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase	Back alignment and domain information

>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]	Back alignment and domain information

>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]	Back alignment and domain information

>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only]	Back alignment and domain information

>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]	Back alignment and domain information

>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4	Back alignment and domain information

>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PTZ00036 glycogen synthase kinase; Provisional	Back alignment and domain information

>PTZ00263 protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon	Back alignment and domain information

>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta	Back alignment and domain information

>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase	Back alignment and domain information

>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2	Back alignment and domain information

>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C	Back alignment and domain information

>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms]	Back alignment and domain information

>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like	Back alignment and domain information

>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C	Back alignment and domain information

>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota	Back alignment and domain information

>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1	Back alignment and domain information

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases	Back alignment and domain information

>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2	Back alignment and domain information

>PLN00009 cyclin-dependent kinase A; Provisional	Back alignment and domain information

>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7	Back alignment and domain information

>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta	Back alignment and domain information

>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase	Back alignment and domain information

>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase	Back alignment and domain information

>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8	Back alignment and domain information

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>PHA03212 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta	Back alignment and domain information

>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>PLN00034 mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha	Back alignment and domain information

>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1	Back alignment and domain information

>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase	Back alignment and domain information

>KOG0589 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor	Back alignment and domain information

>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2	Back alignment and domain information

>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase	Back alignment and domain information

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>PTZ00284 protein kinase; Provisional	Back alignment and domain information

>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha	Back alignment and domain information

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6	Back alignment and domain information

>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1	Back alignment and domain information

>PHA03209 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1	Back alignment and domain information

>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5	Back alignment and domain information

>PTZ00024 cyclin-dependent protein kinase; Provisional	Back alignment and domain information

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>PTZ00267 NIMA-related protein kinase; Provisional	Back alignment and domain information

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity	Back alignment and domain information

>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase	Back alignment and domain information

>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3	Back alignment and domain information

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases	Back alignment and domain information

>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4	Back alignment and domain information

>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]	Back alignment and domain information

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3	Back alignment and domain information

>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha	Back alignment and domain information

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>PHA03207 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PHA03211 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase	Back alignment and domain information

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta	Back alignment and domain information

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase	Back alignment and domain information

>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6	Back alignment and domain information

>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5	Back alignment and domain information

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase	Back alignment and domain information

>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6	Back alignment and domain information

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional	Back alignment and domain information

>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein	Back alignment and domain information

>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3	Back alignment and domain information

>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>PTZ00283 serine/threonine protein kinase; Provisional	Back alignment and domain information

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PHA02988 hypothetical protein; Provisional	Back alignment and domain information

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes	Back alignment and domain information

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10	Back alignment and domain information

>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5	Back alignment and domain information

>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]	Back alignment and domain information

>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta	Back alignment and domain information

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit	Back alignment and domain information

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1	Back alignment and domain information

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin	Back alignment and domain information

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor	Back alignment and domain information

>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1	Back alignment and domain information

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1	Back alignment and domain information

>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins	Back alignment and domain information

>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms]	Back alignment and domain information

>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3	Back alignment and domain information

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity	Back alignment and domain information

>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors	Back alignment and domain information

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2	Back alignment and domain information

>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor	Back alignment and domain information

>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1	Back alignment and domain information

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase	Back alignment and domain information

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases	Back alignment and domain information

>KOG0586 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins	Back alignment and domain information

>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors	Back alignment and domain information

>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]	Back alignment and domain information

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases	Back alignment and domain information

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1	Back alignment and domain information

>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]	Back alignment and domain information

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases	Back alignment and domain information

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase	Back alignment and domain information

>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2	Back alignment and domain information

>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa	Back alignment and domain information

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase	Back alignment and domain information

>PHA03210 serine/threonine kinase US3; Provisional	Back alignment and domain information

>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome	Back alignment and domain information

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors	Back alignment and domain information

>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha	Back alignment and domain information

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors	Back alignment and domain information

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor	Back alignment and domain information

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor	Back alignment and domain information

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases	Back alignment and domain information

>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer	Back alignment and domain information

>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1	Back alignment and domain information

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2	Back alignment and domain information

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]	Back alignment and domain information

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B	Back alignment and domain information

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6	Back alignment and domain information

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors	Back alignment and domain information

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2	Back alignment and domain information

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors	Back alignment and domain information

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2	Back alignment and domain information

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk	Back alignment and domain information

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2	Back alignment and domain information

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4	Back alignment and domain information

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1	Back alignment and domain information

>smart00219 TyrKc Tyrosine kinase, catalytic domain	Back alignment and domain information

>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase	Back alignment and domain information

>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]	Back alignment and domain information

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta	Back alignment and domain information

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase	Back alignment and domain information

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors	Back alignment and domain information

>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3	Back alignment and domain information

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2	Back alignment and domain information

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn	Back alignment and domain information

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C	Back alignment and domain information

>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases	Back alignment and domain information

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron	Back alignment and domain information

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3	Back alignment and domain information

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A	Back alignment and domain information

>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3	Back alignment and domain information

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase	Back alignment and domain information

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl	Back alignment and domain information

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src	Back alignment and domain information

>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2	Back alignment and domain information

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase	Back alignment and domain information

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase	Back alignment and domain information

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase	Back alignment and domain information

>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk	Back alignment and domain information

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes	Back alignment and domain information

>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk	Back alignment and domain information

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)	Back alignment and domain information

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4	Back alignment and domain information

>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2	Back alignment and domain information

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase	Back alignment and domain information

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase	Back alignment and domain information

>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification]	Back alignment and domain information

>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]	Back alignment and domain information

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3	Back alignment and domain information

>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>PHA02882 putative serine/threonine kinase; Provisional	Back alignment and domain information

>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03225 Serine/threonine-protein kinase SNT7; Provisional	Back alignment and domain information

>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms]	Back alignment and domain information

>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]	Back alignment and domain information

>PLN03224 probable serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd00180 PKc Catalytic domain of Protein Kinases	Back alignment and domain information

>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]	Back alignment and domain information

>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]	Back alignment and domain information

>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>smart00221 STYKc Protein kinase; unclassified specificity	Back alignment and domain information

>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>smart00750 KIND kinase non-catalytic C-lobe domain	Back alignment and domain information

>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK09188 serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain	Back alignment and domain information

>PRK12274 serine/threonine protein kinase; Provisional	Back alignment and domain information

>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional	Back alignment and domain information

>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10345 hypothetical protein; Provisional	Back alignment and domain information

>smart00090 RIO RIO-like kinase	Back alignment and domain information

>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK14879 serine/threonine protein kinase; Provisional	Back alignment and domain information

>TIGR03724 arch_bud32 Kae1-associated kinase Bud32	Back alignment and domain information

>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated	Back alignment and domain information

>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain	Back alignment and domain information

>cd05119 RIO RIO kinase family, catalytic domain	Back alignment and domain information

>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed	Back alignment and domain information

>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family	Back alignment and domain information

>KOG1243 consensus Protein kinase [General function prediction only]	Back alignment and domain information

>KOG1266 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain	Back alignment and domain information

>cd05151 ChoK Choline Kinase (ChoK)	Back alignment and domain information

>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed	Back alignment and domain information

>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification]	Back alignment and domain information

>KOG2137 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>KOG3087 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only]	Back alignment and domain information

>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional	Back alignment and domain information

>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins	Back alignment and domain information

>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PRK09902 hypothetical protein; Provisional	Back alignment and domain information

>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]	Back alignment and domain information

>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]	Back alignment and domain information

>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY)	Back alignment and domain information

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0661 AarF Predicted unusual protein kinase [General function prediction only]	Back alignment and domain information

>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172	Back alignment and domain information

>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH)	Back alignment and domain information

>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily	Back alignment and domain information

>PLN02876 acyl-CoA dehydrogenase	Back alignment and domain information

>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1235 consensus Predicted unusual protein kinase [General function prediction only]	Back alignment and domain information

>TIGR02721 ycfN_thiK thiamine kinase	Back alignment and domain information

>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members	Back alignment and domain information

>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes	Back alignment and domain information

>PRK09550 mtnK methylthioribose kinase; Reviewed	Back alignment and domain information

>cd05153 HomoserineK_II Homoserine Kinase, type II	Back alignment and domain information

>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only]	Back alignment and domain information

>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes	Back alignment and domain information

>PRK05231 homoserine kinase; Provisional	Back alignment and domain information

>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP	Back alignment and domain information

>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C)	Back alignment and domain information

>TIGR00938 thrB_alt homoserine kinase, Neisseria type	Back alignment and domain information

>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2	Back alignment and domain information

>PLN02236 choline kinase	Back alignment and domain information

>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]	Back alignment and domain information

>PTZ00384 choline kinase; Provisional	Back alignment and domain information

>PLN02421 phosphotransferase, alcohol group as acceptor/kinase	Back alignment and domain information

>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2	Back alignment and domain information

>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2')	Back alignment and domain information

>TIGR01767 MTRK 5-methylthioribose kinase	Back alignment and domain information

>PLN02756 S-methyl-5-thioribose kinase	Back alignment and domain information

>TIGR02904 spore_ysxE spore coat protein YsxE	Back alignment and domain information

>PTZ00296 choline kinase; Provisional	Back alignment and domain information

>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK10593 hypothetical protein; Provisional	Back alignment and domain information

>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]	Back alignment and domain information

>PRK12396 5-methylribose kinase; Reviewed	Back alignment and domain information

>PRK06148 hypothetical protein; Provisional	Back alignment and domain information

>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK11768 serine/threonine protein kinase; Provisional	Back alignment and domain information

>PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length	Back alignment and domain information

>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []	Back alignment and domain information

>TIGR02906 spore_CotS spore coat protein, CotS family	Back alignment and domain information

>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms]	Back alignment and domain information

>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		282
1gz8_A		299	Human Cyclin Dependent Kinase 2 Complexed With The		2e-49
4erw_A		306	Cdk2 In Complex With Staurosporine Length = 306		3e-49
1oit_A		299	Imidazopyridines: A Potent And Selective Class Of C		3e-49
1pf8_A		298	Crystal Structure Of Human Cyclin-dependent Kinase		3e-49
2w17_A		299	Cdk2 In Complex With The Imidazole Pyrimidine Amide		3e-49
1fin_A		298	Cyclin A-Cyclin-Dependent Kinase 2 Complex Length =		3e-49
3pxf_A		306	Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N		3e-49
1qmz_A		299	Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com		3e-49
4i3z_A		296	Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES		3e-49
1e9h_A		297	Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex		3e-49
3qhr_A		298	Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic		3e-49
3ezr_A		300	Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ		3e-49
3pj8_A		299	Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]		3e-49
4eos_A		300	Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co		3e-49
4eoo_A		299	Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3		3e-49
1h1p_A		303	Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP		3e-49
4eop_A		300	Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3		4e-49
3bht_A		300	Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN		4e-49
1vyw_A		309	Structure Of Cdk2CYCLIN A WITH PNU-292137 Length =		4e-49
1w98_A		298	The Structural Basis Of Cdk2 Activation By Cyclin E		4e-49
4eoq_A		301	Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co		4e-49
4bcq_A		301	Structure Of Cdk2 In Complex With Cyclin A And A 2-		4e-49
2jgz_A		289	Crystal Structure Of Phospho-Cdk2 In Complex With C		4e-49
1jst_A		298	Phosphorylated Cyclin-Dependent Kinase-2 Bound To C		4e-49
1ogu_A		302	Structure Of Human Thr160-phospho Cdk2/cyclin A Com		4e-49
2iw8_A		302	Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82		4e-49
4eom_A		301	Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum		5e-49
4eon_A		300	Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum		5e-49
2iw6_A		302	Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com		1e-48
1oir_A		299	Imidazopyridines: A Potent And Selective Class Of C		1e-48
1h01_A		298	Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili		1e-48
4eoi_A		299	Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc		1e-48
4eoj_A		302	Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma		2e-48
4eok_A		300	Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma		2e-48
1gii_A		298	Human Cyclin Dependent Kinase 2 Complexed With The		2e-48
4exu_A		371	Mapk13, Inactive Form Length = 371		3e-47
3coi_A		353	Crystal Structure Of P38delta Kinase Length = 353		4e-47
4h3q_A		362	Crystal Structure Of Human Erk2 Complexed With A Ma		2e-46
4gsb_A		364	Monoclinic Crystal Form Of The Apo-Erk2 Length = 36		6e-46
3sa0_A		360	Complex Of Erk2 With Norathyriol Length = 360		8e-46
4fv7_A		360	Crystal Structure Of The Erk2 Complexed With E94 Le		9e-46
4fv6_A		360	Crystal Structure Of The Erk2 Complexed With E57 Le		9e-46
2y9q_A		362	Crystal Structure Of Human Erk2 Complexed With A Ma		9e-46
4fux_A		360	Crystal Structure Of The Erk2 Complexed With E75 Le		1e-45
2ojg_A		380	Crystal Structure Of Erk2 In Complex With N,n-dimet		1e-45
1wzy_A		368	Crystal Structure Of Human Erk2 Complexed With A Py		1e-45
1tvo_A		368	The Structure Of Erk2 In Complex With A Small Molec		1e-45
3o71_A		358	Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length		1e-45
3zu7_A		365	Crystal Structure Of A Designed Selected Ankyrin Re		1e-45
2z7l_A		366	Unphosphorylated Mitogen Activated Protein Kinase E		1e-45
3c9w_A		357	Crystal Structure Of Erk-2 With Hypothemycin Covale		1e-45
2fys_B		364	Crystal Structure Of Erk2 Complex With Kim Peptide		1e-45
3qyw_A		364	Crystal Structure Of Erk2 In Complex With An Inhibi		1e-45
2gph_A		364	Docking Motif Interactions In The Map Kinase Erk2 L		1e-45
3tei_A		362	Crystal Structure Of Human Erk2 Complexed With A Ma		2e-45
3r63_A		358	Structure Of Erk2 (Spe) Mutant (S246e) Length = 358		2e-45
1gol_A		364	Coordinates Of Rat Map Kinase Erk2 With An Arginine		2e-45
4b99_A		398	Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le		5e-45
4ic7_A		442	Crystal Structure Of The Erk5 Kinase Domain In Comp		9e-45
3zuv_A		364	Crystal Structure Of A Designed Selected Ankyrin Re		1e-44
2erk_A		365	Phosphorylated Map Kinase Erk2 Length = 365		1e-44
2zoq_A		382	Structural Dissection Of Human Mitogen-Activated Ki		1e-44
1pme_A		380	Structure Of Penta Mutant Human Erk2 Map Kinase Com		2e-44
4e5a_X		360	The W197a Mutant Of P38a Map Kinase Length = 360		3e-43
1lew_A		360	Crystal Structure Of Map Kinase P38 Complexed To Th		5e-43
3p4k_A		370	The Third Conformation Of P38a Map Kinase Observed		5e-43
3mtl_A		324	Crystal Structure Of The Pctaire1 Kinase In Complex		6e-43
2gtm_A		348	Mutated Mouse P38 Map Kinase Domain In Complex With		6e-43
3tg1_A		380	Crystal Structure Of P38alpha In Complex With A Map		6e-43
1ua2_A		346	Crystal Structure Of Human Cdk7 Length = 346		6e-43
1bmk_A		379	The Complex Structure Of The Map Kinase P38SB218655		7e-43
2oza_B		366	Structure Of P38alpha Complex Length = 366		7e-43
3fi4_A		372	P38 Kinase Crystal Structure In Complex With Ro4499		9e-43
3d83_A		360	Crystal Structure Of P38 Kinase In Complex With A B		9e-43
3d7z_A		360	Crystal Structure Of P38 Kinase In Complex With A B		9e-43
2lgc_A		359	Joint Nmr And X-Ray Refinement Reveals The Structur		1e-42
3s3i_A		349	P38 Kinase Crystal Structure In Complex With Small		1e-42
3odz_X		360	Crystal Structure Of P38alpha Y323r Active Mutant L		1e-42
3gcp_A		360	Human P38 Map Kinase In Complex With Sb203580 Lengt		1e-42
1zzl_A		351	Crystal Structure Of P38 With Triazolopyridine Leng		1e-42
3od6_X		360	Crystal Structure Of P38alpha Y323t Active Mutant L		1e-42
3nnu_A		354	Crystal Structure Of P38 Alpha In Complex With Dp13		1e-42
3ody_X		360	Crystal Structure Of P38alpha Y323q Active Mutant L		1e-42
3hec_A		348	P38 In Complex With Imatinib Length = 348		1e-42
3zsg_A		362	X-Ray Structure Of P38alpha Bound To Tak-715 Length		1e-42
2npq_A		367	A Novel Lipid Binding Site In The P38 Alpha Map Kin		1e-42
1di9_A		360	The Structure Of P38 Mitogen-Activated Protein Kina		1e-42
2bal_A		365	P38alpha Map Kinase Bound To Pyrazoloamine Length =		1e-42
2baq_A		365	P38alpha Bound To Ro3201195 Length = 365		1e-42
3e92_A		371	Crystal Structure Of P38 Kinase In Complex With A B		1e-42
3k3i_A		350	P38alpha Bound To Novel Dgf-Out Compound Pf-0021595		1e-42
3dt1_A		383	P38 Complexed With A Quinazoline Inhibitor Length =		1e-42
3oef_X		360	Crystal Structure Of Y323f Inactive Mutant Of P38al		1e-42
1m7q_A		366	Crystal Structure Of P38 Map Kinase In Complex With		1e-42
3k3j_A		362	P38alpha Bound To Novel Dfg-Out Compound Pf-0041612		1e-42
1ian_A		366	Human P38 Map Kinase Inhibitor Complex Length = 366		1e-42
2baj_A		365	P38alpha Bound To Pyrazolourea Length = 365		1e-42
3hrb_A		359	P38 Kinase Crystal Structure In Complex With Small		1e-42
3gcu_A		360	Human P38 Map Kinase In Complex With Rl48 Length =		1e-42
3kq7_A		380	Structure Of Human P38alpha With N-[4-Methyl-3-(6-{		1e-42
3hvc_A		362	Crystal Structure Of Human P38alpha Map Kinase Leng		2e-42
1oz1_A		372	P38 Mitogen-Activated Kinase In Complex With 4-Azai		2e-42
2gfs_A		372	P38 Kinase Crystal Structure In Complex With Ro3201		2e-42
2y8o_A		362	Crystal Structure Of Human P38alpha Complexed With		2e-42
3mpt_A		371	Crystal Structure Of P38 Kinase In Complex With A P		2e-42
1ove_A		366	The Structure Of P38 Alpha In Complex With A Dihydr		2e-42
1bl6_A		379	The Complex Structure Of The Map Kinase P38SB216995		2e-42
3mh2_A		360	Mutagenesis Of P38 Map Kinase Establishes Key Roles		2e-42
3mh0_A		360	Mutagenesis Of P38 Map Kinase Eshtablishes Key Role		2e-42
1cm8_A		367	Phosphorylated Map Kinase P38-Gamma Length = 367		2e-42
3mh3_A		360	Mutagenesis Of P38 Map Kinase Establishes Key Roles		3e-42
3g33_A		308	Crystal Structure Of Cdk4CYCLIN D3 Length = 308		3e-42
2puu_A		348	Crystal Structure Of P38 Complex With 1-(5-Tert-But		3e-42
3mh1_A		360	Mutagenesis Of P38 Map Kinase Establishes Key Roles		4e-42
3oht_A		389	Crystal Structure Of Salmo Salar P38alpha Length =		4e-42
2w99_B		306	Crystal Structure Of Cdk4 In Complex With A D-Type		5e-42
1yw2_A		360	Mutated Mus Musculus P38 Kinase (Mp38) Length = 360		6e-42
3gi3_A		360	Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana		6e-42
1ywr_A		360	Crystal Structure Analysis Of Inactive P38 Kinase D		6e-42
2ghl_A		348	Mutant Mus Musculus P38 Kinase Domain In Complex Wi		6e-42
4ewq_A		383	Human P38 Alpha Mapk In Complex With A Pyridazine B		7e-42
2w96_B		306	Crystal Structure Of Cdk4 In Complex With A D-Type		8e-42
2fsl_X		367	Mitogen Activated Protein Kinase P38alpha (D176a+f3		8e-42
2fst_X		367	Mitogen Activated Protein Kinase P38alpha (d176a+f3		1e-41
3o8p_A		360	Conformational Plasticity Of P38 Map Kinase Dfg Mot		1e-41
2fso_X		367	Mitogen Activated Protein Kinase P38alpha (D176a) A		1e-41
3nnx_A		354	Crystal Structure Of Phosphorylated P38 Alpha In Co		1e-41
2w9f_B		306	Crystal Structure Of Cdk4 In Complex With A D-Type		1e-41
2pk9_A		317	Structure Of The Pho85-pho80 Cdk-cyclin Complex Of		1e-41
2b9f_A		353	Crystal Structure Of Non-Phosphorylated Fus3 Length		2e-41
3py3_A		380	Crystal Structure Of Phosphorylated P38alpha Map Ki		2e-41
3oz6_A		388	Crystal Structure Of Mapk From Cryptosporidium Parv		3e-41
3gc9_A		370	The Structure Of P38beta C119s, C162s In Complex Wi		8e-41
2qkr_A		313	Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5		1e-40
3niz_A		311	Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5		1e-40
1h4l_A		292	Structure And Regulation Of The Cdk5-P25(Nck5a) Com		1e-40
2f9g_A		353	Crystal Structure Of Fus3 Phosphorylated On Tyr182		1e-40
3gp0_A		348	Crystal Structure Of Human Mitogen Activated Protei		1e-40
3gc8_A		370	The Structure Of P38beta C162s In Complex With A Di		2e-40
2b9h_A		353	Crystal Structure Of Fus3 With A Docking Motif From		2e-40
3gbz_A		329	Structure Of The Cmgc Cdk Kinase From Giardia Lambl		5e-40
1ung_A		292	Structural Mechanism For The Inhibition Of Cdk5-P25		5e-40
3nup_A		307	Cdk6 (Monomeric) In Complex With Inhibitor Length =		3e-39
1jow_B		308	Crystal Structure Of A Complex Of Human Cdk6 And A		3e-39
1bi8_A		326	Mechanism Of G1 Cyclin Dependent Kinase Inhibition		4e-39
1v0o_A		288	Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho		3e-38
1v0b_A		288	Crystal Structure Of The T198a Mutant Of Pfpk5 Leng		3e-38
1ob3_A		288	Structure Of P. Falciparum Pfpk5 Length = 288		4e-38
3rp9_A		458	Crystal Structure Of The Apo Mapk From Toxoplasma G		6e-37
3sd0_A		350	Identification Of A Glycogen Synthase Kinase-3b Inh		7e-37
1r0e_A		391	Glycogen Synthase Kinase-3 Beta In Complex With 3-I		8e-37
2o5k_A		372	Crystal Structure Of Gsk3beta In Complex With A Ben		8e-37
1q5k_A		414	Crystal Structure Of Glycogen Synthase Kinase 3 In		9e-37
1i09_A		420	Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len		9e-37
1pyx_A		422	Gsk-3 Beta Complexed With Amp-Pnp Length = 422		9e-37
1q3d_A		424	Gsk-3 Beta Complexed With Staurosporine Length = 42		9e-37
1uv5_A		350	Glycogen Synthase Kinase 3 Beta Complexed With 6-Br		9e-37
4acc_A		465	Gsk3b In Complex With Inhibitor Length = 465		1e-36
1h8f_A		352	Glycogen Synthase Kinase 3 Beta. Length = 352		3e-36
3f88_A		349	Glycogen Synthase Kinase 3beta Inhibitor Complex Le		4e-36
2ow3_A		352	Glycogen Synthase Kinase-3 Beta In Complex With Bis		5e-36
4agu_A		311	Crystal Structure Of The Human Cdkl1 Kinase Domain		6e-36
4dit_A		382	Crystal Structure Of Gsk3beta In Complex With A Imi		7e-36
3f7z_A		350	X-ray Co-crystal Structure Of Glycogen Synthase Kin		7e-36
3zdi_A		350	Glycogen Synthase Kinase 3 Beta Complexed With Axin		7e-36
4afj_A		367	5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec		7e-36
1gng_A		378	Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With		7e-36
3gb2_A		353	Gsk3beta Inhibitor Complex Length = 353		7e-36
3zrk_A		371	Identification Of 2-(4-Pyridyl)thienopyridinones As		7e-36
3say_A		430	Crystal Structure Of Human Glycogen Synthase Kinase		9e-36
1o9u_A		350	Glycogen Synthase Kinase 3 Beta Complexed With Axin		2e-35
3n9x_A		432	Crystal Structure Of Map Kinase From Plasmodium Ber		4e-35
4e7w_A		394	Structure Of Gsk3 From Ustilago Maydis Length = 394		7e-35
3fi3_A		364	Crystal Structure Of Jnk3 With Indazole Inhibitor,		1e-34
2r9s_A		356	C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu		1e-34
3kvx_A		364	Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le		1e-34
3fv8_A		355	Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le		2e-34
3fi2_A		353	Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib		2e-34
4aaa_A		331	Crystal Structure Of The Human Cdkl2 Kinase Domain		2e-34
2ok1_A		365	Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3		2e-34
2o0u_A		364	Crystal Structure Of Human Jnk3 Complexed With N-{3		2e-34
3ttj_A		464	Crystal Structure Of Jnk3 Complexed With Cc-359, A		2e-34
1pmn_A		364	Crystal Structure Of Jnk3 In Complex With An Imidaz		2e-34
3oxi_A		362	Design And Synthesis Of Disubstituted Thiophene And		2e-34
3ptg_A		363	Design And Synthesis Of A Novel, Orally Efficacious		2e-34
1jnk_A		423	The C-Jun N-Terminal Kinase (Jnk3s) Complexed With		2e-34
4h36_A		356	Crystal Structure Of Jnk3 In Complex With Atf2 Pept		3e-34
2b1p_A		355	Inhibitor Complex Of Jnk3 Length = 355		3e-34
2exc_X		356	Inhibitor Complex Of Jnk3 Length = 356		3e-34
3pg1_A		362	Map Kinase Lmampk10 From Leishmania Major (1.95 Ang		2e-33
3vum_A		370	Crystal Structure Of A Cysteine-deficient Mutant M7		2e-33
3uib_A		362	Map Kinase Lmampk10 From Leishmania Major In Comple		2e-33
3elj_A		369	Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine		3e-33
3pze_A		358	Jnk1 In Complex With Inhibitor Length = 358		4e-33
3e7o_A		360	Crystal Structure Of Jnk2 Length = 360		5e-33
3vul_A		370	Crystal Structure Of A Cysteine-deficient Mutant M1		5e-33
3npc_A		364	Crystal Structure Of Jnk2 Complexed With Birb796 Le		5e-33
3vuk_A		370	Crystal Structure Of A Cysteine-deficient Mutant M5		6e-33
3vui_A		370	Crystal Structure Of A Cysteine-deficient Mutant M2		8e-33
2i6l_A		320	Crystal Structure Of Human Mitogen Activated Protei		9e-33
3vuh_A		370	Crystal Structure Of A Cysteine-deficient Mutant M3		2e-32
3vud_A		370	Crystal Structure Of A Cysteine-deficient Mutant M1		2e-32
3nie_A		429	Crystal Structure Of Pf11_0147 Length = 429		3e-32
3vug_A		370	Crystal Structure Of A Cysteine-deficient Mutant M2		3e-32
1ukh_A		369	Structural Basis For The Selective Inhibition Of Jn		4e-32
2xrw_A		371	Linear Binding Motifs For Jnk And For Calcineurin A		4e-32
3mi9_A		351	Crystal Structure Of Hiv-1 Tat Complexed With Human		7e-32
3blh_A		331	Crystal Structure Of Human Cdk9CYCLINT1 Length = 33		8e-32
4bcf_A		331	Structure Of Cdk9 In Complex With Cyclin T And A 2-		8e-32
4ec8_A		373	Structure Of Full Length Cdk9 In Complex With Cycli		9e-32
3o17_A		370	Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3		1e-31
2g01_A		370	Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit		2e-31
3eb0_A		383	Crystal Structure Of Cgd4_240 From Cryptosporidium		4e-31
2xs0_A		386	Linear Binding Motifs For Jnk And For Calcineurin A		4e-31
3v3v_A		379	Structural And Functional Analysis Of Quercetagetin		5e-31
3rgf_A		405	Crystal Structure Of Human Cdk8CYCC Length = 405		6e-28
3e3p_A		360	Glycogen Synthase Kinase From Leishmania Major Leng		8e-27
1na7_A		329	Crystal Structure Of The Catalytic Subunit Of Human		1e-26
3dfa_A		286	Crystal Structure Of Kinase Domain Of Calcium-depen		4e-26
2wei_A		287	Crystal Structure Of The Kinase Domain Of Cryptospo		4e-26
3igo_A		486	Crystal Structure Of Cryptosporidium Parvum Cdpk1,		5e-26
4azf_A		417	Human Dyrk2 In Complex With Leucettine L41 Length =		2e-25
3kvw_A		429	Crystal Structure Of Dual-Specificity Tyrosine Phos		2e-25
3hyh_A		275	Crystal Structure Of The Protein Kinase Domain Of Y		7e-25
3dae_A		283	Crystal Structure Of Phosphorylated Snf1 Kinase Dom		8e-25
3mn3_A		271	An Inhibited Conformation For The Protein Kinase Do		8e-25
2fh9_A		274	Structure And Dimerization Of The Kinase Domain Fro		9e-25
3k2l_A		429	Crystal Structure Of Dual-Specificity Tyrosine Phos		1e-24
3ku2_A		507	Crystal Structure Of Inactivated Form Of Cdpk1 From		2e-24
3hx4_A		508	Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg		2e-24
3i79_A		484	Calcium-Dependent Protein Kinase 1 From Toxoplasma		2e-24
3ma6_A		298	Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr		2e-24
3juh_A		335	Crystal Structure Of A Mutant Of Human Protein Kina		1e-22
3lm0_A		327	Crystal Structure Of Human SerineTHREONINE KINASE 1		2e-22
2cdz_A		303	Crystal Structure Of The Human P21-Activated Kinase		2e-22
2x4z_A		296	Crystal Structure Of The Human P21-Activated Kinase		2e-22
2bva_A		292	Crystal Structure Of The Human P21-Activated Kinase		2e-22
3i7c_A		484	Calcium-Dependent Protein Kinase 1 From Toxoplasma		2e-22
2q0n_A		301	Structure Of Human P21 Activating Kinase 4 (Pak4) I		3e-22
4fif_A		346	Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid		5e-22
3lij_A		494	Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820)		5e-22
4fie_A		423	Full-Length Human Pak4 Length = 423		6e-22
4dgl_C		335	Crystal Structure Of The Ck2 Tetrameric Holoenzyme		7e-22
2vx3_A		382	Crystal Structure Of The Human Dual Specificity Tyr		1e-21
3anq_A		368	Human Dyrk1aINHIBITOR COMPLEX Length = 368		1e-21
3ofm_A		350	Structure Of A Human Ck2alpha Prime, The Paralog Is		1e-21
4aze_A		382	Human Dyrk1a In Complex With Leucettine L41 Length		1e-21
3e3b_X		339	Crystal Structure Of Catalytic Subunit Of Human Pro		1e-21
3txo_A		353	Pkc Eta Kinase In Complex With A Naphthyridine Leng		2e-21
3rzf_A		677	Crystal Structure Of Inhibitor Of Kappab Kinase Bet		2e-21
3bqc_A		335	High Ph-Value Crystal Structure Of Emodin In Comple		2e-21
2r7i_A		335	Crystal Structure Of Catalytic Subunit Of Protein K		2e-21
3h30_A		334	Crystal Structure Of The Catalytic Subunit Of Human		2e-21
3qa8_A		676	Crystal Structure Of Inhibitor Of Kappa B Kinase Be		2e-21
3q9w_A		336	Crystal Structure Of Human Ck2 Alpha In Complex Wit		2e-21
1pjk_A		334	Crystal Structure Of A C-terminal Deletion Mutant O		2e-21
3nga_A		333	Human Ck2 Catalytic Domain In Complex With Cx-4945		2e-21
3q04_A		328	Crystal Structure Of The Apo-Form Of Human Ck2 Alph		2e-21
1jwh_A		337	Crystal Structure Of Human Protein Kinase Ck2 Holoe		2e-21
3nsz_A		330	Human Ck2 Catalytic Domain In Complex With Amppn Le		2e-21
2zjw_A		340	Crystal Structure Of Human Ck2 Alpha Complexed With		2e-21
3u87_A		349	Structure Of A Chimeric Construct Of Human Ck2alpha		2e-21
3mb6_A		331	Human Ck2 Catalytic Domain In Complex With A Difura		2e-21
2ycf_A		322	Crystal Structure Of Checkpoint Kinase 2 In Complex		3e-21
2xk9_A		322	Structural Analysis Of Checkpoint Kinase 2 (Chk2) I		3e-21
2ycr_A		323	Crystal Structure Of Checkpoint Kinase 2 In Complex		3e-21
1phk_A		298	Two Structures Of The Catalytic Domain Of Phosphory		3e-21
2w0j_A		323	Crystal Structure Of Chk2 In Complex With Nsc 10955		3e-21
2phk_A		277	The Crystal Structure Of A Phosphorylase Kinase Pep		3e-21
2cn5_A		329	Crystal Structure Of Human Chk2 In Complex With Adp		3e-21
3i6w_A		443	Structure And Activation Mechanism Of The Chk2 Dna-		4e-21
3i6u_A		419	Structure And Activation Mechanism Of The Chk2 Dna-		5e-21
1ql6_A		298	The Catalytic Mechanism Of Phosphorylase Kinase Pro		5e-21
3dxn_A		287	Crystal Structure Of The Calcium-dependent Kinase F		7e-21
2y94_A		476	Structure Of An Active Form Of Mammalian Ampk Lengt		8e-21
3is5_A		285	Crystal Structure Of Cdpk Kinase Domain From Toxopl		9e-21
2pvh_A		352	Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri		9e-21
4apc_A		350	Crystal Structure Of Human Nima-Related Kinase 1 (N		9e-21
3hzt_A		467	Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4		1e-20
1u5q_A		348	Crystal Structure Of The Tao2 Kinase Domain: Activa		1e-20
3h4j_B		336	Crystal Structure Of Pombe Ampk Kdaid Fragment Leng		1e-20
2gcd_A		309	Tao2 Kinase Domain-Staurosporine Structure Length =		2e-20
1zrz_A		364	Crystal Structure Of The Catalytic Domain Of Atypic		2e-20
3a8w_A		345	Crystal Structure Of Pkciota Kinase Domain Length =		2e-20
3zh8_A		349	A Novel Small Molecule Apkc Inhibitor Length = 349		2e-20
3kxg_A		327	Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun		2e-20
4dgn_A		326	Crystal Structure Of Maize Ck2 In Complex With The		2e-20
3pvg_A		331	Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C		2e-20
4dc2_A		396	Structure Of Pkc In Complex With A Substrate Peptid		2e-20
2qc6_A		332	Protein Kinase Ck2 In Complex With Dbc Length = 332		2e-20
3rny_A		346	Crystal Structure Of Human Rsk1 C-Terminal Kinase D		3e-20
2wnt_A		330	Crystal Structure Of The Human Ribosomal Protein S6		3e-20
1m2p_A		325	Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra		3e-20
4dgm_A		326	Crystal Structure Of Maize Ck2 In Complex With The		3e-20
4anm_A		335	Complex Of Ck2 With A Cdc7 Inhibitor Length = 335		3e-20
1daw_A		327	Crystal Structure Of A Binary Complex Of Protein Ki		4e-20
1ds5_A		332	Dimeric Crystal Structure Of The Alpha Subunit In C		4e-20
3a60_A		327	Crystal Structure Of Unphosphorylated P70s6k1 (Form		5e-20
2wel_A		327	Crystal Structure Of Su6656-Bound CalciumCALMODULIN		6e-20
2qr8_A		342	2.0a X-ray Structure Of C-terminal Kinase Domain Of		6e-20
3a62_A		327	Crystal Structure Of Phosphorylated P70s6k1 Length		6e-20
2vn9_A		301	Crystal Structure Of Human Calcium Calmodulin Depen		7e-20
2vz6_A		313	Structure Of Human Calcium Calmodulin Dependent Pro		8e-20
3bhy_A		283	Crystal Structure Of Human Death Associated Protein		8e-20
1mrv_A		339	Crystal Structure Of An Inactive Akt2 Kinase Domain		9e-20
1gzk_A		315	Molecular Mechanism For The Regulation Of Protein K		9e-20
2jed_A		352	The Crystal Structure Of The Kinase Domain Of The P		9e-20
1gzn_A		335	Structure Of Pkb Kinase Domain Length = 335		1e-19
3cok_A		278	Crystal Structure Of Plk4 Kinase Length = 278		1e-19
1o6l_A		337	Crystal Structure Of An Activated Akt/protein Kinas		1e-19
1o6k_A		336	Structure Of Activated Form Of Pkb Kinase Domain S4		1e-19
3q5i_A		504	Crystal Structure Of Pbanka_031420 Length = 504		1e-19
2jdo_A		342	Structure Of Pkb-Beta (Akt2) Complexed With Isoquin		1e-19
3kk9_A		282	Camkii Substrate Complex B Length = 282		1e-19
3e87_A		335	Crystal Structures Of The Kinase Domain Of Akt2 In		1e-19
3kk8_A		284	Camkii Substrate Complex A Length = 284		1e-19
3f3z_A		277	Crystal Structure Of Cryptosporidium Parvum Calcium		2e-19
2bdw_A		362	Crystal Structure Of The Auto-Inhibited Kinase Doma		2e-19
2qg5_A		294	Cryptosporidium Parvum Calcium Dependent Protein Ki		2e-19
3kl8_A		269	Camkiintide Inhibitor Complex Length = 269		2e-19
1xjd_A		345	Crystal Structure Of Pkc-Theta Complexed With Staur		2e-19
3hko_A		345	Crystal Structure Of A Cdpk Kinase Domain From Cryp		2e-19
1a06_A		332	Calmodulin-Dependent Protein Kinase From Rat Length		3e-19
1z57_A		339	Crystal Structure Of Human Clk1 In Complex With 10z		5e-19
3vn9_A		340	Rifined Crystal Structure Of Non-Phosphorylated Map		5e-19
2y7j_A		365	Structure Of Human Phosphorylase Kinase, Gamma 2 Le		5e-19
4ejn_A		446	Crystal Structure Of Autoinhibited Form Of Akt1 In		5e-19
1yrp_A		278	Catalytic Domain Of Human Zip Kinase Phosphorylated		5e-19
3o96_A		446	Crystal Structure Of Human Akt1 With An Allosteric		5e-19
3com_A		314	Crystal Structure Of Mst1 Kinase Length = 314		6e-19
4gv1_A		340	Pkb Alpha In Complex With Azd5363 Length = 340		6e-19
2f57_A		317	Crystal Structure Of The Human P21-activated Kinase		6e-19
3cqu_A		342	Crystal Structure Of Akt-1 Complexed With Substrate		7e-19
3ocb_A		341	Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor		7e-19
2j90_A		304	Crystal Structure Of Human Zip Kinase In Complex Wi		7e-19
3soa_A		444	Full-Length Human Camkii Length = 444		1e-18
4fg7_A		293	Crystal Structure Of Human Calcium/calmodulin-depen		1e-18
4fg9_A		320	Crystal Structure Of Human Calcium/calmodulin-depen		1e-18
4fg8_A		315	Crystal Structure Of Human Calcium/calmodulin-depen		1e-18
2yza_A		276	Crystal Structure Of Kinase Domain Of Human 5'-Amp-		1e-18
2qr7_A		342	2.0a X-Ray Structure Of C-Terminal Kinase Domain Of		2e-18
2v7o_A		336	Crystal Structure Of Human Calcium-Calmodulin-Depen		2e-18
2c30_A		321	Crystal Structure Of The Human P21-Activated Kinase		2e-18
2hw6_A		307	Crystal Structure Of Mnk1 Catalytic Domain Length =		2e-18
3iw4_A		360	Crystal Structure Of Pkc Alpha In Complex With Nvp-		2e-18
1zy4_A		303	Crystal Structure Of Eif2alpha Protein Kinase Gcn2:		2e-18
3aln_A		327	Crystal Structure Of Human Non-Phosphorylated Mkk4		3e-18
1zyc_A		303	Crystal Structure Of Eif2alpha Protein Kinase Gcn2:		3e-18
2z7q_A		321	Crystal Structure Of The N-Terminal Kinase Domain O		3e-18
2vag_A		339	Crystal Structure Of Di-Phosphorylated Human Clk1 I		3e-18
3kn5_A		325	Crystal Structure Of The C-Terminal Kinase Domain O		3e-18
3bhh_A		295	Crystal Structure Of Human Calcium/calmodulin-depen		4e-18
2w4o_A		349	Crystal Structure Of Human Camk4 In Complex With 4-		4e-18
3lau_A		287	Crystal Structure Of Aurora2 Kinase In Complex With		5e-18
2c6e_A		283	Aurora A Kinase Activated Mutant (T287d) In Complex		5e-18
3fdn_A		279	Structure-Based Drug Design Of Novel Aurora Kinase		5e-18
2c6d_A		275	Aurora A Kinase Activated Mutant (T287d) In Complex		5e-18
3ka0_A		320	Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4		6e-18
3mfr_A		351	Cask-4m Cam Kinase Domain, Native Length = 351		6e-18
1zmu_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		6e-18
2r0i_A		327	Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len		6e-18
3a4o_X		286	Lyn Kinase Domain Length = 286		7e-18
3fme_A		290	Crystal Structure Of Human Mitogen-Activated Protei		7e-18
2hak_A		328	Catalytic And Ubiqutin-Associated Domains Of Mark1P		7e-18
2wzj_A		327	Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82		7e-18
2qnj_A		328	Kinase And Ubiquitin-Associated Domains Of Mark3PAR		7e-18
2h6d_A		276	Protein Kinase Domain Of The Human 5'-Amp-Activated		7e-18
3fpm_A		325	Crystal Structure Of A Squarate Inhibitor Bound To		8e-18
2pzy_A		324	Structure Of Mk2 Complexed With Compound 76 Length		9e-18
2jbo_A		326	Protein Kinase Mk2 In Complex With An Inhibitor (Cr		9e-18
3fe3_A		328	Crystal Structure Of The Kinase Mark3PAR-1: T211a-S		1e-17
2r5t_A		373	Crystal Structure Of Inactive Serum And Glucocortic		1e-17
3r2y_A		319	Mk2 Kinase Bound To Compound 1 Length = 319		1e-17
3r2b_A		318	Mk2 Kinase Bound To Compound 5b Length = 318		1e-17
3ama_A		351	Protein Kinase A Sixfold Mutant Model Of Aurora B W		1e-17
3gok_A		334	Binding Site Mapping Of Protein Ligands Length = 33		1e-17
2p3g_X		327	Crystal Structure Of A Pyrrolopyridine Inhibitor Bo		1e-17
2jc6_A		334	Crystal Structure Of Human Calmodulin-Dependent Pro		1e-17
1zmv_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		1e-17
1zmw_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		1e-17
1kwp_A		400	Crystal Structure Of Mapkap2 Length = 400		1e-17
4bc6_A		293	Crystal Structure Of Human Serine Threonine Kinase-		1e-17
2onl_C		406	Crystal Structure Of The P38a-Mapkap Kinase 2 Heter		1e-17
2oza_A		356	Structure Of P38alpha Complex Length = 356		1e-17
2j7t_A		302	Crystal Structure Of Human Serine Threonine Kinase-		1e-17
2xru_A		280	Aurora-A T288e Complexed With Pha-828300 Length = 2		1e-17
2wqm_A		310	Structure Of Apo Human Nek7 Length = 310		2e-17
4dfy_A		371	Crystal Structure Of R194a Mutant Of Camp-Dependent		2e-17
2j50_A		280	Structure Of Aurora-2 In Complex With Pha-739358 Le		2e-17
2j4z_A		306	Structure Of Aurora-2 In Complex With Pha-680626 Le		2e-17
1kob_A		387	Twitchin Kinase Fragment (Aplysia), Autoregulated P		2e-17
3iec_A		319	Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K		2e-17
2wtw_A		285	Aurora-A Inhibitor Structure (2nd Crystal Form) Len		2e-17
2xng_A		283	Structure Of Aurora-A Bound To A Selective Imidazop		2e-17
2bmc_A		306	Aurora-2 T287d T288d Complexed With Pha-680632 Leng		2e-17
2x6d_A		285	Aurora-A Bound To An Inhibitor Length = 285		2e-17
1mq4_A		272	Crystal Structure Of Aurora-A Protein Kinase Length		2e-17
2w1d_A		275	Structure Determination Of Aurora Kinase In Complex		3e-17
1muo_A		297	Crystal Structure Of Aurora-2, An Oncogenic Serine-		3e-17
3o50_A		267	Crystal Structure Of Benzamide 9 Bound To Auroraa L		3e-17
3r21_A		271	Design, Synthesis, And Biological Evaluation Of Pyr		3e-17
3fhi_A		350	Crystal Structure Of A Complex Between The Catalyti		3e-17
2qur_A		350	Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe		3e-17
1fot_A		318	Structure Of The Unliganded Camp-Dependent Protein		3e-17
3qbn_A		281	Structure Of Human Aurora A In Complex With A Diami		3e-17
2gu8_A		337	Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel		4e-17
2gnf_A		350	Protein Kinase A Fivefold Mutant Model Of Rho-Kinas		4e-17
3qal_E		350	Crystal Structure Of Arg280ala Mutant Of Catalytic		4e-17
3nr9_A		368	Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length		4e-17
1bkx_A		350	A Binary Complex Of The Catalytic Subunit Of Camp-D		4e-17
1j3h_A		350	Crystal Structure Of Apoenzyme Camp-Dependent Prote		4e-17
1fmo_E		350	Crystal Structure Of A Polyhistidine-Tagged Recombi		4e-17
2gng_A		350	Protein Kinase A Fivefold Mutant Model Of Rho-Kinas		4e-17
1y8g_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		4e-17
1jbp_E		350	Crystal Structure Of The Catalytic Subunit Of Camp-		4e-17
1yhv_A		297	Crystal Structure Of Pak1 Kinase Domain With Two Po		4e-17
2erz_E		351	Crystal Structure Of C-amp Dependent Kinase (pka) B		4e-17
3coh_A		268	Crystal Structure Of Aurora-A In Complex With A Pen		5e-17
3e5a_A		268	Crystal Structure Of Aurora A In Complex With Vx-68		5e-17
2f4j_A		287	Structure Of The Kinase Domain Of An Imatinib-Resis		5e-17
3dk7_A		277	Crystal Structure Of Mutant Abl Kinase Domain In Co		5e-17
2g2f_A		287	A Src-Like Inactive Conformation In The Abl Tyrosin		5e-17
1ctp_E		350	Structure Of The Mammalian Catalytic Subunit Of Cam		6e-17
3unz_A		279	Aurora A In Complex With Rpm1679 Length = 279		6e-17
1cmk_E		350	Crystal Structures Of The Myristylated Catalytic Su		6e-17
1cdk_A		350	Camp-Dependent Protein Kinase Catalytic Subunit (E.		6e-17
2zv7_A		279	Lyn Tyrosine Kinase Domain, Apo Form Length = 279		6e-17
3db6_A		301	Crystal Structure Of An Activated (Thr->asp) Polo-L		7e-17
3nx8_A		351	Human Camp Dependent Protein Kinase In Complex With		7e-17
1f3m_C		297	Crystal Structure Of Human SerineTHREONINE KINASE P		7e-17
4ae6_A		343	Structure And Function Of The Human Sperm-specific		7e-17
2dwb_A		285	Aurora-A Kinase Complexed With Amppnp Length = 285		7e-17
3mvj_A		371	Human Cyclic Amp-Dependent Protein Kinase Pka Inhib		7e-17
3h0y_A		268	Aurora A In Complex With A Bisanilinopyrimidine Len		7e-17
3d5v_A		317	Crystal Structure Of An Activated (Thr->asp) Polo-L		7e-17
4el9_A		305	Structure Of N-Terminal Kinase Domain Of Rsk2 With		8e-17
3ubd_A		304	Structure Of N-Terminal Domain Of Rsk2 Kinase In Co		8e-17
3agl_A		351	Complex Of Pka With The Bisubstrate Protein Kinase		8e-17
3nrm_A		283	Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito		8e-17
1apm_E		350	2.0 Angstrom Refined Crystal Structure Of The Catal		8e-17
3g51_A		325	Structural Diversity Of The Active Conformation Of		8e-17
3oy3_A		284	Crystal Structure Of Abl T315i Mutant Kinase Domain		8e-17
1ol6_A		282	Structure Of Unphosphorylated D274n Mutant Of Auror		8e-17
3agm_A		351	Complex Of Pka With The Bisubstrate Protein Kinase		9e-17
2wqe_A		262	Structure Of S155r Aurora-A Somatic Mutant Length =		9e-17
3pfq_A		674	Crystal Structure And Allosteric Activation Of Prot		9e-17
3q52_A		306	Structure Of Phosphorylated Pak1 Kinase Domain Leng		9e-17
2z60_A		288	Crystal Structure Of The T315i Mutant Of Abl Kinase		9e-17
3dk3_A		293	Crystal Structure Of Mutant Abl Kinase Domain In Co		9e-17
2xne_A		272	Structure Of Aurora-A Bound To An Imidazopyrazine I		9e-17
3l9m_A		351	Crystal Structure Of Pkab3 (Pka Triple Mutant V123a		9e-17
3fxz_A		297	Crystal Structure Of Pak1 Kinase Domain With Ruthen		1e-16
1syk_A		350	Crystal Structure Of E230q Mutant Of Camp-Dependent		1e-16
2gnj_A		350	Pka Three Fold Mutant Model Of Rho-Kinase With Y-27		1e-16
2i0e_A		353	Structure Of Catalytic Domain Of Human Protein Kina		1e-16
4dg3_E		371	Crystal Structure Of R336a Mutant Of Camp-dependent		1e-16
3oxz_A		284	Crystal Structure Of Abl Kinase Domain Bound With A		1e-16
1xh9_A		350	Crystal Structures Of Protein Kinase B Selective In		1e-16
1fpu_A		293	Crystal Structure Of Abl Kinase Domain In Complex W		1e-16
4dfx_E		350	Crystal Structure Of Myristoylated K7c Catalytic Su		1e-16
2qcs_A		350	A Complex Structure Between The Catalytic And Regul		1e-16
3o7l_B		350	Crystal Structure Of Phospholamban (1-19):pka C-Sub		1e-16
2qoh_A		288	Crystal Structure Of Abl Kinase Bound With Ppy-a Le		1e-16
1l3r_E		350	Crystal Structure Of A Transition State Mimic Of Th		1e-16
2wtv_A		285	Aurora-A Inhibitor Structure Length = 285		2e-16
1zxe_A		303	Crystal Structure Of Eif2alpha Protein Kinase Gcn2:		2e-16
2hog_A		322	Crystal Structure Of Chek1 In Complex With Inhibito		2e-16
3qam_E		350	Crystal Structure Of Glu208ala Mutant Of Catalytic		2e-16
3pvb_A		345	Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca		2e-16
1ol5_A		282	Structure Of Aurora-A 122-403, Phosphorylated On Th		2e-16
2r0u_A		323	Crystal Structure Of Chek1 In Complex With Inhibito		2e-16
3qrj_A		277	The Crystal Structure Of Human Abl1 Kinase Domain T		2e-16
2v7a_A		286	Crystal Structure Of The T315i Abl Mutant In Comple		2e-16
3ha6_A		268	Crystal Structure Of Aurora A In Complex With Tpx2		2e-16
2br1_A		297	Structure-Based Design Of Novel Chk1 Inhibitors: In		2e-16
1ia8_A		289	The 1.7 A Crystal Structure Of Human Cell Cycle Che		2e-16
1zlt_A		295	Crystal Structure Of Chk1 Complexed With A Hymenald		2e-16
2w1c_A		275	Structure Determination Of Aurora Kinase In Complex		2e-16
4fsm_A		279	Crystal Structure Of The Chk1 Length = 279		2e-16
4fsn_A		278	Crystal Structure Of The Chk1 Length = 278		2e-16
3r1n_A		317	Mk3 Kinase Bound To Compound 5b Length = 317		2e-16
3fhr_A		336	High Resolution Crystal Structure Of Mitogen-Activa		2e-16
2x8e_A		276	Discovery Of A Novel Class Of Triazolones As Checkp		2e-16
2ayp_A		269	Crystal Structure Of Chk1 With An Indol Inhibitor L		2e-16
3jvr_A		271	Characterization Of The Chk1 Allosteric Inhibitor B		2e-16
4ae9_A		343	Structure And Function Of The Human Sperm-specific		2e-16
3ot3_A		273	X-Ray Crystal Structure Of Compound 22k Bound To Hu		2e-16
2e9v_A		268	Structure Of H-Chk1 Complexed With A859017 Length =		3e-16
4fsw_A		279	Crystal Structure Of The Chk1 Length = 279		3e-16
2hzi_A		277	Abl Kinase Domain In Complex With Pd180970 Length =		3e-16
3qri_A		277	The Crystal Structure Of Human Abl1 Kinase Domain I		3e-16
3dk6_A		293	Crystal Structure Of Mutant Abl Kinase Domain In Co		3e-16
1smh_A		350	Protein Kinase A Variant Complex With Completely Or		3e-16
2y0a_A		326	Structure Of Dapk1 Construct Residues 1-304 Length		3e-16
4ft3_A		279	Crystal Structure Of The Chk1 Length = 279		3e-16
2gqg_A		278	X-Ray Crystal Structure Of Dasatinib (Bms-354825) B		3e-16
2ghg_A		269	H-Chk1 Complexed With A431994 Length = 269		3e-16
2e2b_A		293	Crystal Structure Of The C-Abl Kinase Domain In Com		3e-16
3q4z_A		306	Structure Of Unphosphorylated Pak1 Kinase Domain Le		3e-16
2hiw_A		287	Crystal Structure Of Inactive Conformation Abl Kina		3e-16
2hyy_A		273	Human Abl Kinase Domain In Complex With Imatinib (S		3e-16
2hz0_A		270	Abl Kinase Domain In Complex With Nvp-Aeg082 Length		3e-16
4fst_A		269	Crystal Structure Of The Chk1 Length = 269		3e-16
2g1t_A		287	A Src-Like Inactive Conformation In The Abl Tyrosin		3e-16
1wvw_A		278	Crystal Structures Of Kinase Domain Of Dap Kinase I		3e-16
2w4j_A		277	X-Ray Structure Of A Dap-Kinase 2-277 Length = 277		3e-16
2uzt_A		336	Pka Structures Of Akt, Indazole-Pyridine Inhibitors		3e-16
2dq7_X		283	Crystal Structure Of Fyn Kinase Domain Complexed Wi		3e-16
3pyy_A		298	Discovery And Characterization Of A Cell-Permeable,		3e-16
2xzs_A		312	Death Associated Protein Kinase 1 Residues 1-312 Le		3e-16
2yak_A		285	Structure Of Death-Associated Protein Kinase 1 (Dap		3e-16
3f5u_A		295	Crystal Structure Of The Death Associated Protein K		3e-16
1ig1_A		294	1.8a X-Ray Structure Of Ternary Complex Of A Cataly		4e-16
2ya9_A		361	Crystal Structure Of The Autoinhibited Form Of Mous		4e-16
1p4f_A		293	Death Associated Protein Kinase Catalytic Domain Wi		4e-16
1ydt_E		350	Structure Of Camp-Dependent Protein Kinase, Alpha-C		4e-16
2f7e_E		351	Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu		4e-16
1svh_A		350	Crystal Structure Of Protein Kinase A In Complex Wi		4e-16
1rdq_E		350	Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of		4e-16
2xuu_A		334	Crystal Structure Of A Dap-Kinase 1 Mutant Length =		4e-16
2c1a_A		351	Structure Of Camp-Dependent Protein Kinase Complexe		4e-16
3dnd_A		350	Camp-Dependent Protein Kinase Pka Catalytic Subunit		4e-16
1stc_E		350	Camp-Dependent Protein Kinase, Alpha-Catalytic Subu		4e-16
2w4k_A		302	X-Ray Structure Of A Dap-Kinase 2-302 Length = 302		4e-16
3d5u_A		317	Crystal Structure Of A Wildtype Polo-Like Kinase 1		5e-16
1q61_A		350	Pka Triple Mutant Model Of Pkb Length = 350		5e-16
2x0g_A		334	X-ray Structure Of A Dap-kinase Calmodulin Complex		5e-16
3dfc_B		295	Crystal Structure Of A Glycine-Rich Loop Mutant Of		5e-16
1opk_A		495	Structural Basis For The Auto-Inhibition Of C-Abl T		5e-16
2y4i_C		395	Ksr2-Mek1 Heterodimer Length = 395		5e-16
2p55_A		333	X-Ray Structure Of The Human Mitogen-Activated Prot		5e-16
3tac_A		361	Crystal Structure Of The Liprin-AlphaCASK COMPLEX L		5e-16
3d5w_A		317	Crystal Structure Of A Phosphorylated Polo-Like Kin		5e-16
3zgw_A		347	Crystal Structure Of Maternal Embryonic Leucine Zip		6e-16
3c0g_A		351	Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len		6e-16
1rjb_A		344	Crystal Structure Of Flt3 Length = 344		6e-16
3enm_A		316	The Structure Of The Map2k Mek6 Reveals An Autoinhi		6e-16
1s9j_A		341	X-Ray Structure Of The Human Mitogen-Activated Prot		6e-16
1nxk_A		400	Crystal Structure Of Staurosporine Bound To Map Kap		7e-16
3uto_A		573	Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-		7e-16
3gu4_A		295	Crystal Structure Of Dapkq23v-Amppnp Length = 295		7e-16
3gu8_A		295	Crystal Structure Of Dapkl93g With N6-Cyclopentylad		8e-16
3mbl_A		328	Crystal Structure Of The Human Mitogen-Activated Pr		8e-16
3dv3_A		322	Mek1 With Pf-04622664 Bound Length = 322		8e-16
2x7f_A		326	Crystal Structure Of The Kinase Domain Of Human Tra		9e-16
1zys_A		273	Co-Crystal Structure Of Checkpoint Kinase Chk1 With		9e-16
3eqc_A		360	X-Ray Structure Of The Human Mitogen-Activated Prot		9e-16
1q24_A		350	Pka Double Mutant Model Of Pkb In Complex With Mgat		1e-15
1koa_A		491	Twitchin Kinase Fragment (C.Elegans), Autoregulated		1e-15
3d14_A		272	Crystal Structure Of Mouse Aurora A (Asn186->gly, L		1e-15
2fo0_A		495	Organization Of The Sh3-Sh2 Unit In Active And Inac		1e-15
2vo0_A		351	Structure Of Pka-Pkb Chimera Complexed With C-(4-(4		1e-15
2jdt_A		351	Structure Of Pka-Pkb Chimera Complexed With Isoquin		1e-15
2eu9_A		355	Crystal Structure Of Clk3 Length = 355		1e-15
3ll6_A		337	Crystal Structure Of The Human Cyclin G Associated		1e-15
1xh7_A		350	Crystal Structures Of Protein Kinase B Selective In		1e-15
2jds_A		351	Structure Of Camp-Dependent Protein Kinase Complexe		1e-15
2exe_A		357	Crystal Structure Of The Phosphorylated Clk3 Length		1e-15
1q8w_A		350	The Catalytic Subunit Of Camp-Dependent Protein Kin		1e-15
1opl_A		537	Structural Basis For The Auto-Inhibition Of C-Abl T		1e-15
1szm_A		350	Dual Binding Mode Of Bisindolylmaleimide 2 To Prote		2e-15
4g31_A		299	Crystal Structure Of Gsk6414 Bound To Perk (R587-R1		2e-15
3uc4_A		362	The Crystal Structure Of Snf1-Related Kinase 2.6 Le		2e-15
2wu6_A		381	Crystal Structure Of The Human Clk3 In Complex With		2e-15
3udb_A		317	Crystal Structure Of Snrk2.6 Length = 317		2e-15
3ggf_A		301	Crystal Structure Of Human SerineTHREONINE-Protein		2e-15
4fsu_A		279	Crystal Structure Of The Chk1 Length = 279		2e-15
3ujg_A		361	Crystal Structure Of Snrk2.6 In Complex With Hab1 L		2e-15
2wtk_C		305	Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2		2e-15
3daj_A		272	Crystal Structure Of Aurora A Complexed With An Inh		3e-15
1zws_A		288	Crystal Structure Of The Catalytic Domain Of Human		3e-15
1z9x_A		321	Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal		3e-15
2a27_A		321	Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal		3e-15
1wmk_A		321	Human Death-Associated Kinase Drp-1, Mutant S308d D		3e-15
3zuu_A		362	The Structure Of Ost1 (D160a, S175d) Kinase In Comp		3e-15
2a2a_A		321	High-resolution Crystallographic Analysis Of The Au		4e-15
2uvy_A		351	Structure Of Pka-pkb Chimera Complexed With Methyl-		4e-15
3uc3_A		361	The Crystal Structure Of Snf1-Related Kinase 2.3 Le		4e-15
3p1a_A		311	Structure Of Human Membrane-Associated Tyrosine- An		4e-15
4fsy_A		279	Crystal Structure Of The Chk1 Length = 279		5e-15
3cd3_A		377	Crystal Structure Of Phosphorylated Human Feline Sa		5e-15
3gvu_A		292	The Crystal Structure Of Human Abl2 In Complex With		5e-15
3orn_A		307	Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In		5e-15
2ac5_A		316	Structure Of Human Mnk2 Kinase Domain Mutant D228g		5e-15
2ydj_A		276	Discovery Of Checkpoint Kinase Inhibitor Azd7762 By		5e-15
4fsz_A		279	Crystal Structure Of The Chk1 Length = 279		6e-15
1mqb_A		333	Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro		6e-15
2j51_A		325	Crystal Structure Of Human Ste20-Like Kinase Bound		6e-15
2zv2_A		298	Crystal Structure Of Human CalciumCALMODULIN-Depend		7e-15
2rku_A		294	Structure Of Plk1 In Complex With Bi2536 Length = 2		7e-15
2vrx_A		285	Structure Of Aurora B Kinase In Complex With Zm4474		7e-15
2bfx_B		284	Mechanism Of Aurora-B Activation By Incenp And Inhi		8e-15
2bfy_A		284	Complex Of Aurora-B With Incenp And Hesperidin. Len		8e-15
3ckw_A		304	Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3		8e-15
3bkb_A		377	Crystal Structure Of Human Feline Sarcoma Viral Onc		8e-15
3sls_A		304	Crystal Structure Of Human Mek-1 Kinase In Complex		8e-15
2ou7_A		335	Structure Of The Catalytic Domain Of Human Polo-Lik		8e-15
2yac_A		311	Crystal Structure Of Polo-Like Kinase 1 In Complex		8e-15
3zhp_C		294	Human Mst3 (stk24) In Complex With Mo25beta Length		9e-15
3a7f_A		303	Human Mst3 Kinase Length = 303		9e-15
3thb_A		333	Structure Of Plk1 Kinase Domain In Complex With A B		9e-15
3kb7_A		311	Crystal Structure Of Polo-Like Kinase 1 In Complex		9e-15
2v5q_A		315	Crystal Structure Of Wild-type Plk-1 Kinase Domain		9e-15
3ckx_A		304	Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3		1e-14
3kul_A		325	Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep		1e-14
2jfm_A		325	Crystal Structure Of Human Ste20-Like Kinase (Unlig		1e-14
2jfl_A		325	Crystal Structure Of Human Ste20-Like Kinase ( Diph		1e-14
2rei_A		318	Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep		1e-14
3dak_A		290	Crystal Structure Of Domain-Swapped Osr1 Kinase Dom		1e-14
2vwi_A		303	Structure Of The Osr1 Kinase, A Hypertension Drug T		1e-14
3p23_A		432	Crystal Structure Of The Human Kinase And Rnase Dom		2e-14
2r2p_A		295	Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep		2e-14
2uv2_A		287	Crystal Structure Of Human Ste20-Like Kinase Bound		2e-14
2clq_A		295	Structure Of Mitogen-Activated Protein Kinase Kinas		2e-14
3vw6_A		269	Crystal Structure Of Human Apoptosis Signal-Regulat		2e-14
3zut_A		362	The Structure Of Ost1 (D160a) Kinase Length = 362		2e-14
3qgw_A		286	Crystal Structure Of Itk Kinase Bound To An Inhibit		2e-14
2f2u_A		402	Crystal Structure Of The Rho-Kinase Kinase Domain L		2e-14
2ogv_A		317	Crystal Structure Of The Autoinhibited Human C-Fms		2e-14
2h8h_A		535	Src Kinase In Complex With A Quinazoline Inhibitor		2e-14
2z2w_A		285	Humand Wee1 Kinase Complexed With Inhibitor Pf03357		2e-14
2in6_A		287	Wee1 Kinase Complex With Inhibitor Pd311839 Length		3e-14
1x8b_A		289	Structure Of Human Wee1a Kinase: Kinase Domain Comp		3e-14
3bi6_A		287	Wee1 Kinase Complex With Inhibitor Pd352396 Length		3e-14
4an2_A		301	Crystal Structures Of Human Mek1 With Carboxamide-B		3e-14
3dtc_A		271	Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp		3e-14
3lcd_A		329	Inhibitor Bound To A Dfg-In Structure Of The Kinase		3e-14
1fmk_A		452	Crystal Structure Of Human Tyrosine-Protein Kinase		3e-14
2qok_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y596f:		3e-14
1y57_A		452	Structure Of Unphosphorylated C-Src In Complex With		3e-14
2y6m_A		291	Crystal Structure Of Epha4 Kinase Domain Length = 2		4e-14
3miy_A		266	X-Ray Crystal Structure Of Itk Complexed With Sunit		4e-14
3g6h_A		286	Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma		4e-14
2xyu_A		285	Crystal Structure Of Epha4 Kinase Domain In Complex		4e-14
2bdf_A		279	Src Kinase In Complex With Inhibitor Ap23451 Length		4e-14
2ac3_A		316	Structure Of Human Mnk2 Kinase Domain Length = 316		4e-14
1ad5_A		438	Src Family Kinase Hck-Amp-Pnp Complex Length = 438		4e-14
1ksw_A		452	Structure Of Human C-Src Tyrosine Kinase (Thr338gly		4e-14
3sxr_A		268	Crystal Structure Of Bmx Non-Receptor Tyrosine Kina		5e-14
3dzq_A		361	Human Epha3 Kinase Domain In Complex With Inhibitor		5e-14
3dqw_A		286	C-Src Kinase Domain Thr338ile Mutant In Complex Wit		5e-14
1jpa_A		312	Crystal Structure Of Unphosphorylated Ephb2 Recepto		5e-14
2qoc_A		344	Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp		5e-14
3k54_A		283	Structures Of Human Bruton's Tyrosine Kinase In Act		5e-14
1yol_A		283	Crystal Structure Of Src Kinase Domain In Complex W		5e-14
2hk5_A		270	Hck Kinase In Complex With Lck Targetted Inhibitor		5e-14
2x4f_A		373	The Crystal Structure Of The Human Myosin Light Cha		5e-14
3u4w_A		275	Src In Complex With Dna-Templated Macrocyclic Inhib		6e-14
2qoi_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y596f:		6e-14
4hct_A		269	Crystal Structure Of Itk In Complex With Compound 5		6e-14
2qof_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y596f		6e-14
2qod_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y602f		6e-14
3fxx_A		371	Human Epha3 Kinase And Juxtamembrane Region Bound T		6e-14
2gsf_A		373	The Human Epha3 Receptor Tyrosine Kinase And Juxtam		6e-14
2oiq_A		286	Crystal Structure Of Chicken C-Src Kinase Domain In		6e-14
3v5j_A		266	Crystal Structure Of Interleukin-2 Inducible T-Cell		6e-14
3d7u_B		277	Structural Basis For The Recognition Of C-Src By It		7e-14
3svv_A		286	Crystal Structure Of T338c C-Src Covalently Bound T		7e-14
3ppz_A		309	Crystal Structure Of Ctr1 Kinase Domain In Complex		7e-14
3gen_A		283	The 1.6 A Crystal Structure Of Human Bruton's Tyros		7e-14
1sm2_A		264	Crystal Structure Of The Phosphorylated Interleukin		7e-14
2a19_B		284	Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng		7e-14
3oez_A		286	Crystal Structure Of The L317i Mutant Of The Chicke		7e-14
2xik_A		294	Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K		8e-14
1how_A		373	The X-Ray Crystal Structure Of Sky1p, An Sr Protein		8e-14
2qq7_A		286	Crystal Structure Of Drug Resistant Src Kinase Doma		8e-14
1q8y_A		373	The Structure Of The Yeast Sr Protein Kinase, Sky1p		8e-14
3pix_A		274	Crystal Structure Of Btk Kinase Domain Complexed Wi		8e-14
2qol_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y596:y		8e-14
3p08_A		267	Crystal Structure Of The Human Btk Kinase Domain Le		8e-14
1qcf_A		454	Crystal Structure Of Hck In Complex With A Src Fami		8e-14
3ocs_A		271	Crystal Structure Of Bruton's Tyrosine Kinase In Co		9e-14
3kul_B		325	Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep		9e-14
3p86_A		309	Crystal Structure Of Ctr1 Kinase Domain Mutant D676		9e-14
1k2p_A		263	Crystal Structure Of Bruton's Tyrosine Kinase Domai		9e-14
1yoj_A		283	Crystal Structure Of Src Kinase Domain Length = 283		1e-13
2hwo_A		286	Crystal Structure Of Src Kinase Domain In Complex W		1e-13
3geq_A		286	Structural Basis For The Chemical Rescue Of Src Kin		1e-13
2esm_A		415	Crystal Structure Of Rock 1 Bound To Fasudil Length		1e-13
3uiu_A		306	Crystal Structure Of Apo-Pkr Kinase Domain Length =		1e-13
3v8s_A		410	Human Rho-Associated Protein Kinase 1 (Rock 1) In C		1e-13
2pl0_A		289	Lck Bound To Imatinib Length = 289		1e-13
1qpe_A		279	Structural Analysis Of The Lymphocyte-Specific Kina		1e-13
4e4l_A		302	Jak1 Kinase (Jh1 Domain) In Complex With Compound 3		1e-13
3bys_A		277	Co-Crystal Structure Of Lck And Aminopyrimidine Ami		1e-13
2zm1_A		285	Crystal Structure Of Imidazo Pyrazin 1 Bound To The		1e-13
2ofu_A		273	X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam		1e-13
3eyg_A		290	Crystal Structures Of Jak1 And Jak2 Inhibitor Compl		1e-13
2ofv_A		277	Crystal Structure Of Aminoquinazoline 1 Bound To Lc		1e-13
3kmm_A		288	Structure Of Human Lck Kinase With A Small Molecule		1e-13
2v55_A		406	Mechanism Of Multi-site Phosphorylation From A Rock		1e-13
3lck_A		271	The Kinase Domain Of Human Lymphocyte Kinase (Lck),		1e-13
3kxz_A		287	The Complex Crystal Structure Of Lck With A Probe M		1e-13
2of2_A		271	Crystal Structure Of Furanopyrimidine 8 Bound To Lc		2e-13
3bym_A		272	X-Ray Co-Crystal Structure Aminobenzimidazole Triaz		2e-13
1yi6_A		276	C-Term Tail Segment Of Human Tyrosine Kinase (258-5		2e-13
3oct_A		265	Crystal Structure Of Bruton's Tyrosine Kinase Mutan		2e-13
2vwu_A		302	Ephb4 Kinase Domain Inhibitor Complex Length = 302		2e-13
2jam_A		304	Crystal Structure Of Human Calmodulin-Dependent Pro		2e-13
2og8_A		265	Crystal Structure Of Aminoquinazoline 36 Bound To L		2e-13
3d7t_A		269	Structural Basis For The Recognition Of C-Src By It		2e-13
1luf_A		343	Crystal Structure Of The Musk Tyrosine Kinase: Insi		2e-13
2qoo_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y596f:		2e-13
4aw5_A		291	Complex Of The Ephb4 Kinase Domain With An Oxindole		2e-13
2dyl_A		318	Crystal Structure Of Human Mitogen-Activated Protei		2e-13
1k9a_A		450	Crystal Structure Analysis Of Full-Length Carboxyl-		2e-13
1byg_A		278	Kinase Domain Of Human C-Terminal Src Kinase (Csk)		2e-13
3bea_A		333	Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P		2e-13
2w5a_A		279	Human Nek2 Kinase Adp-Bound Length = 279		2e-13
3d7u_A		263	Structural Basis For The Recognition Of C-Src By It		2e-13
1qpd_A		279	Structural Analysis Of The Lymphocyte-specific Kina		2e-13
2ptk_A		453	Chicken Src Tyrosine Kinase Length = 453		3e-13
1s9i_A		354	X-Ray Structure Of The Human Mitogen-Activated Prot		3e-13
3fpq_A		290	Crystal Structure Of The Kinase Domain Of Wnk1 Leng		3e-13
2hel_A		306	Crystal Structure Of A Mutant Epha4 Kinase Domain (		3e-13
3cly_A		334	Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase		4e-13
2pz5_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		4e-13
2hen_A		286	Crystal Structure Of The Ephb2 Receptor Kinase Doma		4e-13
2pvy_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		4e-13
2i1m_A		333	Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An		4e-13
2pzp_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		4e-13
3mpm_A		267	Lck Complexed With A Pyrazolopyrimidine Length = 26		4e-13
2qob_A		344	Human Epha3 Kinase Domain, Base Structure Length =		4e-13
2psq_A		370	Crystal Structure Of Unphosphorylated Unactivated W		4e-13
2pwl_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		5e-13
2qo7_A		373	Human Epha3 Kinase And Juxtamembrane Region, Dephos		5e-13
4aoj_A		329	Human Trka In Complex With The Inhibitor Az-23 Leng		6e-13
3t9t_A		267	Crystal Structure Of Btk Mutant (F435t,K596r) Compl		6e-13
4f0i_A		300	Crystal Structure Of Apo Trka Length = 300		6e-13
4gt5_A		306	Crystal Structure Of The Inactive Trka Kinase Domai		6e-13
3b2t_A		311	Structure Of Phosphotransferase Length = 311		6e-13
3ri1_A		313	Crystal Structure Of The Catalytic Domain Of Fgfr2		6e-13
1yxs_A		293	Crystal Structure Of Kinase Pim1 With P123m Mutatio		7e-13
1gjo_A		316	The Fgfr2 Tyrosine Kinase Domain Length = 316		7e-13
2jav_A		279	Human Kinase With Pyrrole-Indolinone Ligand Length		7e-13
4a4x_A		279	Nek2-Ede Bound To Cct248662 Length = 279		7e-13
2pzr_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		7e-13
3lco_A		324	Inhibitor Bound To A Dfg-Out Structure Of The Kinas		1e-12
4eut_A		396	Structure Of Bx-795 Complexed With Unphosphorylated		1e-12
4af3_A		292	Human Aurora B Kinase In Complex With Incenp And Vx		1e-12
3krw_A		688	Human Grk2 In Complex With Gbetgamma Subunits And B		1e-12
2pvf_A		334	Crystal Structure Of Tyrosine Phosphorylated Activa		1e-12
3cik_A		689	Human Grk2 In Complex With Gbetagamma Subunits Leng		1e-12
1omw_A		689	Crystal Structure Of The Complex Between G Protein-		1e-12
3psc_A		695	Bovine Grk2 In Complex With Gbetagamma Subunits Len		1e-12
4euu_A		319	Structure Of Bx-795 Complexed With Human Tbk1 Kinas		1e-12
2vd5_A		412	Structure Of Human Myotonic Dystrophy Protein Kinas		2e-12
2i0v_A		335	C-Fms Tyrosine Kinase In Complex With A Quinolone I		2e-12
2q0b_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		2e-12
2buj_A		317	Crystal Structure Of The Human Serine-Threonine Kin		2e-12
2py3_A		324	Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D		2e-12
1vzo_A		355	The Structure Of The N-Terminal Kinase Domain Of Ms		2e-12
4gs6_A		315	Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz		3e-12
2oo8_X		317	Synthesis, Structural Analysis, And Sar Studies Of		3e-12
4f99_A		361	Human Cdc7 Kinase In Complex With Dbf4 And Nucleoti		3e-12
3a99_A		320	Structure Of Pim-1 Kinase Crystallized In The Prese		3e-12
1fvr_A		327	Tie2 Kinase Domain Length = 327		3e-12
2xj0_A		301	Protein Kinase Pim-1 In Complex With Fragment-4 Fro		3e-12
1xqz_A		300	Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut		3e-12
3f2a_A		300	Crystal Structure Of Human Pim-1 In Complex With Da		3e-12
2eva_A		307	Structural Basis For The Interaction Of Tak1 Kinase		3e-12
3jpv_A		313	Crystal Structure Of Human Proto-Oncogene Serine Th		3e-12
2xiy_A		301	Protein Kinase Pim-1 In Complex With Fragment-2 Fro		3e-12
2bil_B		313	The Human Protein Kinase Pim1 In Complex With Its C		3e-12
1yhs_A		273	Crystal Structure Of Pim-1 Bound To Staurosporine L		3e-12
3cy3_A		314	Crystal Structure Of Human Proto-Oncogene Serine Th		3e-12
4asz_A		299	Crystal Structure Of Apo Trkb Kinase Domain Length		3e-12
2xix_A		301	Protein Kinase Pim-1 In Complex With Fragment-1 Fro		3e-12
3ma3_A		313	Crystal Structure Of Human Proto-Oncogene Serine Th		3e-12
2j2i_B		312	Crystal Structure Of The Humab Pim1 In Complex With		3e-12
3cxw_A		314	Crystal Structure Of Human Proto-Oncogene Serine Th		3e-12
1xws_A		313	Crystal Structure Of The Human Pim1 Kinase Domain L		4e-12
2bik_B		313	Human Pim1 Phosphorylated On Ser261 Length = 313		4e-12
3kga_A		299	Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe		4e-12
2obj_A		333	Crystal Structure Of Human Pim-1 Kinase In Complex		4e-12
4alv_A		328	Benzofuropyrimidinone Inhibitors Of Pim-1 Length =		4e-12
3uix_A		298	Crystal Structure Of Pim1 Kinase In Complex With Sm		4e-12
3dcv_A		328	Crystal Structure Of Human Pim1 Kinase Complexed Wi		4e-12
4fr4_A		384	Crystal Structure Of Human SerineTHREONINE-Protein		4e-12
3gqi_A		326	Crystal Structure Of Activated Receptor Tyrosine Ki		4e-12
2qon_A		373	Human Epha3 Kinase And Juxtamembrane Region, Y596f:		5e-12
3r00_A		299	The Discovery Of Novel Benzofuran-2-Carboxylic Acid		5e-12
2acx_A		576	Crystal Structure Of G Protein Coupled Receptor Kin		5e-12
1ywv_A		293	Crystal Structures Of Proto-Oncogene Kinase Pim1: A		5e-12
3pwy_A		311	Crystal Structure Of An Extender (Spd28345)-Modifie		5e-12
4aw2_A		437	Crystal Structure Of Cdc42 Binding Protein Kinase A		5e-12
3jxw_A		294	Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-		5e-12
4as0_A		273	Cyclometalated Phthalimides As Protein Kinase Inhib		5e-12
3nyn_A		576	Crystal Structure Of G Protein-Coupled Receptor Kin		5e-12
2r7b_A		312	Crystal Structure Of The Phosphoinositide-Dependent		5e-12
3c4e_A		273	Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7		5e-12
4a07_A		311	Human Pdk1 Kinase Domain In Complex With Allosteric		5e-12
4a7c_A		308	Crystal Structure Of Pim1 Kinase With Etp46546 Leng		5e-12
1irk_A		306	Crystal Structure Of The Tyrosine Kinase Domain Of		5e-12
3eta_A		317	Kinase Domain Of Insulin Receptor Complexed With A		6e-12
3hrc_A		311	Crystal Structure Of A Mutant Of Human Pdk1 Kinase		6e-12
4dtk_A		276	Novel And Selective Pan-Pim Kinase Inhibitor Length		6e-12
3qc4_A		314	Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length =		6e-12
4eqm_A		294	Structural Analysis Of Staphylococcus Aureus Serine		7e-12
3sc1_A		311	Novel Isoquinolone Pdk1 Inhibitors Discovered Throu		7e-12
3tku_A		433	Mrck Beta In Complex With Fasudil Length = 433		7e-12
3rwp_A		311	Discovery Of A Novel, Potent And Selective Inhibito		7e-12
3nax_A		311	Pdk1 In Complex With Inhibitor Mp7 Length = 311		8e-12
1h1w_A		289	High Resolution Crystal Structure Of The Human Pdk1		8e-12
2xch_A		309	Crystal Structure Of Pdk1 In Complex With A Pyrazol		8e-12
3h9o_A		311	Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1)		8e-12
1uu9_A		286	Structure Of Human Pdk1 Kinase Domain In Complex Wi		8e-12
3orx_A		316	Pdk1 Mutant Bound To Allosteric Disulfide Fragment		8e-12
3iop_A		312	Pdk-1 In Complex With The Inhibitor Compound-8i Len		8e-12
2biy_A		310	Structure Of Pdk1-S241a Mutant Kinase Domain Length		8e-12
1uu3_A		310	Structure Of Human Pdk1 Kinase Domain In Complex Wi		8e-12
1z5m_A		286	Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr		8e-12
3qfv_A		415	Mrck Beta In Complex With Tpca-1 Length = 415		8e-12
3nus_A		286	Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra		8e-12
3kxx_A		317	Structure Of The Mutant Fibroblast Growth Factor Re		9e-12
1rqq_A		306	Crystal Structure Of The Insulin Receptor Kinase In		9e-12
3rhx_B		306	Crystal Structure Of The Catalytic Domain Of Fgfr1		9e-12
3js2_A		317	Crystal Structure Of Minimal Kinase Domain Of Fibro		9e-12
3c4f_A		302	Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M		9e-12
3nun_A		292	Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea		1e-11
1fgk_A		310	Crystal Structure Of The Tyrosine Kinase Domain Of		1e-11
4f63_A		309	Crystal Structure Of Human Fibroblast Growth Factor		1e-11
3fbv_A		448	Crystal Structure Of The Oligomer Formed By The Kin		1e-11
1p14_A		306	Crystal Structure Of A Catalytic-Loop Mutant Of The		1e-11
3nay_A		311	Pdk1 In Complex With Inhibitor Mp6 Length = 311		1e-11
3sdj_A		448	Structure Of Rnase-Inactive Point Mutant Of Oligome		1e-11
3gql_A		326	Crystal Structure Of Activated Receptor Tyrosine Ki		1e-11
2wqb_A		324	Structure Of The Tie2 Kinase Domain In Complex With		1e-11
3tt0_A		382	Co-Structure Of Fibroblast Growth Factor Receptor 1		1e-11
4g3d_A		371	Crystal Structure Of Human Nf-kappab Inducing Kinas		1e-11
3t8o_A		543	Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu		1e-11
4e1z_A		291	Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda		1e-11
3ekk_A		307	Insulin Receptor Kinase Complexed With An Inhibitor		1e-11
3qc9_A		543	Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4		1e-11
4g3g_A		350	Crystal Structure Of Murine Nf-kappab Inducing Kina		1e-11
3c4w_A		543	Crystal Structure Of G Protein Coupled Receptor Kin		1e-11
3pjc_A		315	Crystal Structure Of Jak3 Complexed With A Potent A		1e-11
4g3f_A		336	Crystal Structure Of Murine Nf-kappab Inducing Kina		1e-11
3lxk_A		327	Structural And Thermodynamic Characterization Of Th		1e-11
3c4x_A		543	Crystal Structure Of G Protein Coupled Receptor Kin		1e-11
4e20_A		290	Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda		1e-11
2rio_A		434	Structure Of The Dual Enzyme Ire1 Reveals The Basis		1e-11
3v5q_A		297	Discovery Of A Selective Trk Inhibitor With Efficac		1e-11
4hvd_A		314	Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h		1e-11
2z8c_A		303	Phosphorylated Insulin Receptor Tyrosine Kinase In		2e-11
4g3c_A		352	Crystal Structure Of Apo Murine Nf-kappab Inducing		2e-11
1ir3_A		306	Phosphorylated Insulin Receptor Tyrosine Kinase In		2e-11
3lj0_A		434	Ire1 Complexed With Adp And Quercetin Length = 434		2e-11
1i44_A		306	Crystallographic Studies Of An Activation Loop Muta		2e-11
2xck_A		309	Crystal Structure Of Pdk1 In Complex With A Pyrazol		2e-11
1tki_A		321	Autoinhibited Serine Kinase Domain Of The Giant Mus		2e-11
4dn5_A		356	Crystal Structure Of Nf-kb-inducing Kinase (nik) Le		4e-11
3ugc_A		295	Structural Basis Of Jak2 Inhibition By The Type Ii		5e-11
4bbe_A		298	Aminoalkylpyrimidine Inhibitor Complexes With Jak2		6e-11
3nyx_A		302	Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T		6e-11
4hge_A		300	Jak2 Kinase (Jh1 Domain) In Complex With Compound 8		7e-11
1t46_A		313	Structural Basis For The Autoinhibition And Sti-571		7e-11
1pkg_A		329	Structure Of A C-kit Kinase Product Complex Length		7e-11
3nz0_A		302	Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3		7e-11
3jy9_A		311	Janus Kinase 2 Inhibitors Length = 311		7e-11
2w1i_A		326	Structure Determination Of Aurora Kinase In Complex		7e-11
3tjc_A		298	Co-Crystal Structure Of Jak2 With Thienopyridine 8		7e-11
4e4m_A		302	Jak2 Kinase (Jh1 Domain) In Complex With Compound 3		7e-11
3io7_A		313	2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel		7e-11
3e62_A		293	Fragment Based Discovery Of Jak-2 Inhibitors Length		7e-11
2b7a_A		293	The Structural Basis Of Janus Kinase 2 Inhibition B		8e-11
3lpb_A		295	Crystal Structure Of Jak2 Complexed With A Potent 2		8e-11
4aqc_A		301	Triazolopyridine-Based Inhibitor Of Janus Kinase 2		8e-11
3rvg_A		303	Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido		8e-11
3q32_A		301	Structure Of Janus Kinase 2 With A Pyrrolotriazine		8e-11
1t45_A		331	Structural Basis For The Autoinhibition And Sti-571		9e-11
3g0e_A		336	Kit Kinase Domain In Complex With Sunitinib Length		9e-11
2xa4_A		298	Inhibitors Of Jak2 Kinase Domain Length = 298		9e-11
1u59_A		287	Crystal Structure Of The Zap-70 Kinase Domain In Co		1e-10
3g0f_A		336	Kit Kinase Domain Mutant D816h In Complex With Suni		1e-10
1yvj_A		290	Crystal Structure Of The Jak3 Kinase Domain In Comp		1e-10
2qkw_B		321	Structural Basis For Activation Of Plant Immunity B		2e-10
2ozo_A		613	Autoinhibited Intact Human Zap-70 Length = 613		2e-10
4alu_A		328	Benzofuropyrimidinone Inhibitors Of Pim-1 Length =		2e-10
4fk3_A		292	B-Raf Kinase V600e Oncogenic Mutant In Complex With		2e-10
3f69_A		311	Crystal Structure Of The Mycobacterium Tuberculosis		2e-10
2iwi_A		312	Crystal Structure Of The Human Pim2 In Complex With		2e-10
4e6d_A		298	Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W		2e-10
3lxn_A		318	Structural And Thermodynamic Characterization Of Th		2e-10
3og7_A		289	B-Raf Kinase V600e Oncogenic Mutant In Complex With		2e-10
3ori_A		311	Mycobacterium Tuberculosis Pknb Kinase Domain L33d		3e-10
3c4c_A		280	B-Raf Kinase In Complex With Plx4720 Length = 280		3e-10
3qd2_B		332	Crsytal Structure Of Mouse Perk Kinase Domain Lengt		4e-10
3f61_A		311	Crystal Structure Of M. Tuberculosis Pknb Leu33aspV		4e-10
2x9e_A		317	Human Mps1 In Complex With Nms-P715 Length = 317		5e-10
1uwj_A		276	The Complex Of Mutant V599e B-raf And Bay439006 Len		5e-10
3vqu_A		320	Crystal Structure Of Human Mps1 Catalytic Domain In		5e-10
1mru_A		311	Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob		6e-10
3idp_A		300	B-Raf V600e Kinase Domain In Complex With An Aminoi		6e-10
3cek_A		313	Crystal Structure Of Human Dual Specificity Protein		6e-10
3dbq_A		343	Crystal Structure Of Ttk Kinase Domain Length = 343		6e-10
4g9r_A		307	B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr		7e-10
1o6y_A		299	Catalytic Domain Of Pknb Kinase From Mycobacterium		7e-10
3hmn_A		342	Crystal Structure Of Human Mps1 Catalytic Domain In		8e-10
2zmc_A		390	Crystal Structure Of Human Mitotic Checkpoint Kinas		8e-10
3zzw_A		289	Crystal Structure Of The Kinase Domain Of Ror2 Leng		8e-10
3omv_A		307	Crystal Structure Of C-Raf (Raf-1) Length = 307		9e-10
3s95_A		310	Crystal Structure Of The Human Limk1 Kinase Domain		9e-10
3dls_A		335	Crystal Structure Of Human Pas Kinase Bound To Adp		9e-10
4gt4_A		308	Structure Of Unliganded, Inactive Ror2 Kinase Domai		9e-10
3q96_A		282	B-Raf Kinase Domain In Complex With A Tetrahydronap		1e-09
4dbn_A		284	Crystal Structure Of The Kinase Domain Of Human B-R		1e-09
1u54_A		291	Crystal Structures Of The Phosphorylated And Unphos		1e-09
2fb8_A		281	Structure Of The B-Raf Kinase Domain Bound To Sb-59		1e-09
4hzs_A		341	Crystal Structure Of Ack1 Kinase Domain With C-term		1e-09
4ewh_B		275	Co-Crystal Structure Of Ack1 With Inhibitor Length		1e-09
3hgk_A		327	Crystal Structure Of Effect Protein Avrptob Complex		1e-09
4h58_A		275	Braf In Complex With Compound 3 Length = 275		1e-09
1u46_A		291	Crystal Structure Of The Unphosphorylated Kinase Do		1e-09
3orm_A		311	Mycobacterium Tuberculosis Pknb Kinase Domain D76a		1e-09
3eqp_B		276	Crystal Structure Of Ack1 With Compound T95 Length		1e-09
4hzr_A		277	Crystal Structure Of Ack1 Kinase Domain Length = 27		1e-09
3ii5_A		306	The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi		1e-09
4id7_A		273	Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-		1e-09
1uwh_A		276	The Complex Of Wild Type B-Raf And Bay439006 Length		2e-09
3d4q_A		307	Pyrazole-Based Inhibitors Of B-Raf Kinase Length =		2e-09
3h9f_A		313	Crystal Structure Of Human Dual Specificity Protein		2e-09
2oh4_A		316	Crystal Structure Of Vegfr2 With A Benzimidazole-Ur		2e-09
2ivv_A		314	Crystal Structure Of Phosphorylated Ret Tyrosine Ki		2e-09
3c7q_A		316	Structure Of Vegfr2 Kinase Domain In Complex With B		2e-09
3cjg_A		309	Crystal Structure Of Vegfr2 In Complex With A 3,4,5		3e-09
3cjf_A		309	Crystal Structure Of Vegfr2 In Complex With A 3,4,5		3e-09
2zmd_A		390	Crystal Structure Of Human Mps1 Catalytic Domain T6		3e-09
1p4o_A		322	Structure Of Apo Unactivated Igf-1r Kinase Domain A		3e-09
2ivt_A		314	Crystal Structure Of Phosphorylated Ret Tyrosine Ki		3e-09
2p2i_A		314	Crystal Structure Of The Vegfr2 Kinase Domain In Co		3e-09
3vnt_A		318	Crystal Structure Of The Kinase Domain Of Human Veg		3e-09
1ywn_A		316	Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p		3e-09
1vr2_A		316	Human Vascular Endothelial Growth Factor Receptor 2		3e-09
4agc_A		353	Crystal Structure Of Vegfr2 (Juxtamembrane And Kina		4e-09
2xir_A		316	Crystal Structure Of The Vegfr2 Kinase Domain In Co		4e-09
2jkm_A		276	Focal Adhesion Kinase Catalytic Domain In Complex W		4e-09
3lw0_A		304	Igf-1rk In Complex With Ligand Msc1609119a-1 Length		4e-09
1mp8_A		281	Crystal Structure Of Focal Adhesion Kinase (Fak) Le		4e-09
2pzi_A		681	Crystal Structure Of Protein Kinase Pkng From Mycob		4e-09
3qup_A		323	Inhibitor Bound Structure Of The Kinase Domain Of T		4e-09
2j0l_A		276	Crystal Structure Of A The Active Conformation Of T		4e-09
4ebw_A		304	Structure Of Focal Adhesion Kinase Catalytic Domain		4e-09
2ivs_A		314	Crystal Structure Of Non-Phosphorylated Ret Tyrosin		4e-09
2p2h_A		314	Crystal Structure Of The Vegfr2 Kinase Domain In Co		4e-09
3u6j_A		314	Crystal Structure Of The Vegfr2 Kinase Domain In Co		4e-09
3ewh_A		314	Crystal Structure Of The Vegfr2 Kinase Domain In Co		5e-09
2etm_A		281	Crystal Structure Of Focal Adhesion Kinase Domain C		5e-09
2j0m_B		276	Crystal Structure A Two-Chain Complex Between The F		5e-09
1m7n_A		322	Crystal Structure Of Unactivated Apo Insulin-Like G		5e-09
3bz3_A		276	Crystal Structure Analysis Of Focal Adhesion Kinase		5e-09
3pxk_A		282	Focal Adhesion Kinase Catalytic Domain In Complex W		5e-09
2jkk_A		276	Focal Adhesion Kinase Catalytic Domain In Complex W		5e-09
2oj9_A		307	Structure Of Igf-1r Kinase Domain Complexed With A		6e-09
3i81_A		315	Crystal Structure Of Insulin-Like Growth Factor 1 R		6e-09
3o23_A		305	Human Unphosphorylated Igf1-R Kinase Domain In Comp		6e-09
3qqu_A		301	Cocrystal Structure Of Unphosphorylated Igf With Py		7e-09
1jqh_A		308	Igf-1 Receptor Kinase Domain Length = 308		7e-09
3lvp_A		336	Crystal Structure Of Bisphosphorylated Igf1-R Kinas		8e-09
4h1j_A		293	Crystal Structure Of Pyk2 With The Pyrazole 13a Len		9e-09
2j0j_A		656	Crystal Structure Of A Fragment Of Focal Adhesion K		1e-08
3fzo_A		277	Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin		1e-08
3cc6_A		281	Crystal Structure Of Kinase Domain Of Protein Tyros		1e-08
2j0k_A		656	Crystal Structure Of A Fragment Of Focal Adhesion K		1e-08
3d94_A		301	Crystal Structure Of The Insulin-Like Growth Factor		1e-08
2jiv_A		328	Crystal Structure Of Egfr Kinase Domain T790m Mutat		1e-08
4fnw_A		327	Crystal Structure Of The Apo F1174l Anaplastic Lymp		2e-08
2yjr_A		342	Structure Of F1174l Mutant Anaplastic Lymphoma Kina		2e-08
3beg_A		381	Crystal Structure Of Sr Protein Kinase 1 Complexed		2e-08
1k3a_A		299	Structure Of The Insulin-Like Growth Factor 1 Recep		2e-08
2zm3_A		308	Complex Structure Of Insulin-Like Growth Factor Rec		2e-08
2j5e_A		327	Crystal Structure Of Egfr Kinase Domain In Complex		2e-08
3ika_A		331	Crystal Structure Of Egfr 696-1022 T790m Mutant Cov		2e-08
2jiu_A		328	Crystal Structure Of Egfr Kinase Domain T790m Mutat		2e-08
2jit_A		327	Crystal Structure Of Egfr Kinase Domain T790m Mutat		2e-08
3ug1_A		334	Crystal Structure Of The Mutated Egfr Kinase Domain		2e-08
4i24_A		329	Structure Of T790m Egfr Kinase Domain Co-crystalliz		2e-08
2rfd_A		324	Crystal Structure Of The Complex Between The Egfr K		2e-08
1m14_A		333	Tyrosine Kinase Domain From Epidermal Growth Factor		2e-08
4g5p_A		330	Crystal Structure Of Egfr Kinase T790m In Complex W		2e-08
1wbp_A		397	Srpk1 Bound To 9mer Docking Motif Peptide Length =		2e-08
2xb7_A		315	Structure Of Human Anaplastic Lymphoma Kinase In Co		3e-08
3lzb_A		327	Egfr Kinase Domain Complexed With An Imidazo[2,1-B]		3e-08
2eb2_A		334	Crystal Structure Of Mutated Egfr Kinase Domain (G7		3e-08
2j5f_A		327	Crystal Structure Of Egfr Kinase Domain In Complex		3e-08
3vjo_A		334	Crystal Structure Of The Wild-Type Egfr Kinase Doma		3e-08
2xp2_A		327	Structure Of The Human Anaplastic Lymphoma Kinase I		3e-08
4i23_A		329	Crystal Structure Of The Wild-type Egfr Kinase Doma		3e-08
3gni_B		389	Structure Of Strad And Mo25 Length = 389		3e-08
2itn_A		327	Crystal Structure Of Egfr Kinase Domain G719s Mutat		3e-08
4fnz_A		327	Crystal Structure Of Human Anaplastic Lymphoma Kina		3e-08
2gs2_A		330	Crystal Structure Of The Active Egfr Kinase Domain		3e-08
3bel_A		315	X-Ray Structure Of Egfr In Complex With Oxime Inhib		3e-08
4g5j_A		330	Crystal Structure Of Egfr Kinase In Complex With Bi		3e-08
2yfx_A		327	Structure Of L1196m Mutant Anaplastic Lymphoma Kina		3e-08
2gs7_A		330	Crystal Structure Of The Inactive Egfr Kinase Domai		3e-08
3aox_A		344	X-Ray Crystal Structure Of Human Anaplastic Lymphom		3e-08
4fnx_A		327	Crystal Structure Of The Apo R1275q Anaplastic Lymp		3e-08
2wtk_B		373	Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2		3e-08
1xkk_A		352	Egfr Kinase Domain Complexed With A Quinazoline Inh		3e-08

>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299