Citrus Sinensis ID: 044181


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MKRAFQESSELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHGNEKLSDLSGLSDKAPLVKKANSRGGLCLDLNLTPYENDLETFRLGNKVDSLVNLELCA
ccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccc
ccccccccccccHHHHHHHHHHHHHccccccccccccccccccEEEEcccccccccHHHcccccccccccccccccccccccccccccccEEccccccEcccccccccccHHccccccccccccccccccccccccccccccccEEEEEcccccccccHHHEEcccEEEccccccccc
mkrafqesseldhsLNMANCLMFlshgrgfnavngvntMAAGRAFecktcnrqfpsfqalgghrashkkprftdgnggvdmqqlpikpkthecsvcglEFAIGQALGghmrrhraaglhgneklsdlsglsdkaplvkkansrgglcldlnltpyendletfrlgnkvdSLVNLELCA
MKRAFQESSELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFqalgghrashKKPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHgneklsdlsglsDKAPLVKKansrgglcldlNLTPYENDLEtfrlgnkvdslvnlelca
MKRAFQESSELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHGNEKLSDLSGLSDKAPLVKKANSRGGLCLDLNLTPYENDLETFRLGNKVDSLVNLELCA
**************LNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQAL*************************IKPKTHECSVCGLEFAIGQALGGHMRR******************************RGGLCLDLNLTPYENDLETFRLGNKVDSLVNLE***
******************NCLM*************************KTCNRQFP***********************************HECSVCGLEFAIGQALGGHMRR***********************************LDLNLTPYENDLE***********V*LE***
***********DHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQA*********KPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHGNEKLSDLSGLSDKAPLVKKANSRGGLCLDLNLTPYENDLETFRLGNKVDSLVNLELCA
************HSLNMANCLMFLSHG**************GRAFECKTCNRQFPSFQAL*****************************THECSVCGLEFAIGQAL************************************RGGLCLDLNLTPYENDLETFRLGNKVDSLVNLELC*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRAFQESSELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHGNEKLSDLSGLSDKAPLVKKANSRGGLCLDLNLTPYENDLETFRLGNKVDSLVNLELCA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q9SLD4178 Zinc finger protein ZAT11 yes no 0.865 0.865 0.437 1e-26
Q42410162 Zinc finger protein ZAT12 no no 0.859 0.944 0.426 1e-21
Q681X4286 Zinc finger protein ZAT5 no no 0.747 0.465 0.338 9e-20
Q42453168 Zinc finger protein ZAT7 no no 0.764 0.809 0.404 2e-18
Q9LX85164 Zinc finger protein ZAT8 no no 0.719 0.780 0.413 2e-16
Q9SSW0193 Zinc finger protein AZF3 no no 0.640 0.590 0.398 4e-14
Q9M202288 Zinc finger protein ZAT9 no no 0.724 0.447 0.329 9e-14
Q39092267 Zinc finger protein ZAT1 no no 0.415 0.277 0.493 3e-12
O65499284 Zinc finger protein ZAT3 no no 0.679 0.426 0.347 2e-11
Q9SIJ0270 Zinc finger protein ZAT2 no no 0.758 0.5 0.300 8e-11
>sp|Q9SLD4|ZAT11_ARATH Zinc finger protein ZAT11 OS=Arabidopsis thaliana GN=ZAT11 PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 98/167 (58%), Gaps = 13/167 (7%)

Query: 1   MKRAFQESSELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRA---FECKTCNRQFPSF 57
           MKR   +  E   ++++A CLM L+       + G+N          FECKTCN++F SF
Sbjct: 1   MKRERSDFEESLKNIDIAKCLMILAQTSMVKQI-GLNQHTESHTSNQFECKTCNKRFSSF 59

Query: 58  QALGGHRASHKKPRFTDGNGGVDMQQLPIKPK---THECSVCGLEFAIGQALGGHMRRHR 114
           QALGGHRASHKKP+ T      D++ L    K    H+CS+C   F  GQALGGHMRRHR
Sbjct: 60  QALGGHRASHKKPKLTVEQK--DVKHLSNDYKGNHFHKCSICSQSFGTGQALGGHMRRHR 117

Query: 115 AAGLHGNEKLSDLSGLSDKAPLVKK-ANSRGGLCLDLNLTPYENDLE 160
           ++      + S +S +    P++K+  +S+  L LDLNLTP ENDLE
Sbjct: 118 SS---MTVEPSFISPMIPSMPVLKRCGSSKRILSLDLNLTPLENDLE 161




Probable transcription factor that may be involved in stress responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42410|ZAT12_ARATH Zinc finger protein ZAT12 OS=Arabidopsis thaliana GN=ZAT12 PE=2 SV=1 Back     alignment and function description
>sp|Q681X4|ZAT5_ARATH Zinc finger protein ZAT5 OS=Arabidopsis thaliana GN=ZAT5 PE=2 SV=1 Back     alignment and function description
>sp|Q42453|ZAT7_ARATH Zinc finger protein ZAT7 OS=Arabidopsis thaliana GN=ZAT7 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX85|ZAT8_ARATH Zinc finger protein ZAT8 OS=Arabidopsis thaliana GN=ZAT8 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW0|AZF3_ARATH Zinc finger protein AZF3 OS=Arabidopsis thaliana GN=AZF3 PE=1 SV=1 Back     alignment and function description
>sp|Q9M202|ZAT9_ARATH Zinc finger protein ZAT9 OS=Arabidopsis thaliana GN=ZAT9 PE=2 SV=1 Back     alignment and function description
>sp|Q39092|ZAT1_ARATH Zinc finger protein ZAT1 OS=Arabidopsis thaliana GN=ZAT1 PE=2 SV=1 Back     alignment and function description
>sp|O65499|ZAT3_ARATH Zinc finger protein ZAT3 OS=Arabidopsis thaliana GN=ZAT3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIJ0|ZAT2_ARATH Zinc finger protein ZAT2 OS=Arabidopsis thaliana GN=ZAT2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
255575128190 nucleic acid binding protein, putative [ 0.915 0.857 0.598 3e-51
224112835179 predicted protein [Populus trichocarpa] 0.910 0.905 0.609 2e-48
224098312177 predicted protein [Populus trichocarpa] 0.915 0.920 0.603 2e-47
225449611176 PREDICTED: zinc finger protein ZAT12-lik 0.870 0.880 0.590 2e-45
356568969175 PREDICTED: zinc finger protein ZAT11-lik 0.893 0.908 0.592 4e-42
351723355180 uncharacterized protein LOC100500371 [Gl 0.898 0.888 0.561 6e-41
373839318178 Cys2/His2-type zinc finger protein [Chry 0.926 0.926 0.543 3e-40
388502156180 unknown [Lotus japonicus] 0.893 0.883 0.559 2e-39
388506426180 unknown [Lotus japonicus] 0.904 0.894 0.548 2e-39
2346978166 ZPT2-14 [Petunia x hybrida] 0.831 0.891 0.556 8e-39
>gi|255575128|ref|XP_002528469.1| nucleic acid binding protein, putative [Ricinus communis] gi|223532145|gb|EEF33952.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/182 (59%), Positives = 129/182 (70%), Gaps = 19/182 (10%)

Query: 1   MKRAFQESSELDHSLNMANCLMFLSHGR------GFNAVNGVNTMAAGRAFECKTCNRQF 54
           MKR+F+E+ E+D SL+MANCLM LS GR       F A+ G N  ++ R FECKTCNRQF
Sbjct: 1   MKRSFREA-EID-SLSMANCLMLLSQGREIVSFPSFEAMKGTNINSSNRVFECKTCNRQF 58

Query: 55  PSFQALGGHRASHKKPRFTDGN-GGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRH 113
           PSFQALGGHRASHKKPR T+G+ G ++ Q  P KPKTHECS+CGLEFAIGQALGGHMRRH
Sbjct: 59  PSFQALGGHRASHKKPRLTNGDVGSLETQSSPAKPKTHECSICGLEFAIGQALGGHMRRH 118

Query: 114 RAAG----------LHGNEKLSDLSGLSDKAPLVKKANSRGGLCLDLNLTPYENDLETFR 163
           RA               + +L  +       P++KK+NSR  LCLDLNLTPYEND+E FR
Sbjct: 119 RAINNDSSSLSTPSPTSSAELMAVKPAGVAPPVMKKSNSRRVLCLDLNLTPYENDVELFR 178

Query: 164 LG 165
           LG
Sbjct: 179 LG 180




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224112835|ref|XP_002316305.1| predicted protein [Populus trichocarpa] gi|222865345|gb|EEF02476.1| predicted protein [Populus trichocarpa] gi|355477194|gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098312|ref|XP_002311150.1| predicted protein [Populus trichocarpa] gi|222850970|gb|EEE88517.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225449611|ref|XP_002284111.1| PREDICTED: zinc finger protein ZAT12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356568969|ref|XP_003552680.1| PREDICTED: zinc finger protein ZAT11-like [Glycine max] Back     alignment and taxonomy information
>gi|351723355|ref|NP_001237020.1| uncharacterized protein LOC100500371 [Glycine max] gi|255630149|gb|ACU15428.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|373839318|gb|AEY76110.1| Cys2/His2-type zinc finger protein [Chrysanthemum x morifolium] Back     alignment and taxonomy information
>gi|388502156|gb|AFK39144.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388506426|gb|AFK41279.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|2346978|dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
TAIR|locus:2054548156 AT2G28710 "AT2G28710" [Arabido 0.797 0.910 0.456 4.4e-29
TAIR|locus:2049811178 ZAT11 "AT2G37430" [Arabidopsis 0.876 0.876 0.436 5.7e-27
TAIR|locus:2168073162 RHL41 "AT5G59820" [Arabidopsis 0.859 0.944 0.426 8.7e-24
TAIR|locus:2179924362 AT5G04390 "AT5G04390" [Arabido 0.370 0.182 0.457 4.3e-23
TAIR|locus:2084046175 AT3G53600 "AT3G53600" [Arabido 0.842 0.857 0.397 7.8e-23
TAIR|locus:2075865398 AT3G10470 "AT3G10470" [Arabido 0.398 0.178 0.432 7.9e-23
TAIR|locus:2046153286 AT2G28200 "AT2G28200" [Arabido 0.151 0.094 0.888 1.1e-20
TAIR|locus:2142674292 AT5G03510 "AT5G03510" [Arabido 0.404 0.246 0.44 2.3e-20
TAIR|locus:2075261170 AT3G46070 "AT3G46070" [Arabido 0.831 0.870 0.408 4.4e-20
TAIR|locus:2075291168 ZAT7 "AT3G46090" [Arabidopsis 0.752 0.797 0.433 9.2e-20
TAIR|locus:2054548 AT2G28710 "AT2G28710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 4.4e-29, P = 4.4e-29
 Identities = 74/162 (45%), Positives = 98/162 (60%)

Query:     9 SELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQALGGHRASHK 68
             S+++   NMANCL+ LS        N   +    R F CKTCN++FPSFQALGGHRASH+
Sbjct:     6 SDMEMINNMANCLILLSKAHQ----NDTKS----RVFACKTCNKEFPSFQALGGHRASHR 57

Query:    69 KPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRA-AGLHGNEKLSDL 127
             +    +G+     ++  +KP  HEC +CG EFA+GQALGGHMR+HR  +G  G   L+  
Sbjct:    58 RSAALEGHAPPSPKR--VKPVKHECPICGAEFAVGQALGGHMRKHRGGSGGGGGRSLAPA 115

Query:   128 SGLSDKAPL-VKKANSRGG---LCLDLNLTPYENDLETFRLG 165
             +     AP+ +KK+    G   LCLDLNLTP EN+     LG
Sbjct:   116 T-----APVTMKKSGGGNGKRVLCLDLNLTPLENEDLKLELG 152




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2049811 ZAT11 "AT2G37430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168073 RHL41 "AT5G59820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179924 AT5G04390 "AT5G04390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084046 AT3G53600 "AT3G53600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075865 AT3G10470 "AT3G10470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046153 AT2G28200 "AT2G28200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142674 AT5G03510 "AT5G03510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075261 AT3G46070 "AT3G46070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075291 ZAT7 "AT3G46090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SLD4ZAT11_ARATHNo assigned EC number0.43710.86510.8651yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0022029401
hypothetical protein (179 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 4e-06
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 5e-04
>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information
 Score = 41.4 bits (98), Expect = 4e-06
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 45 FECKTCNRQFPSFQALGGHRASHKKP 70
            C  C + F S QALGGH+ SH   
Sbjct: 2  HTCGVCGKTFSSLQALGGHKKSHCSL 27


Length = 27

>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.91
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.87
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.7
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.68
KOG3576267 consensus Ovo and related transcription factors [T 99.56
KOG3608467 consensus Zn finger proteins [General function pre 99.55
KOG3576267 consensus Ovo and related transcription factors [T 99.49
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.43
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.41
PHA00733128 hypothetical protein 99.38
KOG3608467 consensus Zn finger proteins [General function pre 99.07
PHA0276855 hypothetical protein; Provisional 99.02
PHA0276855 hypothetical protein; Provisional 98.96
KOG3993500 consensus Transcription factor (contains Zn finger 98.79
PHA00733128 hypothetical protein 98.72
PLN03086567 PRLI-interacting factor K; Provisional 98.65
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.6
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.57
PLN03086567 PRLI-interacting factor K; Provisional 98.55
PHA0061644 hypothetical protein 98.48
KOG3993500 consensus Transcription factor (contains Zn finger 98.47
PHA0073279 hypothetical protein 98.43
PHA0061644 hypothetical protein 98.23
PHA0073279 hypothetical protein 98.07
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.05
COG5189423 SFP1 Putative transcriptional repressor regulating 98.0
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.95
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.76
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.59
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.49
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.44
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.41
smart0035526 ZnF_C2H2 zinc finger. 97.35
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.35
smart0035526 ZnF_C2H2 zinc finger. 97.1
COG5189423 SFP1 Putative transcriptional repressor regulating 97.05
PRK04860160 hypothetical protein; Provisional 96.77
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.75
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.7
PRK04860160 hypothetical protein; Provisional 96.65
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.64
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.51
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.23
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.05
KOG1146 1406 consensus Homeobox protein [General function predi 95.67
COG5048467 FOG: Zn-finger [General function prediction only] 95.6
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.59
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.33
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.29
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.99
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.36
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.91
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.31
COG5048467 FOG: Zn-finger [General function prediction only] 92.74
KOG11461406 consensus Homeobox protein [General function predi 92.68
KOG2893 341 consensus Zn finger protein [General function pred 91.66
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.75
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.45
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.33
COG5236 493 Uncharacterized conserved protein, contains RING Z 82.98
COG404965 Uncharacterized protein containing archaeal-type C 80.82
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.91  E-value=3.1e-25  Score=167.50  Aligned_cols=116  Identities=22%  Similarity=0.308  Sum_probs=107.5

Q ss_pred             CcccchhhhHHHhcCCCCCCcccccccCC---CCCceecCcCCCcCCChHHHHHHHHhcCCCCCCCCCCC--------cc
Q 044181           12 DHSLNMANCLMFLSHGRGFNAVNGVNTMA---AGRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGNGG--------VD   80 (178)
Q Consensus        12 ~~~~~C~~C~~~f~~~~~l~~~~h~~~H~---~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~c~~--------~~   80 (178)
                      ...|.|..|||.+++..+|.  +|..+|-   ..+.+.|++|||.|.+...|+.|+++|+-.-.|..|++        ..
T Consensus       128 ~~r~~c~eCgk~ysT~snLs--rHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLS--RHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccc--hhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhc
Confidence            57899999999999999996  8999986   46789999999999999999999999997777999987        78


Q ss_pred             ccccCCCCCCCcCCcccccCCCchHHHHHHhhhccCCCCCCCCcccCcC
Q 044181           81 MQQLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHGNEKLSDLSG  129 (178)
Q Consensus        81 h~~~h~~~k~~~C~~Cgk~F~~~~~L~~H~~~H~~~~~~~~~~~~~~~~  129 (178)
                      |+++|+|||||.|..|+|.|+..++|+.||++|.+.|.|.|..+...++
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFs  254 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFA  254 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHH
Confidence            9999999999999999999999999999999999999999998876554



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 1e-10
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 8e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 53.2 bits (128), Expect = 1e-10
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 43 RAFECKTCNRQFPSFQALGGHRASHKKPR 71
          R++ C  C R+F S QALGGH   H++ R
Sbjct: 5  RSYTCSFCKREFRSAQALGGHMNVHRRDR 33


>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.9
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.9
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.83
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.82
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.82
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.82
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.81
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.81
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.8
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.79
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.75
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.74
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.74
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.73
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.71
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.71
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.7
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.7
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.69
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.69
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.68
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.68
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.68
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.67
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.66
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.64
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.64
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.62
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.62
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.58
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.57
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.56
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.56
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.55
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.55
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.55
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.54
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.54
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.54
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.53
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.53
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.53
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.52
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.52
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.52
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.5
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.48
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.47
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.46
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.45
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.45
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.45
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.45
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.44
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.44
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.44
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.43
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.43
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.43
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.43
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.42
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.42
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.42
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.41
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.4
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.39
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.38
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.37
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.36
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.35
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.35
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.34
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.34
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.34
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.34
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.34
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.33
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.33
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.33
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.32
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.32
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.32
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.31
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.31
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.31
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.31
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.3
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.28
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.28
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.28
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.28
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.26
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.26
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.26
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.25
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.25
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.24
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.23
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.22
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.21
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.21
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.2
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.19
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.18
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.17
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.15
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.13
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.13
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.11
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.1
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.07
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.06
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.05
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.04
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.01
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.98
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.97
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.97
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.92
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.9
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.89
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.88
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.85
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.82
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.76
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.76
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.76
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.74
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.72
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.71
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.71
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.7
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.68
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.68
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.64
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.64
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.64
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.63
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.62
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.6
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.58
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.58
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.56
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.56
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.56
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.97
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.96
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.54
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.53
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.53
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.51
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.5
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.5
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.49
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.49
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.46
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.46
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.46
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.8
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.42
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.42
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.39
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.39
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.39
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.72
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.72
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.31
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.6
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.23
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.11
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.63
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.15
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.05
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.76
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.44
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.01
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.16
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.72
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.03
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 84.52
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 83.69
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 82.41
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 80.98
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 80.88
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.91  E-value=3e-26  Score=160.08  Aligned_cols=98  Identities=15%  Similarity=0.248  Sum_probs=89.6

Q ss_pred             ccccccCCCCcccchhhhHHHhcCCCCCCcccccccCCCCCceecCcCCCcCCChHHHHHHHHhcCCCCCCCCCCCcccc
Q 044181            3 RAFQESSELDHSLNMANCLMFLSHGRGFNAVNGVNTMAAGRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGNGGVDMQ   82 (178)
Q Consensus         3 r~~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~h~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~c~~~~h~   82 (178)
                      .|...|.| +++|.|.+|++.|.+...|.  .|+++|++++||.|++|++.|...+.|..|+++|+              
T Consensus        12 h~~~~h~G-ek~y~C~~C~k~F~~~~~L~--~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~--------------   74 (133)
T 2lt7_A           12 HYELIVDG-RVYYICIVCKRSYVCLTSLR--RHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHT--------------   74 (133)
T ss_dssp             EEEEEETT-EEEEEETTTCCEESCHHHHH--HHHHHHHCCSCEECSSSSCEESSHHHHHHHHHHHH--------------
T ss_pred             hceeecCC-CcCeECCCCCCCcCCHHHHH--HHHHHcCCCCCeeCCccCeecccccchhhhccccC--------------
Confidence            45567767 99999999999999999995  99999999999999999999999999999999987              


Q ss_pred             ccCCCCCCCcCCcccccCCCchHHHHHHhhhccCCCCCC
Q 044181           83 QLPIKPKTHECSVCGLEFAIGQALGGHMRRHRAAGLHGN  121 (178)
Q Consensus        83 ~~h~~~k~~~C~~Cgk~F~~~~~L~~H~~~H~~~~~~~~  121 (178)
                          |++||.|++||+.|.+.+.|..|+++|++++|+.+
T Consensus        75 ----~~k~~~C~~C~k~F~~~~~L~~H~~~hh~~~p~~~  109 (133)
T 2lt7_A           75 ----GERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD  109 (133)
T ss_dssp             ----TCCCEEESSSCCEESSHHHHHHHHHHHTCCCTTSS
T ss_pred             ----CCccccCCCCCCCcCCHHHHHHHhHHhcCCCCCCC
Confidence                68999999999999999999999999988876544



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 5e-12
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 1e-10
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 55.5 bits (134), Expect = 5e-12
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 43 RAFECKTCNRQFPSFQALGGHRASHKKPR 71
          R++ C  C R+F S QALGGH   H++ R
Sbjct: 4  RSYTCSFCKREFRSAQALGGHMNVHRRDR 32


>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.74
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.68
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.55
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.54
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.48
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.46
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.44
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.43
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.43
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.41
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.34
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.32
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.29
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.28
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.19
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.17
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.15
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.13
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.12
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.06
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.01
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.96
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.91
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.9
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.85
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.82
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.75
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.67
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.63
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.49
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.22
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.16
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.11
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.94
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.92
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.92
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.9
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.89
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.82
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.8
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.8
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.69
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.65
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.65
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.65
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.51
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.46
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.45
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.45
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.44
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.43
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.41
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.33
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.29
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.28
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.18
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.14
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.03
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.01
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.77
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.76
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.75
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.49
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.37
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.24
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.1
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.07
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.02
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.96
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.62
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.53
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.31
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.24
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.99
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.9
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.24
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.0
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.86
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.01
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.91
d1y0jb136 U-shaped transcription factor, different fingers { 92.89
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.0
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.27
d1y0jb136 U-shaped transcription factor, different fingers { 91.23
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.81
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.68
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.62
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.98
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.89
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.61
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.4
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 84.27
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 80.08
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=5.5e-19  Score=102.31  Aligned_cols=53  Identities=28%  Similarity=0.652  Sum_probs=50.7

Q ss_pred             CCceecCcCCCcCCChHHHHHHHHhcCCCCCCCCCCCccccccCCCCCCCcCCcccccCCCchHHHHHHhhh
Q 044181           42 GRAFECKTCNRQFPSFQALGGHRASHKKPRFTDGNGGVDMQQLPIKPKTHECSVCGLEFAIGQALGGHMRRH  113 (178)
Q Consensus        42 ~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~c~~~~h~~~h~~~k~~~C~~Cgk~F~~~~~L~~H~~~H  113 (178)
                      ||||+|+ ||++|....+|..|+++|+                  |++||.|.+||+.|.+.++|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht------------------~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHL------------------GLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHS------------------CCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccc------------------cccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            7899995 9999999999999999998                  699999999999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure