Citrus Sinensis ID: 044196

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MLNSLISLCFVTLFCVSAAAASRTKIYSINGHEGKFVSSPPAADGICRSMVQSQGYICHEHTVTTQDGYILSMQRMPKARSGKPADMPPVLLQHGLLMDGITWLLNSPNESLAFILAEKGYDVWIANTRGTKYSLGHTSLSPNDPAYWEWTWDELMAYDVTASVKFVHDQTGQQKLHYVGHSLGTLVAFAAFSQDKLVSMIRSAALLSPIAYLGQMPSQLARSAVDAFLAEDIYWLGLHEFAPRGGAVAKLLEDICQKPGNNCSNLMSSFTGQNCCLNSSRTDIFLEHEPQSTATKNMIHLAQMARKGTIAMYDYGNEDDNMNHYGQPTPPVYNMTKIPKDLPLFLSYGGKDLLSDVKDVKHLLGNLKDHDSDKLVVQYIKDYAHADFVFGIQANRDVYDPMMAFFRLH

cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHccccccEEEEEcccccEEEEEEccccccccccccccEEEEccccccccccccccccccHHHHHHHccccEEEccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHcccHHHHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHHHHHHHccCCccccHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHccccccccEEEEEcccccccHHHHcccccHHHHHHHHHHHHcc

*LNSLISLCFVTLFCVSAAAASRTKIYSINGHEGKFVSSPPAADGICRSMVQSQGYICHEHTVTTQDGYILSMQRM*K**********PVLLQHGLLMDGITWLLNSPNESLAFILAEKGYDVWIANTRGTKYSLGHTSLSPNDPAYWEWTWDELMAYDVTASVKFVHDQTGQQKLHYVGHSLGTLVAFAAFSQDKLVSMIRSAALLSPIAYLGQMPSQLARSAVDAFLAEDIYWLGLHEFAPRGGAVAKLLEDICQKPGNNCSNLMSSFTGQNCCLNSSRTDIFLEHEPQSTATKNMIHLAQMARKGTIAMYDYGNEDDNMNHYGQPTPPVYNMTKIPKDLPLFLSYGGKDLLSDVKDVKHLLGNLKDHDSDKLVVQYIKDYAHADFVFGIQANRDVYDPMMAFFRLH

xxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Triacylglycerol lipase 2	Triacylglycerol (TAG) lipase. May be involved for TAG storage breakdown during seed germination.	probable	Q67ZU1
Lipase member K	Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.	probable	Q5VXJ0
Lipase member K	Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.	probable	Q8BM14

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.1.-	Carboxylic ester hydrolases.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8Q, chain A
Confidence level:very confident
Coverage over the Query: 41-409
View the alignment between query and template
View the model in PyMOL