BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044235
(91 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4GWG|A Chain A, Crystal Structure Analysis Of 6-Phosphogluconate
Dehydrogenase Apo- Form
pdb|4GWK|A Chain A, Crystal Structure Of 6-Phosphogluconate Dehydrogenase
Complexed With 3-Phosphoglyceric Acid
Length = 484
Score = 26.6 bits (57), Expect = 4.1, Method: Composition-based stats.
Identities = 13/42 (30%), Positives = 23/42 (54%)
Query: 13 ILVLASSQSASIKLEKHVALFVFGDSLYDPGNNNFLNISSGC 54
IL++ + Q+ +EK V L GD + D GN+ + + + C
Sbjct: 73 ILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRC 114
>pdb|2JKV|A Chain A, Structure Of Human Phosphogluconate Dehydrogenase In
Complex With Nadph At 2.53a
pdb|2JKV|B Chain B, Structure Of Human Phosphogluconate Dehydrogenase In
Complex With Nadph At 2.53a
pdb|2JKV|C Chain C, Structure Of Human Phosphogluconate Dehydrogenase In
Complex With Nadph At 2.53a
pdb|2JKV|D Chain D, Structure Of Human Phosphogluconate Dehydrogenase In
Complex With Nadph At 2.53a
pdb|2JKV|E Chain E, Structure Of Human Phosphogluconate Dehydrogenase In
Complex With Nadph At 2.53a
pdb|2JKV|F Chain F, Structure Of Human Phosphogluconate Dehydrogenase In
Complex With Nadph At 2.53a
Length = 505
Score = 26.6 bits (57), Expect = 4.1, Method: Composition-based stats.
Identities = 13/42 (30%), Positives = 23/42 (54%)
Query: 13 ILVLASSQSASIKLEKHVALFVFGDSLYDPGNNNFLNISSGC 54
IL++ + Q+ +EK V L GD + D GN+ + + + C
Sbjct: 94 ILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRC 135
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.330 0.148 0.472
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,844,770
Number of Sequences: 62578
Number of extensions: 106799
Number of successful extensions: 210
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 207
Number of HSP's gapped (non-prelim): 3
length of query: 91
length of database: 14,973,337
effective HSP length: 58
effective length of query: 33
effective length of database: 11,343,813
effective search space: 374345829
effective search space used: 374345829
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)