BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044235
         (91 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GWG|A Chain A, Crystal Structure Analysis Of 6-Phosphogluconate
           Dehydrogenase Apo- Form
 pdb|4GWK|A Chain A, Crystal Structure Of 6-Phosphogluconate Dehydrogenase
           Complexed With 3-Phosphoglyceric Acid
          Length = 484

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 13  ILVLASSQSASIKLEKHVALFVFGDSLYDPGNNNFLNISSGC 54
           IL++ + Q+    +EK V L   GD + D GN+ + + +  C
Sbjct: 73  ILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRC 114


>pdb|2JKV|A Chain A, Structure Of Human Phosphogluconate Dehydrogenase In
           Complex With Nadph At 2.53a
 pdb|2JKV|B Chain B, Structure Of Human Phosphogluconate Dehydrogenase In
           Complex With Nadph At 2.53a
 pdb|2JKV|C Chain C, Structure Of Human Phosphogluconate Dehydrogenase In
           Complex With Nadph At 2.53a
 pdb|2JKV|D Chain D, Structure Of Human Phosphogluconate Dehydrogenase In
           Complex With Nadph At 2.53a
 pdb|2JKV|E Chain E, Structure Of Human Phosphogluconate Dehydrogenase In
           Complex With Nadph At 2.53a
 pdb|2JKV|F Chain F, Structure Of Human Phosphogluconate Dehydrogenase In
           Complex With Nadph At 2.53a
          Length = 505

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 13  ILVLASSQSASIKLEKHVALFVFGDSLYDPGNNNFLNISSGC 54
           IL++ + Q+    +EK V L   GD + D GN+ + + +  C
Sbjct: 94  ILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRC 135


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.148    0.472 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,844,770
Number of Sequences: 62578
Number of extensions: 106799
Number of successful extensions: 210
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 207
Number of HSP's gapped (non-prelim): 3
length of query: 91
length of database: 14,973,337
effective HSP length: 58
effective length of query: 33
effective length of database: 11,343,813
effective search space: 374345829
effective search space used: 374345829
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)