BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044237
(212 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OB1|B Chain B, Crystal Structure Of A Fab Complex Whith Plasmodium
Falciparum Msp1-19
pdb|1OB1|E Chain E, Crystal Structure Of A Fab Complex Whith Plasmodium
Falciparum Msp1-19
Length = 219
Score = 28.1 bits (61), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
Query: 182 LKMLELRDLDSLTSFCSANYTFKFPSLQDLW 212
L+++ L++ D+ T FC+ NY ++F D W
Sbjct: 81 LQIINLKNEDTATYFCARNY-YRFDGGMDFW 110
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.140 0.426
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,890,688
Number of Sequences: 62578
Number of extensions: 152839
Number of successful extensions: 314
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 314
Number of HSP's gapped (non-prelim): 1
length of query: 212
length of database: 14,973,337
effective HSP length: 95
effective length of query: 117
effective length of database: 9,028,427
effective search space: 1056325959
effective search space used: 1056325959
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)