BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044254
(312 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q5JGR9|IF2P_PYRKO Probable translation initiation factor IF-2 OS=Pyrococcus
kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
GN=infB PE=3 SV=1
Length = 1144
Score = 32.7 bits (73), Expect = 3.6, Method: Composition-based stats.
Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 7/69 (10%)
Query: 151 MENMYMWVFKERPENALGKMQLRSYMNGHSRQGERPFPFSVEKGFVRSHRMQRKHYRGLS 210
+E+ Y+W + R GKM N HS PF +G+VR+ +++ Y ++
Sbjct: 76 LESPYVWKVRHR-----GKMLRVKLKNWHSVSVTPEHPFLTTRGWVRADQLKPGDY--VA 128
Query: 211 NPQCVHGIE 219
P+ +HG E
Sbjct: 129 VPRVIHGNE 137
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.315 0.133 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 125,859,726
Number of Sequences: 539616
Number of extensions: 5438582
Number of successful extensions: 13697
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 13697
Number of HSP's gapped (non-prelim): 5
length of query: 312
length of database: 191,569,459
effective HSP length: 117
effective length of query: 195
effective length of database: 128,434,387
effective search space: 25044705465
effective search space used: 25044705465
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)