Query         044254
Match_columns 312
No_of_seqs    25 out of 27
Neff          1.8 
Searched_HMMs 46136
Date          Fri Mar 29 12:55:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044254.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044254hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10961 DUF2763:  Protein of u  65.1     2.5 5.5E-05   33.9   0.5   26   99-124    22-47  (91)
  2 PF10123 Mu-like_Pro:  Mu-like   48.4     9.8 0.00021   35.2   1.4   30  201-230    92-131 (326)
  3 cd01244 PH_RasGAP_CG9209 RAS_G  29.3      46 0.00099   26.5   2.3   26  216-241    67-95  (98)
  4 PF00169 PH:  PH domain;  Inter  29.1      57  0.0012   22.4   2.5   31  210-240    64-98  (104)
  5 cd01220 PH_CDEP Chondrocyte-de  26.6      55  0.0012   25.9   2.3   25  216-241    65-93  (99)
  6 PF07755 DUF1611:  Protein of u  21.5      52  0.0011   31.5   1.5   57  190-246   213-286 (301)
  7 COG3531 Predicted protein-disu  21.0      37  0.0008   31.8   0.4   25  195-227   108-132 (212)
  8 smart00233 PH Pleckstrin homol  20.6 1.1E+02  0.0025   20.1   2.6   29  213-241    65-97  (102)
  9 cd01967 Nitrogenase_MoFe_alpha  18.7      89  0.0019   29.0   2.3   52  217-270   162-213 (406)
 10 PF06884 DUF1264:  Protein of u  18.3      48   0.001   30.0   0.5   53  201-253    26-98  (171)

No 1  
>PF10961 DUF2763:  Protein of unknown function (DUF2763);  InterPro: IPR024491 This entry represents an eukaryotic family of selenoproteins. It includes SelK, which seems to play an important role in protecting cells from endoplasmic reticulum stress-induced apoptosis [] and SelG, which may be involved in regulating the redox state of the cell [].
Probab=65.07  E-value=2.5  Score=33.87  Aligned_cols=26  Identities=23%  Similarity=0.553  Sum_probs=21.6

Q ss_pred             cCcchhhhhhhhhcccccccccccce
Q 044254           99 LDSVWGACFFFTYYFKPVLNEKSKCK  124 (312)
Q Consensus        99 ~DsiWGAWFFF~~YFkP~l~~k~k~K  124 (312)
                      .|-+||+|.|+..||+.+++..+...
T Consensus        22 ~d~Fwgi~~fI~lFF~Tl~~p~~~~~   47 (91)
T PF10961_consen   22 TDFFWGIINFIVLFFQTLFSPDSSRS   47 (91)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCcccc
Confidence            47899999999999999998765533


No 2  
>PF10123 Mu-like_Pro:  Mu-like prophage I protein;  InterPro: IPR012106 This entry is represented by the Bacteriophage Mu, Gp32. The characteristics of the protein distribution suggest prophage matches.
Probab=48.35  E-value=9.8  Score=35.25  Aligned_cols=30  Identities=30%  Similarity=0.516  Sum_probs=20.7

Q ss_pred             hhhhhccCCC----------CCccccceeEeeCCCCCCCC
Q 044254          201 MQRKHYRGLS----------NPQCVHGIEVVSSPNLKGID  230 (312)
Q Consensus       201 MQRKHYRGLS----------NPQCvHGIEvV~sPnL~~~~  230 (312)
                      +..|+||-||          ++.+||++-.+..|||.++.
T Consensus        92 i~~~eYry~SPvf~~d~~~g~v~~l~~aaLTN~P~l~gl~  131 (326)
T PF10123_consen   92 IANKEYRYLSPVFHYDKDTGRVLRLHSAALTNRPALDGLA  131 (326)
T ss_pred             HhCCCCceeCceeeecCCCCcEEEEEEeeecCCCcccccH
Confidence            3455555555          33478888889999997764


No 3  
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain. This protein consists of two C2 domains, followed by a RasGAP domain, a PH domain and a BTK domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=29.26  E-value=46  Score=26.54  Aligned_cols=26  Identities=19%  Similarity=0.259  Sum_probs=19.4

Q ss_pred             cceeEeeCC---CCCCCCHHHHHhhhhhc
Q 044254          216 HGIEVVSSP---NLKGIDEEEQKRWMELT  241 (312)
Q Consensus       216 HGIEvV~sP---nL~~~~e~d~kRW~ELT  241 (312)
                      |.++||..-   .+..=+|+||+.|++..
T Consensus        67 ~~fqivt~~r~~yi~a~s~~E~~~Wi~al   95 (98)
T cd01244          67 DIITIVCEDDTMQLQFEAPVEATDWLNAL   95 (98)
T ss_pred             ceEEEEeCCCeEEEECCCHHHHHHHHHHH
Confidence            678887632   25677899999999854


No 4  
>PF00169 PH:  PH domain;  InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]. The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families:  Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....
Probab=29.06  E-value=57  Score=22.40  Aligned_cols=31  Identities=29%  Similarity=0.529  Sum_probs=25.3

Q ss_pred             CCCccccceeEeeCCC----CCCCCHHHHHhhhhh
Q 044254          210 SNPQCVHGIEVVSSPN----LKGIDEEEQKRWMEL  240 (312)
Q Consensus       210 SNPQCvHGIEvV~sPn----L~~~~e~d~kRW~EL  240 (312)
                      .+...-|+++|+...+    |..=+++|+++|++-
T Consensus        64 ~~~~~~~~f~i~~~~~~~~~~~~~s~~~~~~W~~~   98 (104)
T PF00169_consen   64 SNKKRKNCFEITTPNGKSYLFSAESEEERKRWIQA   98 (104)
T ss_dssp             STSSSSSEEEEEETTSEEEEEEESSHHHHHHHHHH
T ss_pred             cccCCCcEEEEEeCCCcEEEEEcCCHHHHHHHHHH
Confidence            6777788899988877    556689999999974


No 5  
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain. CDEP consists of a Ferm domain, a rhoGEF (DH) domain followed by two PH domains.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=26.58  E-value=55  Score=25.92  Aligned_cols=25  Identities=12%  Similarity=0.385  Sum_probs=17.2

Q ss_pred             cceeEeeCCC----CCCCCHHHHHhhhhhc
Q 044254          216 HGIEVVSSPN----LKGIDEEEQKRWMELT  241 (312)
Q Consensus       216 HGIEvV~sPn----L~~~~e~d~kRW~ELT  241 (312)
                      |+.+|. +|+    |..=+++||.+|++-.
T Consensus        65 ~~F~I~-~~~ks~~l~A~s~~Ek~~Wi~~i   93 (99)
T cd01220          65 HCFTIF-GGQCAITVAASTRAEKEKWLADL   93 (99)
T ss_pred             eeEEEE-cCCeEEEEECCCHHHHHHHHHHH
Confidence            555555 333    5666899999999743


No 6  
>PF07755 DUF1611:  Protein of unknown function (DUF1611);  InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins. The region is approximately 350 residues long. A member of this family (Q6M063 from SWISSPROT) is thought to associate with another subunit to form an H+-transporting ATPase, but no evidence has been found to support this.; PDB: 2G0T_A 2OBN_A.
Probab=21.50  E-value=52  Score=31.51  Aligned_cols=57  Identities=32%  Similarity=0.400  Sum_probs=34.5

Q ss_pred             cccccchhhhhhhhhhccCCCC------Ccccc----------ceeEee-CCCCCCCCHHHHHhhhhhcccccc
Q 044254          190 SVEKGFVRSHRMQRKHYRGLSN------PQCVH----------GIEVVS-SPNLKGIDEEEQKRWMELTGRDLN  246 (312)
Q Consensus       190 S~dkGFvRSHRMQRKHYRGLSN------PQCvH----------GIEvV~-sPnL~~~~e~d~kRW~ELTGRd~n  246 (312)
                      |...++|--|+.-|||++|+.+      ..||-          .+.||. |=|-.++++++.++..+-.-++++
T Consensus       213 s~Pd~lVL~H~p~r~~~~~~p~~~ip~l~~~I~l~e~la~~~~~~~VvgIslNt~~l~~~e~~~~~~~~~~e~g  286 (301)
T PF07755_consen  213 SQPDALVLCHAPGRKHRDGFPHYPIPPLEEEIELIEALAGTKPPAKVVGISLNTSGLSEEEAKAAIERIEEELG  286 (301)
T ss_dssp             H--SEEEEEEETT-SC-TTSTTSC---HHHHHHHHHHCCCGC---EEEEEECC-TTS-HHHHHHHHHHHHHHH-
T ss_pred             CCCCeEEEEecCCcccccCCCcCCCCCHHHHHHHHHHhhccCCCccEEEEEEECCCCCHHHHHHHHHHHHHHHC
Confidence            4567889999999999999633      12222          222332 458889999999999887776653


No 7  
>COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=20.96  E-value=37  Score=31.77  Aligned_cols=25  Identities=32%  Similarity=0.578  Sum_probs=18.9

Q ss_pred             chhhhhhhhhhccCCCCCccccceeEeeCCCCC
Q 044254          195 FVRSHRMQRKHYRGLSNPQCVHGIEVVSSPNLK  227 (312)
Q Consensus       195 FvRSHRMQRKHYRGLSNPQCvHGIEvV~sPnL~  227 (312)
                      +---|+.||+||        +-|-.|+.+|=|.
T Consensus       108 l~ml~aIQrA~Y--------vEGrdi~~t~vl~  132 (212)
T COG3531         108 LTMLHAIQRAHY--------VEGRDITQTEVLA  132 (212)
T ss_pred             hHHHHHHHHHHH--------hccccchhhHHHH
Confidence            445699999999        5677777777663


No 8  
>smart00233 PH Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
Probab=20.65  E-value=1.1e+02  Score=20.13  Aligned_cols=29  Identities=24%  Similarity=0.493  Sum_probs=21.1

Q ss_pred             ccccceeEeeCCC----CCCCCHHHHHhhhhhc
Q 044254          213 QCVHGIEVVSSPN----LKGIDEEEQKRWMELT  241 (312)
Q Consensus       213 QCvHGIEvV~sPn----L~~~~e~d~kRW~ELT  241 (312)
                      .+-++++|+...+    +..=+++|+..|++-.
T Consensus        65 ~~~~~f~l~~~~~~~~~f~~~s~~~~~~W~~~i   97 (102)
T smart00233       65 KKPHCFEIKTADRRSYLLQAESEEEREEWVDAL   97 (102)
T ss_pred             CCceEEEEEecCCceEEEEcCCHHHHHHHHHHH
Confidence            3456777777666    5566899999999743


No 9  
>cd01967 Nitrogenase_MoFe_alpha_like Nitrogenase_MoFe_alpha_like: Nitrogenase MoFe protein, alpha subunit_like. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia.  Three genetically distinct types of nitrogenase systems are known to exist: a molybdenum-dependent  nitrogenase (Mo-nitrogenase), a vanadium dependent nitrogenase (V-nitrogenase), and an iron-only nitrogenase (Fe-nitrogenase). These nitrogenase systems consist of component 1 (MoFe protein, VFe protein or, FeFe protein respectively) and, component 2 (Fe protein). This group contains the alpha subunit of component 1 of all three different forms. The most widespread and best characterized of these systems is the Mo-nitrogenase. MoFe is an alpha2beta2 tetramer, the alternative nitrogenases are alpha2beta2delta2 hexamers having  alpha and beta subunits similar to the alpha and beta subunits of MoFe.  The role of the delta subunit is unknown. For MoFe, each alphabeta pair of subunits contains one
Probab=18.72  E-value=89  Score=28.96  Aligned_cols=52  Identities=17%  Similarity=0.242  Sum_probs=41.1

Q ss_pred             ceeEeeCCCCCCCCHHHHHhhhhhccccccccCCCCCcccccccCCCCCccccc
Q 044254          217 GIEVVSSPNLKGIDEEEQKRWMELTGRDLNFSVPPEASEFSSWRNLPNTEFELD  270 (312)
Q Consensus       217 GIEvV~sPnL~~~~e~d~kRW~ELTGRd~nFsiP~eAsdf~sWRnlPntefELe  270 (312)
                      -|-|+..-|+.+ +-+|.||..|..|-++|-.+| ...+++.++++|+.++-+-
T Consensus       162 ~VNiig~~~~~~-d~~el~~lL~~~Gi~~~~~~~-~~~~~~~i~~~~~A~~niv  213 (406)
T cd01967         162 DVNIIGEYNIGG-DAWVIKPLLEELGIRVNATFT-GDGTVDELRRAHRAKLNLV  213 (406)
T ss_pred             eEEEEeccccch-hHHHHHHHHHHcCCEEEEEeC-CCCCHHHHhhCccCCEEEE
Confidence            366666555533 778999999999999997776 5778999999999987663


No 10 
>PF06884 DUF1264:  Protein of unknown function (DUF1264);  InterPro: IPR010686 This family contains a number of bacterial and eukaryotic proteins of unknown function that are approximately 200 residues long. Some family members are annotated as putative lipoproteins.
Probab=18.32  E-value=48  Score=30.04  Aligned_cols=53  Identities=36%  Similarity=0.544  Sum_probs=36.9

Q ss_pred             hhhhhccCCCCC---ccc-----------cceeEeeCCCCC-CCCHHHHHhhh----h-hccccccccCCCCC
Q 044254          201 MQRKHYRGLSNP---QCV-----------HGIEVVSSPNLK-GIDEEEQKRWM----E-LTGRDLNFSVPPEA  253 (312)
Q Consensus       201 MQRKHYRGLSNP---QCv-----------HGIEvV~sPnL~-~~~e~d~kRW~----E-LTGRd~nFsiP~eA  253 (312)
                      |.--||-.-=|.   ||+           =|||-+-|+.|. .|++||||-|-    | ..|.=+.=.||..|
T Consensus        26 veahHyC~~vned~~QC~iyDs~~~~ArLIGvEYiISe~lf~tLP~eEkklWHsH~~EVkSG~L~~p~vP~~a   98 (171)
T PF06884_consen   26 VEAHHYCSHVNEDFRQCLIYDSNEPNARLIGVEYIISEKLFETLPEEEKKLWHSHVYEVKSGMLVMPGVPEAA   98 (171)
T ss_pred             eeeeeeeeecCCcceEEEEecCCCCCcceeeeeEEEcHHHHhhCCHHHHhccCCcceeeeeeeEecCCCCHHH
Confidence            334577665554   785           599999999984 69999999994    3 34555555566554


Done!