Query         044269
Match_columns 129
No_of_seqs    111 out of 579
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 13:02:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044269.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044269hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09269 DUF1967:  Domain of un 100.0 2.3E-29 5.1E-34  169.4   7.2   69   34-103     1-69  (69)
  2 TIGR03595 Obg_CgtA_exten Obg f 100.0 9.4E-29   2E-33  166.6   9.8   69   34-103     1-69  (69)
  3 PRK12297 obgE GTPase CgtA; Rev  99.8 1.7E-20 3.6E-25  161.8  10.4   73   32-105   352-424 (424)
  4 PRK12296 obgE GTPase CgtA; Rev  99.8 2.2E-19 4.8E-24  158.0  10.7   76   32-108   364-444 (500)
  5 COG2012 RPB5 DNA-directed RNA   86.0    0.87 1.9E-05   32.0   2.9   15   83-97     50-64  (80)
  6 PF01568 Molydop_binding:  Moly  76.9     2.4 5.1E-05   29.0   2.4   17   81-97     37-53  (110)
  7 PRK09570 rpoH DNA-directed RNA  71.1     4.6  0.0001   28.1   2.7   44   46-96     17-60  (79)
  8 cd02787 MopB_CT_ydeP The MopB_  69.2     4.7  0.0001   28.0   2.5   17   81-97     38-54  (112)
  9 cd02781 MopB_CT_Acetylene-hydr  67.2     5.7 0.00012   28.0   2.6   17   81-97     40-56  (130)
 10 COG1497 Predicted transcriptio  66.9      29 0.00062   29.2   7.0   63   36-104    55-124 (260)
 11 cd02786 MopB_CT_3 The MopB_CT_  65.5     6.3 0.00014   27.2   2.5   17   81-97     38-54  (116)
 12 PF11213 DUF3006:  Protein of u  64.5       4 8.6E-05   27.1   1.3   29   79-107    25-54  (71)
 13 TIGR00030 S21p ribosomal prote  63.7      11 0.00023   24.6   3.2   23   64-86     12-34  (58)
 14 cd02791 MopB_CT_Nitrate-R-NapA  63.0     7.6 0.00016   26.9   2.5   17   81-97     42-58  (122)
 15 cd02790 MopB_CT_Formate-Dh_H F  62.9     7.7 0.00017   26.6   2.5   18   81-98     42-59  (116)
 16 cd00508 MopB_CT_Fdh-Nap-like T  62.8     7.7 0.00017   26.6   2.5   18   81-98     42-59  (120)
 17 cd02777 MopB_CT_DMSOR-like The  61.5     8.1 0.00018   27.3   2.5   17   81-97     41-57  (127)
 18 cd02785 MopB_CT_4 The MopB_CT_  60.2     8.8 0.00019   27.0   2.5   17   81-97     39-55  (124)
 19 cd02789 MopB_CT_FmdC-FwdD The   59.9     9.5 0.00021   26.7   2.6   17   81-97     38-54  (106)
 20 cd02794 MopB_CT_DmsA-EC The Mo  59.9     9.1  0.0002   26.9   2.5   17   81-97     37-53  (121)
 21 cd02775 MopB_CT Molybdopterin-  59.1      10 0.00022   25.1   2.5   17   81-97     30-46  (101)
 22 cd02776 MopB_CT_Nitrate-R-NarG  58.0      10 0.00022   28.1   2.6   17   81-97     38-54  (141)
 23 cd02788 MopB_CT_NDH-1_NuoG2-N7  57.6      11 0.00024   25.7   2.6   16   82-97     37-52  (96)
 24 cd02792 MopB_CT_Formate-Dh-Na-  57.6      11 0.00024   26.1   2.6   17   81-97     42-58  (122)
 25 cd02793 MopB_CT_DMSOR-BSOR-TMA  57.5      11 0.00023   27.0   2.6   18   81-98     40-57  (129)
 26 cd02784 MopB_CT_PHLH The MopB_  57.2      10 0.00022   28.2   2.5   18   80-97     44-61  (137)
 27 PRK00270 rpsU 30S ribosomal pr  57.0      16 0.00035   24.2   3.2   23   64-86     13-35  (64)
 28 cd02783 MopB_CT_2 The MopB_CT_  57.0      10 0.00023   28.3   2.6   18   81-98     39-56  (156)
 29 PF04014 Antitoxin-MazE:  Antid  56.0      14  0.0003   22.3   2.6   15   82-96     15-29  (47)
 30 cd02779 MopB_CT_Arsenite-Ox Th  55.7      12 0.00025   26.2   2.5   17   81-97     40-56  (115)
 31 cd02778 MopB_CT_Thiosulfate-R-  55.4      12 0.00026   25.9   2.5   16   81-96     37-52  (123)
 32 COG1153 FwdD Formylmethanofura  54.0      11 0.00024   28.5   2.3   17   81-97     38-54  (128)
 33 PF01191 RNA_pol_Rpb5_C:  RNA p  53.9      10 0.00022   26.0   1.8   14   84-97     45-58  (74)
 34 cd02782 MopB_CT_1 The MopB_CT_  52.8      14  0.0003   26.1   2.5   17   81-97     40-56  (129)
 35 COG2746 Aminoglycoside N3'-ace  52.6      13 0.00027   31.2   2.5   25   73-97     11-35  (251)
 36 PF03990 DUF348:  Domain of unk  51.3      16 0.00035   21.9   2.3   19   77-95     18-38  (43)
 37 PF10015 DUF2258:  Uncharacteri  48.7      19 0.00041   25.0   2.6   34   63-97     29-63  (75)
 38 COG2897 SseA Rhodanese-related  47.4      19  0.0004   30.3   2.8   20   80-99     79-98  (285)
 39 COG0426 FpaA Uncharacterized f  46.9      19 0.00041   31.7   2.9   22   85-106   121-142 (388)
 40 PRK15094 magnesium/cobalt effl  45.4   1E+02  0.0022   25.5   6.9   57   36-104   204-267 (292)
 41 PF01628 HrcA:  HrcA protein C   45.0      32 0.00069   26.7   3.7   54   43-98    129-183 (224)
 42 PRK00082 hrcA heat-inducible t  45.0      82  0.0018   26.7   6.4   51   44-98    232-283 (339)
 43 cd01796 DDI1_N DNA damage indu  44.9      21 0.00045   23.2   2.2   16   82-97     55-70  (71)
 44 PRK11573 hypothetical protein;  44.5      90  0.0019   27.1   6.7   57   36-104   326-389 (413)
 45 PLN02377 3-ketoacyl-CoA syntha  44.1      30 0.00066   31.2   3.8   45   33-79    102-146 (502)
 46 cd02780 MopB_CT_Tetrathionate_  43.4      23  0.0005   25.6   2.5   16   82-97     38-53  (143)
 47 COG0186 RpsQ Ribosomal protein  42.8      15 0.00032   26.1   1.3   12   87-98     55-66  (87)
 48 PF02938 GAD:  GAD domain;  Int  41.2      23  0.0005   24.4   2.1   18   80-97     67-84  (95)
 49 TIGR03520 GldE gliding motilit  40.2 1.3E+02  0.0029   25.9   7.0   60   36-105   325-394 (408)
 50 PF03471 CorC_HlyC:  Transporte  39.9 1.1E+02  0.0023   20.1   5.6   53   41-103     4-64  (81)
 51 cd01812 BAG1_N Ubiquitin-like   39.6      29 0.00062   21.7   2.2   17   80-96     52-68  (71)
 52 PF08845 SymE_toxin:  Toxin Sym  38.9      27 0.00058   22.6   2.0   16   81-96     31-46  (57)
 53 TIGR03635 S17_bact 30S ribosom  38.4      20 0.00044   24.2   1.4   12   87-98     48-59  (71)
 54 COG2015 Alkyl sulfatase and re  37.6      35 0.00077   31.7   3.2   18   89-106   262-279 (655)
 55 PF03459 TOBE:  TOBE domain;  I  37.4      35 0.00076   21.0   2.4   16   81-96     40-55  (64)
 56 PF02359 CDC48_N:  Cell divisio  37.3      32  0.0007   23.1   2.3   28   81-108    23-54  (87)
 57 cd08177 MAR Maleylacetate redu  37.0      25 0.00054   29.2   2.0   44   50-93    266-309 (337)
 58 cd06288 PBP1_sucrose_transcrip  37.0      56  0.0012   24.5   3.8   40   60-99    158-212 (269)
 59 PF03829 PTSIIA_gutA:  PTS syst  36.6      32 0.00069   25.3   2.3   17   87-103    51-67  (117)
 60 PF04225 OapA:  Opacity-associa  36.0      39 0.00084   23.2   2.6   43   48-96      9-51  (85)
 61 TIGR02609 doc_partner putative  35.9      39 0.00085   22.5   2.5   16   81-96     17-32  (74)
 62 PF03120 DNA_ligase_OB:  NAD-de  35.8      31 0.00068   24.0   2.1   15   83-97     45-59  (82)
 63 PRK11507 ribosome-associated p  35.5      27  0.0006   23.7   1.7   26   77-102    42-67  (70)
 64 PF08817 YukD:  WXG100 protein   35.4      16 0.00035   24.2   0.6   17   80-96     62-78  (79)
 65 PLN03111 DNA-directed RNA poly  35.2      37 0.00081   27.5   2.7   13   84-96    177-189 (206)
 66 PRK11347 antitoxin ChpS; Provi  35.1      41 0.00088   23.2   2.6   16   81-96     19-34  (83)
 67 PF08461 HTH_12:  Ribonuclease   35.0      31 0.00066   22.6   1.8   36   47-82     14-50  (66)
 68 cd01805 RAD23_N Ubiquitin-like  34.7      38 0.00082   21.6   2.2   16   81-96     56-71  (77)
 69 COG0243 BisC Anaerobic dehydro  34.6      32 0.00068   31.8   2.5   17   81-97    678-694 (765)
 70 cd00989 PDZ_metalloprotease PD  34.2      37 0.00079   21.3   2.1   20   82-101    24-44  (79)
 71 PF12668 DUF3791:  Protein of u  34.2      66  0.0014   20.5   3.3   30   51-84      7-36  (62)
 72 PRK14990 anaerobic dimethyl su  34.0      28 0.00061   32.4   2.0   21   77-98    726-746 (814)
 73 PF04023 FeoA:  FeoA domain;  I  34.0      39 0.00085   21.5   2.2   18   81-98     26-43  (74)
 74 cd01791 Ubl5 UBL5 ubiquitin-li  33.9      38 0.00083   22.4   2.2   16   82-97     56-71  (73)
 75 PF02643 DUF192:  Uncharacteriz  33.7      27 0.00059   24.7   1.5   14   83-96     93-106 (108)
 76 TIGR01439 lp_hng_hel_AbrB loop  33.6      51  0.0011   18.7   2.5   17   81-97     14-30  (43)
 77 PRK05282 (alpha)-aspartyl dipe  33.3      35 0.00077   27.6   2.3   31   65-97     88-118 (233)
 78 PTZ00061 DNA-directed RNA poly  33.0      42 0.00091   27.2   2.7   13   84-96    176-188 (205)
 79 cd06317 PBP1_ABC_sugar_binding  32.9      79  0.0017   23.8   4.1   37   60-97    167-219 (275)
 80 KOG2500 Uncharacterized conser  32.7      77  0.0017   26.5   4.2   64   34-97     91-161 (253)
 81 cd01804 midnolin_N Ubiquitin-l  32.5      42 0.00091   22.2   2.2   15   82-96     55-69  (78)
 82 PF08133 Nuclease_act:  Anticod  31.9      27 0.00059   19.6   1.0   23   58-80      1-23  (26)
 83 PF08939 DUF1917:  Domain of un  31.9      44 0.00095   27.6   2.7   24   58-81    203-226 (243)
 84 PF13275 S4_2:  S4 domain; PDB:  31.3      29 0.00063   23.1   1.3   26   77-102    38-63  (65)
 85 KOG3085 Predicted hydrolase (H  31.3      50  0.0011   27.2   2.9   21   80-100   175-195 (237)
 86 PTZ00237 acetyl-CoA synthetase  31.1      44 0.00095   29.9   2.7   18   80-97    106-123 (647)
 87 PF13533 Biotin_lipoyl_2:  Biot  30.9      35 0.00076   20.8   1.5   21   86-106    16-36  (50)
 88 TIGR03479 DMSO_red_II_alp DMSO  30.2      39 0.00085   32.2   2.4   17   81-97    817-833 (912)
 89 PF04994 TfoX_C:  TfoX C-termin  30.2      62  0.0014   22.0   2.8   36   49-88     12-47  (81)
 90 PF08206 OB_RNB:  Ribonuclease   30.0      36 0.00079   21.4   1.5   11   86-96     30-40  (58)
 91 TIGR02164 torA trimethylamine-  30.0      44 0.00095   31.3   2.6   17   81-97    714-730 (822)
 92 PRK05610 rpsQ 30S ribosomal pr  29.9      32  0.0007   23.9   1.4   12   87-98     53-64  (84)
 93 PRK11303 DNA-binding transcrip  29.4      73  0.0016   25.1   3.5   39   60-98    219-272 (328)
 94 CHL00142 rps17 ribosomal prote  29.3      34 0.00073   23.9   1.4   12   87-98     50-61  (84)
 95 PRK11041 DNA-binding transcrip  29.0      83  0.0018   24.4   3.7   39   60-98    194-247 (309)
 96 PRK10461 thiamine biosynthesis  29.0      21 0.00046   30.4   0.4   31   65-98    190-220 (350)
 97 PRK15102 trimethylamine N-oxid  28.9      47   0.001   31.1   2.6   17   81-97    717-733 (825)
 98 cd01799 Hoil1_N Ubiquitin-like  28.6      52  0.0011   21.9   2.2   17   81-97     56-73  (75)
 99 COG3127 Predicted ABC-type tra  28.6      48   0.001   32.0   2.6   25   81-105   144-168 (829)
100 COG2179 Predicted hydrolase of  28.4      26 0.00057   27.8   0.8   48   50-102    74-122 (175)
101 PF13180 PDZ_2:  PDZ domain; PD  28.2      35 0.00075   22.2   1.2   19   83-101    27-46  (82)
102 COG0828 RpsU Ribosomal protein  28.1      72  0.0016   21.6   2.7   25   64-88     13-37  (67)
103 cd06308 PBP1_sensor_kinase_lik  27.0      95  0.0021   23.5   3.7   20   77-97    195-214 (270)
104 TIGR03089 conserved hypothetic  27.0      61  0.0013   25.3   2.6   17   81-97     42-59  (227)
105 COG0380 OtsA Trehalose-6-phosp  26.9      15 0.00032   33.3  -1.0   41   87-127   144-184 (486)
106 TIGR00638 Mop molybdenum-pteri  26.7      73  0.0016   19.7   2.5   16   81-96     42-57  (69)
107 PTZ00241 40S ribosomal protein  26.7      38 0.00083   26.5   1.4   12   87-98    116-127 (158)
108 cd01808 hPLIC_N Ubiquitin-like  26.6      63  0.0014   20.6   2.2   16   81-96     53-68  (71)
109 PF06253 MTTB:  Trimethylamine   26.6      83  0.0018   28.4   3.7   50   48-97     22-85  (505)
110 cd06313 PBP1_ABC_sugar_binding  26.5   1E+02  0.0023   23.7   3.8   36   60-97    164-214 (272)
111 cd00991 PDZ_archaeal_metallopr  26.5      46   0.001   21.6   1.6   21   82-102    22-43  (79)
112 PF14053 DUF4248:  Domain of un  26.5 1.9E+02   0.004   19.3   4.6   50   45-94      1-53  (69)
113 PF01982 CTP-dep_RFKase:  Domai  26.5      46   0.001   24.8   1.7   11   86-96    109-119 (121)
114 PF12990 DUF3874:  Domain of un  26.3      33 0.00072   23.4   0.9   47   41-87     21-68  (73)
115 cd06303 PBP1_LuxPQ_Quorum_Sens  26.2      53  0.0011   25.4   2.1   37   60-97    171-222 (280)
116 cd00990 PDZ_glycyl_aminopeptid  26.1      54  0.0012   20.7   1.9   19   83-101    25-44  (80)
117 PF06300 Tsp45I:  Tsp45I type I  25.8      68  0.0015   27.0   2.8   29   62-90     85-113 (261)
118 PF02073 Peptidase_M29:  Thermo  25.8      90  0.0019   27.2   3.6   28   63-97      3-30  (398)
119 PRK00285 ihfA integration host  25.6      73  0.0016   21.9   2.5   43   51-100     8-50  (99)
120 PF04724 Glyco_transf_17:  Glyc  25.5      73  0.0016   27.5   3.0   21   80-100   168-188 (356)
121 cd06301 PBP1_rhizopine_binding  25.5      52  0.0011   24.9   2.0   21   77-97    196-216 (272)
122 PRK15488 thiosulfate reductase  25.4      58  0.0013   30.0   2.5   18   81-98    673-690 (759)
123 PF10410 DnaB_bind:  DnaB-helic  25.3   1E+02  0.0023   18.6   3.0   26   51-76      5-30  (59)
124 TIGR00353 nrfE c-type cytochro  25.3      70  0.0015   29.5   3.0   22   87-108   456-477 (576)
125 PLN02654 acetate-CoA ligase     25.3      64  0.0014   29.0   2.7   19   79-97    133-151 (666)
126 PRK03760 hypothetical protein;  25.0      64  0.0014   23.5   2.3   16   82-97    100-115 (117)
127 cd06293 PBP1_LacI_like_11 Liga  24.8 1.2E+02  0.0027   22.8   3.9   24   77-100   190-213 (269)
128 TIGR00509 bisC_fam molybdopter  24.8      61  0.0013   30.0   2.6   18   81-98    664-681 (770)
129 TIGR01217 ac_ac_CoA_syn acetoa  24.5      68  0.0015   28.7   2.7   19   79-97    127-145 (652)
130 PF13242 Hydrolase_like:  HAD-h  24.5      48   0.001   21.2   1.4   21   79-99     10-30  (75)
131 PF12143 PPO1_KFDV:  Protein of  24.4      55  0.0012   24.5   1.8   21   75-95     89-109 (130)
132 PF07775 PaRep2b:  PaRep2b prot  24.4 4.2E+02  0.0091   24.5   7.6   85   18-105   295-404 (512)
133 PF08922 DUF1905:  Domain of un  24.3      65  0.0014   21.7   2.0   20   77-96     58-78  (80)
134 cd04867 TGS_YchF_C TGS_YchF_C:  24.2      85  0.0018   22.1   2.6    9   88-96     73-81  (83)
135 PRK10113 cell division modulat  24.1      47   0.001   23.0   1.3   37   43-79     35-77  (80)
136 cd06274 PBP1_FruR Ligand bindi  24.0 1.3E+02  0.0028   22.7   3.9   23   76-98    190-212 (264)
137 COG2411 Uncharacterized conser  24.0 1.2E+02  0.0025   24.5   3.7   29   79-109    82-112 (188)
138 PRK10050 curli assembly protei  24.0 2.7E+02  0.0059   21.3   5.5   46   61-106    62-107 (138)
139 PRK10377 PTS system glucitol/s  23.9      80  0.0017   23.3   2.6   17   87-103    51-67  (120)
140 PF10431 ClpB_D2-small:  C-term  23.9 1.4E+02   0.003   19.4   3.6   20   77-96     62-81  (81)
141 cd01815 BMSC_UbP_N Ubiquitin-l  23.8      74  0.0016   21.7   2.3   17   80-96     56-72  (75)
142 TIGR02166 dmsA_ynfE anaerobic   23.8      52  0.0011   30.4   1.9   18   81-98    712-729 (797)
143 COG0611 ThiL Thiamine monophos  23.8      53  0.0012   28.1   1.9   18   81-98    141-158 (317)
144 cd01809 Scythe_N Ubiquitin-lik  23.6      79  0.0017   19.6   2.2   17   80-96     53-69  (72)
145 TIGR00849 gutA PTS system, glu  23.3      84  0.0018   23.3   2.6   17   87-103    51-67  (121)
146 COG2002 AbrB Regulators of sta  23.3      67  0.0014   22.0   2.0   15   84-98     24-38  (89)
147 TIGR02254 YjjG/YfnB HAD superf  23.2      71  0.0015   23.7   2.3   20   80-99    159-179 (224)
148 PF11302 DUF3104:  Protein of u  23.2      58  0.0013   22.6   1.6   14   87-100     5-18  (75)
149 PRK06342 transcription elongat  23.1      89  0.0019   24.0   2.8   16   87-102   140-155 (160)
150 TIGR01509 HAD-SF-IA-v3 haloaci  23.1      87  0.0019   22.3   2.6   21   80-100   147-167 (183)
151 cd01810 ISG15_repeat2 ISG15 ub  23.0      81  0.0018   20.3   2.3   16   81-96     52-67  (74)
152 PF14250 AbrB-like:  AbrB-like   23.0      69  0.0015   22.0   1.9   13   84-96     49-61  (71)
153 PF04246 RseC_MucC:  Positive r  22.9      54  0.0012   23.7   1.5   14   84-97     48-61  (135)
154 cd06297 PBP1_LacI_like_12 Liga  22.8 1.2E+02  0.0025   23.2   3.5   23   77-99    193-215 (269)
155 TIGR01923 menE O-succinylbenzo  22.8      81  0.0018   25.6   2.7   17   81-97     14-30  (436)
156 cd01803 Ubiquitin Ubiquitin. U  22.7      83  0.0018   19.7   2.2   16   81-96     54-69  (76)
157 PRK14132 riboflavin kinase; Pr  22.7      67  0.0014   24.1   2.0   11   86-96    114-124 (126)
158 TIGR02316 propion_prpE propion  22.6      79  0.0017   27.9   2.8   19   79-97     96-114 (628)
159 cd00591 HU_IHF Integration hos  22.6   1E+02  0.0022   20.1   2.7   43   51-100     5-47  (87)
160 cd08188 Fe-ADH4 Iron-containin  22.4      70  0.0015   27.1   2.3   43   50-92    295-346 (377)
161 PF02424 ApbE:  ApbE family;  I  22.3      23 0.00051   28.5  -0.6   32   65-99    117-148 (254)
162 COG1021 EntE Peptide arylation  22.3      63  0.0014   29.6   2.1   17   80-96     67-83  (542)
163 cd01540 PBP1_arabinose_binding  22.2      65  0.0014   24.7   1.9   22   76-97    206-227 (289)
164 COG4043 Preprotein translocase  22.2      74  0.0016   23.6   2.1   15   84-98     30-44  (111)
165 TIGR03145 cyt_nit_nrfE cytochr  22.0      95  0.0021   29.0   3.2   44   67-110   481-536 (628)
166 PLN00045 photosystem I reactio  22.0      75  0.0016   23.2   2.0   21   86-106    38-58  (101)
167 cd01807 GDX_N ubiquitin-like d  22.0      88  0.0019   20.1   2.3   17   80-96     53-69  (74)
168 PF00240 ubiquitin:  Ubiquitin   21.9      41  0.0009   20.9   0.7   16   81-96     49-64  (69)
169 PRK10369 heme lyase subunit Nr  21.9      86  0.0019   29.0   2.9   44   67-110   417-472 (571)
170 cd06280 PBP1_LacI_like_4 Ligan  21.8      63  0.0014   24.4   1.8   41   60-100   153-208 (263)
171 cd00136 PDZ PDZ domain, also c  21.7      69  0.0015   19.6   1.7   17   85-101    28-45  (70)
172 cd01800 SF3a120_C Ubiquitin-li  21.7      87  0.0019   20.3   2.2   16   81-96     51-66  (76)
173 PF01041 DegT_DnrJ_EryC1:  DegT  21.7 1.3E+02  0.0027   25.0   3.7   25   77-101    51-75  (363)
174 TIGR03354 VI_FHA type VI secre  21.6      97  0.0021   27.0   3.1   18   88-105    86-103 (396)
175 TIGR02693 arsenite_ox_L arseni  21.5      77  0.0017   30.0   2.6   17   81-97    732-748 (806)
176 PF13419 HAD_2:  Haloacid dehal  21.4      65  0.0014   22.2   1.6   20   80-99    140-159 (176)
177 PRK05609 nusG transcription an  21.4      84  0.0018   23.5   2.4   34   64-98    104-137 (181)
178 PF15007 CEP44:  Centrosomal sp  21.3      41 0.00088   25.5   0.6   30   64-93      3-32  (131)
179 PRK03584 acetoacetyl-CoA synth  21.2      88  0.0019   27.7   2.8   19   79-97    127-145 (655)
180 PF05896 NQRA:  Na(+)-transloca  21.2      85  0.0018   26.3   2.5   18   85-102    42-59  (257)
181 PRK13532 nitrate reductase cat  21.1      64  0.0014   30.2   2.0   17   81-97    753-769 (830)
182 cd01806 Nedd8 Nebb8-like  ubiq  21.1      94   0.002   19.4   2.2   16   81-96     54-69  (76)
183 COG4766 EutQ Ethanolamine util  20.9      68  0.0015   25.5   1.8   13   85-97    137-149 (176)
184 PRK10524 prpE propionyl-CoA sy  20.8      91   0.002   27.3   2.7   18   80-97     98-115 (629)
185 PLN02860 o-succinylbenzoate-Co  20.7      90   0.002   26.9   2.7   19   79-97     45-63  (563)
186 cd06285 PBP1_LacI_like_7 Ligan  20.3      72  0.0016   24.1   1.8   21   77-97    188-208 (265)
187 COG1827 Predicted small molecu  20.3 1.6E+02  0.0035   23.1   3.8   30   45-78    101-130 (168)
188 TIGR02369 trimeth_pyl trimethy  20.3   1E+02  0.0022   28.0   2.9   26   72-97     33-68  (489)
189 cd00987 PDZ_serine_protease PD  20.2      72  0.0016   20.3   1.6   20   83-102    37-57  (90)
190 cd06324 PBP1_ABC_sugar_binding  20.1      65  0.0014   25.4   1.6   23   77-99    215-237 (305)
191 PRK09798 antitoxin MazE; Provi  20.1      95  0.0021   21.3   2.2   15   82-96     21-35  (82)

No 1  
>PF09269 DUF1967:  Domain of unknown function (DUF1967);  InterPro: IPR015349 The Obg family comprises a group of ancient P-loop small G proteins (GTPases) belonging to the TRAFAC (for translation factors) class and can be subdivided into several distinct protein subfamilies []. OBG GTPases have been found in both prokaryotes and eukaryotes []. The structure of the OBG GTPase from Thermus thermophilus has been determined []. This entry represents a C-terminal domain found in certain OBG GTPases. This domain contains a four-stranded beta sheet and three alpha helices flanked by an additional beta strand. It is predominantly found in the bacterial GTP-binding protein Obg, and is functionally uncharacterised. ; GO: 0000166 nucleotide binding; PDB: 1UDX_A.
Probab=99.96  E-value=2.3e-29  Score=169.44  Aligned_cols=69  Identities=45%  Similarity=0.672  Sum_probs=60.5

Q ss_pred             cEEEEcCCCCeEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEEEEE
Q 044269           34 FEIFHDSGSNTWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDMEMVW  103 (129)
Q Consensus        34 f~I~k~~e~g~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~EFey  103 (129)
                      |+|+++ ++|+|+|+|++||++++||||+++||+.||+++|+++||+++|+++||++||||+||++||+|
T Consensus         1 F~I~~~-~~g~~~V~g~~ie~~~~~~~~~~~e~~~rf~~~L~~~Gv~~~L~~~G~~~GD~V~Ig~~eFe~   69 (69)
T PF09269_consen    1 FEIERE-DEGVFVVEGPKIERLVAMTNFDDEESLRRFQRKLKKMGVEKALRKAGAKEGDTVRIGDYEFEY   69 (69)
T ss_dssp             -EEEEE-ETTEEEEE-HHHHHHHTTEEE-TGGGHHHHHHHHHHTTHHHHHHTTT--TT-EEEETTEEEE-
T ss_pred             CEEEEc-CCceEEEEChHHHHHHHhcCCCCHHHHHHHHHHHHHCCHHHHHHHcCCCCCCEEEEcCEEEEC
Confidence            789997 579999999999999999999999999999999999999999999999999999999999998


No 2  
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=99.96  E-value=9.4e-29  Score=166.64  Aligned_cols=69  Identities=39%  Similarity=0.658  Sum_probs=66.2

Q ss_pred             cEEEEcCCCCeEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEEEEE
Q 044269           34 FEIFHDSGSNTWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDMEMVW  103 (129)
Q Consensus        34 f~I~k~~e~g~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~EFey  103 (129)
                      |+|++. ++|+|+|+|++|||+++||||+++||+.||+++|+++||+++|+++||++||||+||++||+|
T Consensus         1 f~i~~~-~~~~~~V~g~~ier~~~~~~~~~~e~~~~f~~~L~~~Gv~~~L~~~G~~~GD~V~Ig~~eFe~   69 (69)
T TIGR03595         1 FEIERD-EDGVFVVSGKKIERWVAKTPFNNDENLRRFARKLKKLGVEDALRKAGAKDGDTVRIGDFEFEW   69 (69)
T ss_pred             CEEEEC-CCCeEEEechHHHHHHHHcCCCCHHHHHHHHHHHHHCCHHHHHHHcCCCCCCEEEEccEEEeC
Confidence            578886 578999999999999999999999999999999999999999999999999999999999997


No 3  
>PRK12297 obgE GTPase CgtA; Reviewed
Probab=99.83  E-value=1.7e-20  Score=161.81  Aligned_cols=73  Identities=38%  Similarity=0.632  Sum_probs=69.1

Q ss_pred             CCcEEEEcCCCCeEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEEEEEEe
Q 044269           32 NDFEIFHDSGSNTWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDMEMVWHD  105 (129)
Q Consensus        32 ~~f~I~k~~e~g~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~EFey~e  105 (129)
                      ++|.|.+. ++|.|+|.|++||++++||||+++|++.||+++|+++||+++|+++||++||+|+||++||+|++
T Consensus       352 ~~~~~~~~-~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~gv~~~l~~~g~~~gd~v~i~~~~f~~~~  424 (424)
T PRK12297        352 KDFTITRD-EDGVFVVSGEKIERLFKMTNFNRDESLRRFARQLRKMGVDDALREAGAKDGDTVRIGDFEFEFVD  424 (424)
T ss_pred             CCcEEEEC-CCCcEEEeChHHHHHHhhccCCCHHHHHHHHHHHHHCCHHHHHHHCCCCCCCEEEECCEEEEEeC
Confidence            46888876 57899999999999999999999999999999999999999999999999999999999999974


No 4  
>PRK12296 obgE GTPase CgtA; Reviewed
Probab=99.80  E-value=2.2e-19  Score=157.97  Aligned_cols=76  Identities=25%  Similarity=0.488  Sum_probs=71.1

Q ss_pred             CCcEEEEcCCC--CeEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEc---CEEEEEEec
Q 044269           32 NDFEIFHDSGS--NTWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVG---DMEMVWHDS  106 (129)
Q Consensus        32 ~~f~I~k~~e~--g~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IG---d~EFey~ed  106 (129)
                      ..|+|.++ ++  |.|+|.|+++|||++||||+++||+.||+++|+++||+++|+++||++||+|+||   +++|+|++.
T Consensus       364 ~~~~i~~~-~~~~~~~~v~g~~~e~~~~~~~~~~~e~~~~~~~~l~~~gv~~~l~~~g~~~gd~v~i~~~~~~~f~~~~~  442 (500)
T PRK12296        364 AGFTVERD-GDGEGGFRVRGEKPERWVRQTDFDNDEAVGYLADRLARLGVEDELLKAGARPGDAVTIGTGNGVVFDWEPT  442 (500)
T ss_pred             CCcEEEeC-CCCCCcEEEeCchHHHHHhccCCCCHHHHHHHHHHHHHCCHHHHHHHcCCCCCCEEEECCCCCEEEEEeec
Confidence            35899886 45  8999999999999999999999999999999999999999999999999999999   999999987


Q ss_pred             CC
Q 044269          107 AN  108 (129)
Q Consensus       107 ~~  108 (129)
                      ..
T Consensus       443 ~~  444 (500)
T PRK12296        443 TP  444 (500)
T ss_pred             cc
Confidence            54


No 5  
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=86.03  E-value=0.87  Score=31.97  Aligned_cols=15  Identities=40%  Similarity=0.507  Sum_probs=13.1

Q ss_pred             HHHcCCCCCCEEEEc
Q 044269           83 LMKLGVKEGDTVIVG   97 (129)
Q Consensus        83 LkkaGakeGDtV~IG   97 (129)
                      -+..||+.||.|+|=
T Consensus        50 a~~lgak~GdvVkIv   64 (80)
T COG2012          50 AKALGAKPGDVVKIV   64 (80)
T ss_pred             HHHccCCCCcEEEEE
Confidence            577899999999984


No 6  
>PF01568 Molydop_binding:  Molydopterin dinucleotide binding domain;  InterPro: IPR006657 A domain in this entry corresponds to the C-terminal domain IV in dimethyl sulphoxide (DMSO)reductase which interacts with the 2-amino pyrimidone ring of both molybdopterin guanine dinucleotide molecules [].; GO: 0016491 oxidoreductase activity, 0030151 molybdenum ion binding, 0055114 oxidation-reduction process; PDB: 2IVF_A 1OGY_G 3ML1_A 3O5A_A 1TI2_G 1VLE_M 1VLD_U 1VLF_O 1TI4_I 1TI6_E ....
Probab=76.88  E-value=2.4  Score=28.97  Aligned_cols=17  Identities=47%  Similarity=0.691  Sum_probs=12.7

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        37 ~dA~~~Gi~~Gd~V~v~   53 (110)
T PF01568_consen   37 EDAAKLGIKDGDWVRVS   53 (110)
T ss_dssp             HHHHHCT--TTCEEEEE
T ss_pred             HHHHHhcCcCCCEEEEE
Confidence            55688999999999993


No 7  
>PRK09570 rpoH DNA-directed RNA polymerase subunit H; Reviewed
Probab=71.10  E-value=4.6  Score=28.12  Aligned_cols=44  Identities=9%  Similarity=0.122  Sum_probs=25.1

Q ss_pred             EEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEE
Q 044269           46 NVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        46 ~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~I   96 (129)
                      +++-...+.++++++.....    |=+++..==   ..+..|++.||.|+|
T Consensus        17 iLs~eE~~~lL~~y~i~~~q----LP~I~~~DP---v~r~~g~k~GdVvkI   60 (79)
T PRK09570         17 ILSEEEAKKLLKEYGIKPEQ----LPKIKASDP---VVKAIGAKPGDVIKI   60 (79)
T ss_pred             ECCHHHHHHHHHHcCCCHHH----CCceeccCh---hhhhcCCCCCCEEEE
Confidence            44455666677777655322    222222211   223449999999999


No 8  
>cd02787 MopB_CT_ydeP The MopB_CT_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=69.24  E-value=4.7  Score=27.98  Aligned_cols=17  Identities=35%  Similarity=0.649  Sum_probs=13.8

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.||++||.|+|.
T Consensus        38 ~dA~~lgI~dGd~V~v~   54 (112)
T cd02787          38 DDIARLGLKAGDRVDLE   54 (112)
T ss_pred             HHHHHhCCCCCCEEEEE
Confidence            34567799999999985


No 9  
>cd02781 MopB_CT_Acetylene-hydratase The MopB_CT_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins. The acetylene hydratase of Pelobacter acetylenicus is a tungsten iron-sulfur protein involved in the fermentation of acetylene to ethanol and acetate. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=67.17  E-value=5.7  Score=27.99  Aligned_cols=17  Identities=41%  Similarity=0.628  Sum_probs=14.7

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +...+.|+++||.|+|.
T Consensus        40 ~dA~~~gi~~Gd~V~v~   56 (130)
T cd02781          40 ETAAKLGIADGDWVWVE   56 (130)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            56788899999999985


No 10 
>COG1497 Predicted transcriptional regulator [Transcription]
Probab=66.93  E-value=29  Score=29.21  Aligned_cols=63  Identities=24%  Similarity=0.340  Sum_probs=47.2

Q ss_pred             EEEcCCCCeEEEEcchHHHHHHhcCCCCHHHHHHHHH----HHHHCChHHHHHHcCCCCCCEEEEc---CEEEEEE
Q 044269           36 IFHDSGSNTWNVVGAGLQRFVQMTNWRYLDSERRFQH----GLEACGVTKSLMKLGVKEGDTVIVG---DMEMVWH  104 (129)
Q Consensus        36 I~k~~e~g~f~V~G~~IEr~v~~tnfd~~es~~rF~r----~Lk~~GV~~aLkkaGakeGDtV~IG---d~EFey~  104 (129)
                      |.+. ..|.|+|+=+..|.+.+.++     .+++|.+    .|...-++.|.-+.-|++||+|...   ++-+-+.
T Consensus        55 i~~~-gR~~Y~iTkkG~e~l~~~~~-----dlr~f~~ev~~~l~~~~vw~AIA~edI~~Gd~V~L~M~dG~LyA~~  124 (260)
T COG1497          55 IEKE-GRGEYEITKKGAEWLLEQLS-----DLRRFSEEVELVLDYVMVWTAIAKEDIKEGDTVYLRMKDGYLYASR  124 (260)
T ss_pred             eeec-CCeeEEEehhHHHHHHHHHH-----HHHHHHHHHHHHHhhHHHHHHhhHhhhccCCEEEEEecCcEEEEec
Confidence            4443 36689999999999987764     5555554    4577889999999999999999873   5555543


No 11 
>cd02786 MopB_CT_3 The MopB_CT_3 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=65.54  E-value=6.3  Score=27.20  Aligned_cols=17  Identities=29%  Similarity=0.438  Sum_probs=14.1

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        38 ~dA~~lgi~~Gd~V~v~   54 (116)
T cd02786          38 ADAAARGIADGDLVVVF   54 (116)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45677899999999984


No 12 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=64.50  E-value=4  Score=27.15  Aligned_cols=29  Identities=28%  Similarity=0.368  Sum_probs=21.4

Q ss_pred             hHHHHHHcCCCCCCEEEE-cCEEEEEEecC
Q 044269           79 VTKSLMKLGVKEGDTVIV-GDMEMVWHDSA  107 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~I-Gd~EFey~ed~  107 (129)
                      |...+--.||++||.+.| .+..|...++.
T Consensus        25 vp~~~LP~~~keGDvl~i~~~~~~~~d~ee   54 (71)
T PF11213_consen   25 VPRSRLPEGAKEGDVLEIGEDGSIEIDPEE   54 (71)
T ss_pred             EEHHHCCCCCCcccEEEECCCceEEECHHH
Confidence            344455579999999999 78788775543


No 13 
>TIGR00030 S21p ribosomal protein S21. This model describes bacterial ribosomal protein S21 and most mitochondrial and chloroplast equivalents.
Probab=63.75  E-value=11  Score=24.57  Aligned_cols=23  Identities=35%  Similarity=0.455  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHCChHHHHHHc
Q 044269           64 LDSERRFQHGLEACGVTKSLMKL   86 (129)
Q Consensus        64 ~es~~rF~r~Lk~~GV~~aLkka   86 (129)
                      +.++.+|.+.+.+-||.+.+++.
T Consensus        12 e~alrrfkr~~~~~gil~e~r~r   34 (58)
T TIGR00030        12 DSALRRFKRKLEKEGILRELKKR   34 (58)
T ss_pred             HHHHHHHHHHHHHcchHHHHHHH
Confidence            46889999999999999999864


No 14 
>cd02791 MopB_CT_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite. Monomeric Nas is located in the cytoplasm and participates in nitrogen assimilation. Dimeric Nap is located in the periplasm and is coupled to quinol oxidation via a membrane-anchored tetraheme cytochrome. This CD (MopB_CT_Nitrate-R-Nap) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs
Probab=62.98  E-value=7.6  Score=26.90  Aligned_cols=17  Identities=47%  Similarity=0.687  Sum_probs=14.6

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        42 ~dA~~lgi~~Gd~V~v~   58 (122)
T cd02791          42 EDAARLGLKEGDLVRVT   58 (122)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45788999999999984


No 15 
>cd02790 MopB_CT_Formate-Dh_H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is a monomer composed of a single polypeptide chain with a  Mo active site region and a [4Fe-4S] center. This CD (MopB_CT_Formate-Dh_H) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=62.88  E-value=7.7  Score=26.56  Aligned_cols=18  Identities=28%  Similarity=0.632  Sum_probs=14.8

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +-.++.|+++||.|+|..
T Consensus        42 ~dA~~lgi~~Gd~V~v~~   59 (116)
T cd02790          42 EDAKRLGIEDGEKVRVSS   59 (116)
T ss_pred             HHHHHcCCCCCCEEEEEc
Confidence            446788999999999853


No 16 
>cd00508 MopB_CT_Fdh-Nap-like This CD includes formate dehydrogenases (Fdh) H and N; nitrate reductases, Nap and Nas; and other related proteins. Formate dehydrogenase H is a component of the anaerobic formate hydrogen lyase complex  and catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. Formate dehydrogenase N (alpha subunit) is the major electron donor to the bacterial nitrate respiratory chain and nitrate reductases, Nap and Nas, catalyze the reduction of nitrate to nitrite. This CD (MopB_CT_Fdh-Nap-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=62.79  E-value=7.7  Score=26.57  Aligned_cols=18  Identities=39%  Similarity=0.693  Sum_probs=14.9

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +..++.|+++||.|+|..
T Consensus        42 ~dA~~lgi~~Gd~V~v~~   59 (120)
T cd00508          42 EDAARLGIKDGDLVRVSS   59 (120)
T ss_pred             HHHHHcCCCCCCEEEEEe
Confidence            456788999999999853


No 17 
>cd02777 MopB_CT_DMSOR-like The MopB_CT_DMSOR-like CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR),  trimethylamine N-oxide reductase (TMAOR) and other related proteins. DMSOR always catalyzes the reduction of DMSO to dimethylsulfide, but its cellular location and oligomerization state are organism-dependent. For example, in Rhodobacter sphaeriodes and Rhodobacter capsulatus, it is an 82-kDa monomeric soluble protein found in the periplasmic space; in E. coli, it is membrane-bound and exists as a heterotrimer. BSOR catalyzes the reduction of biotin sulfixode to biotin, and is unique among Mo enzymes because no additional auxiliary proteins or cofactors are required. TMAOR is similar to DMSOR, but its only natural substrate is TMAO. Also included in this group is the pyrogallol-phloroglucinol transhydroxylase from Pelobacter acidigallici. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB hom
Probab=61.46  E-value=8.1  Score=27.34  Aligned_cols=17  Identities=35%  Similarity=0.382  Sum_probs=14.6

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        41 ~dA~~lgi~~Gd~V~v~   57 (127)
T cd02777          41 LDAAARGIKDGDIVRVF   57 (127)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            55778999999999984


No 18 
>cd02785 MopB_CT_4 The MopB_CT_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=60.20  E-value=8.8  Score=27.04  Aligned_cols=17  Identities=29%  Similarity=0.270  Sum_probs=14.4

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        39 ~dA~~~gi~~Gd~V~v~   55 (124)
T cd02785          39 IDAAARGIAHGDLVEVY   55 (124)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45678899999999985


No 19 
>cd02789 MopB_CT_FmdC-FwdD The MopB_FmdC-FwdD CD includes the  C-terminus of subunit C of molybdenum formylmethanofuran dehydrogenase (FmdC) and subunit D of tungsten formylmethanofuran dehydrogenase (FwdD), and other related proteins. Formylmethanofuran dehydrogenase catalyzes the first step in methane formation from CO2 in methanogenic archaea and some eubacteria. Members of this CD belong to the molybdopterin_binding superfamily of proteins. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=59.93  E-value=9.5  Score=26.69  Aligned_cols=17  Identities=41%  Similarity=0.493  Sum_probs=14.4

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        38 ~dA~~lgi~~Gd~V~v~   54 (106)
T cd02789          38 EDYKLLGKPEGDKVKVT   54 (106)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45788899999999884


No 20 
>cd02794 MopB_CT_DmsA-EC The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted N-terminal iron-sulfur [4Fe-4S] cluster binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=59.86  E-value=9.1  Score=26.87  Aligned_cols=17  Identities=35%  Similarity=0.491  Sum_probs=14.1

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|-
T Consensus        37 ~~A~~~gi~~Gd~V~v~   53 (121)
T cd02794          37 LDAAARGIKDGDRVLVF   53 (121)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            34678899999999984


No 21 
>cd02775 MopB_CT Molybdopterin-Binding, C-terminal (MopB_CT) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and tungsten-containing enzymes, including formate dehydrogenase-H (Fdh-H) and -N (Fdh-N), several forms of nitrate reductase (Nap, Nas, NarG), dimethylsulfoxide reductase (DMSOR), thiosulfate reductase, formylmethanofuran dehydrogenase, and arsenite oxidase. Molybdenum is present in most of these enzymes in the form of molybdopterin, a modified pterin ring with a dithiolene side chain, which is responsible for ligating the Mo. In many bacterial and archaeal species, molybdopterin is in the form of a dinucleotide, with two molybdopterin dinucleotide units per molybdenum. These proteins can function as monomers, heterodimers, or heterotrimers, depending on the protein and organism. Also included in the MopB superfamily is
Probab=59.13  E-value=10  Score=25.08  Aligned_cols=17  Identities=41%  Similarity=0.640  Sum_probs=13.9

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|.|.
T Consensus        30 ~da~~lgl~~Gd~v~v~   46 (101)
T cd02775          30 EDAAALGIKDGDLVRVE   46 (101)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            34668899999999874


No 22 
>cd02776 MopB_CT_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins. Under anaerobic conditions in the presence of nitrate, E. coli synthesizes the cytoplasmic membrane-bound quinol-nitrate oxidoreductase (NarGHI), which reduces nitrate to nitrite and forms part of a redox loop generating a proton-motive force. Found in prokaryotes and some archaea, NarGHI usually functions as a heterotrimer. The alpha chain contains the molybdenum cofactor-containing Mo-bisMGD catalytic subunit. This CD (MopB_CT_Nitrate-R-NarG-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=57.97  E-value=10  Score=28.14  Aligned_cols=17  Identities=41%  Similarity=0.454  Sum_probs=14.5

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        38 ~dA~~lgI~dGd~V~v~   54 (141)
T cd02776          38 KDAAELGIKDNDWVEVF   54 (141)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45788899999999984


No 23 
>cd02788 MopB_CT_NDH-1_NuoG2-N7 MopB_CT_NDH-1_NuoG2-N7: C-terminal region of the NuoG-like subunit (of the variant with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria. The NDH-1 is the first energy-transducting complex in the respiratory chain and functions as a redox pump that uses the redox energy to translocate H+ ions across the membrane, resulting in a significant contribution to energy production. In Escherichia coli NDH-1, the largest subunit is encoded by the nuoG gene, and is part of the 14 distinct subunits constituting the functional enzyme. The NuoG subunit is made of two domains: the first contains three binding sites for FeS clusters (the fer2 domain), the second domain, is of unknown function or, as postulated, has lost an ancestral formate dehydrogenase activity that became redundant during the evolution of the complex I enzyme. Unique to this group, compared to the other prokaryotic and eukaryotic groups
Probab=57.60  E-value=11  Score=25.72  Aligned_cols=16  Identities=31%  Similarity=0.567  Sum_probs=13.4

Q ss_pred             HHHHcCCCCCCEEEEc
Q 044269           82 SLMKLGVKEGDTVIVG   97 (129)
Q Consensus        82 aLkkaGakeGDtV~IG   97 (129)
                      ..++.|+++||.|+|.
T Consensus        37 dA~~lGi~~Gd~V~v~   52 (96)
T cd02788          37 DAARLGLADGDLVEFS   52 (96)
T ss_pred             HHHHcCCCCCCEEEEE
Confidence            4677899999999984


No 24 
>cd02792 MopB_CT_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a  functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. This CD (MopB_CT_Formate-Dh-Na-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=57.59  E-value=11  Score=26.08  Aligned_cols=17  Identities=35%  Similarity=0.513  Sum_probs=14.2

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +.-++.|+++||.|+|.
T Consensus        42 ~dA~~lgi~~Gd~V~v~   58 (122)
T cd02792          42 ELAAERGIKNGDMVWVS   58 (122)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            35678899999999985


No 25 
>cd02793 MopB_CT_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR),  trimethylamine N-oxide reductase (TMAOR) and other related proteins. DMSOR always catalyzes the reduction of DMSO to dimethylsulfide, but its cellular location and oligomerization state are organism-dependent. For example, in Rhodobacter sphaeriodes and Rhodobacter capsulatus, it is an 82-kDa monomeric soluble protein found in the periplasmic space; in E. coli, it is membrane-bound and exists as a heterotrimer. BSOR catalyzes the reduction of biotin sulfixode to biotin, and is unique among Mo enzymes because no additional auxiliary proteins or cofactors are required. TMAOR is similar to DMSOR, but its only natural substrate is TMAO.This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=57.53  E-value=11  Score=26.97  Aligned_cols=18  Identities=28%  Similarity=0.366  Sum_probs=14.6

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +...+.|+++||.|+|.+
T Consensus        40 ~dA~~~gi~~Gd~V~v~s   57 (129)
T cd02793          40 ADAAARGIADGDIVRVFN   57 (129)
T ss_pred             HHHHHcCCCCCCEEEEEc
Confidence            346788999999999853


No 26 
>cd02784 MopB_CT_PHLH The MopB_CT_PHLH CD includes a group of related uncharacterized putative hydrogenase-like homologs (PHLH) of molybdopterin binding proteins. This CD is of the PHLH region homologous to the conserved molybdopterin-binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=57.18  E-value=10  Score=28.23  Aligned_cols=18  Identities=28%  Similarity=0.503  Sum_probs=14.7

Q ss_pred             HHHHHHcCCCCCCEEEEc
Q 044269           80 TKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IG   97 (129)
                      -+...+.||++||.|+|.
T Consensus        44 P~dA~~lGI~dGD~V~V~   61 (137)
T cd02784          44 PRTAEALGLLQGDVVRIR   61 (137)
T ss_pred             HHHHHHcCCCCCCEEEEE
Confidence            355677799999999995


No 27 
>PRK00270 rpsU 30S ribosomal protein S21; Reviewed
Probab=57.01  E-value=16  Score=24.18  Aligned_cols=23  Identities=26%  Similarity=0.462  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHCChHHHHHHc
Q 044269           64 LDSERRFQHGLEACGVTKSLMKL   86 (129)
Q Consensus        64 ~es~~rF~r~Lk~~GV~~aLkka   86 (129)
                      +.|+.+|.+.+.+-||...+++.
T Consensus        13 e~Alrrfkr~~~k~gil~e~r~r   35 (64)
T PRK00270         13 DKALRRFKRKVEKAGILRELRRR   35 (64)
T ss_pred             HHHHHHHHHHHHHcchHHHHHHH
Confidence            46889999999999999998863


No 28 
>cd02783 MopB_CT_2 The MopB_CT_2 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=56.97  E-value=10  Score=28.28  Aligned_cols=18  Identities=44%  Similarity=0.656  Sum_probs=15.1

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +..++.||++||.|+|..
T Consensus        39 ~dA~~~GI~dGd~V~v~s   56 (156)
T cd02783          39 KTAKELGIKDGDWVWVES   56 (156)
T ss_pred             HHHHHcCCCCCCEEEEEc
Confidence            556788999999999963


No 29 
>PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=55.99  E-value=14  Score=22.28  Aligned_cols=15  Identities=47%  Similarity=0.607  Sum_probs=12.0

Q ss_pred             HHHHcCCCCCCEEEE
Q 044269           82 SLMKLGVKEGDTVIV   96 (129)
Q Consensus        82 aLkkaGakeGDtV~I   96 (129)
                      -+++.|+++||.|.|
T Consensus        15 ~~~~l~l~~Gd~v~i   29 (47)
T PF04014_consen   15 IREKLGLKPGDEVEI   29 (47)
T ss_dssp             HHHHTTSSTTTEEEE
T ss_pred             HHHHcCCCCCCEEEE
Confidence            356679999999875


No 30 
>cd02779 MopB_CT_Arsenite-Ox This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of Arsenite oxidase (Arsenite-Ox) and related proteins. Arsenite oxidase oxidizes arsenite to the less toxic arsenate; it transfers the electrons obtained from the oxidation of arsenite towards the soluble periplasmic electron carriers cytochrome c and/or amicyanin.
Probab=55.68  E-value=12  Score=26.20  Aligned_cols=17  Identities=35%  Similarity=0.425  Sum_probs=14.2

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..++.|+++||.|+|.
T Consensus        40 ~dA~~lgi~~Gd~V~v~   56 (115)
T cd02779          40 EDAKREGLKNGDLVEVY   56 (115)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45678899999999984


No 31 
>cd02778 MopB_CT_Thiosulfate-R-like The MopB_CT_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins. Thiosulfate reductase catalyzes the cleavage of sulfur-sulfur bonds in thiosulfate. Polysulfide reductase is a membrane-bound enzyme that catalyzes the reduction of polysulfide using either hydrogen or formate as the electron donor. Also included in this CD is the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), which has been characterized as a membrane-bound molybdenum-iron-sulfur enzyme involved in anaerobic metabolism of phenylalanine in the denitrifying bacterium Thauera aromatica. The MopB_CT_Thiosulfate-R-like CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=55.42  E-value=12  Score=25.95  Aligned_cols=16  Identities=44%  Similarity=0.798  Sum_probs=13.6

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +...+.|+++||.|+|
T Consensus        37 ~dA~~~gi~~Gd~V~v   52 (123)
T cd02778          37 ETAARLGIKDGDRVEV   52 (123)
T ss_pred             HHHHHcCCCCCCEEEE
Confidence            3467789999999998


No 32 
>COG1153 FwdD Formylmethanofuran dehydrogenase subunit D [Energy production and conversion]
Probab=54.00  E-value=11  Score=28.52  Aligned_cols=17  Identities=47%  Similarity=0.731  Sum_probs=13.5

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +-|++.|+++||+|++-
T Consensus        38 ~D~~~Lgv~EGD~VkVk   54 (128)
T COG1153          38 EDMKQLGVSEGDKVKVK   54 (128)
T ss_pred             HHHHHhCCCcCCeEEEE
Confidence            44666799999999973


No 33 
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=53.95  E-value=10  Score=26.05  Aligned_cols=14  Identities=43%  Similarity=0.496  Sum_probs=9.5

Q ss_pred             HHcCCCCCCEEEEc
Q 044269           84 MKLGVKEGDTVIVG   97 (129)
Q Consensus        84 kkaGakeGDtV~IG   97 (129)
                      +-.|++.||.|+|-
T Consensus        45 r~~g~k~GdVvkI~   58 (74)
T PF01191_consen   45 RYLGAKPGDVVKII   58 (74)
T ss_dssp             HHTT--TTSEEEEE
T ss_pred             hhcCCCCCCEEEEE
Confidence            33499999999994


No 34 
>cd02782 MopB_CT_1 The MopB_CT_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=52.78  E-value=14  Score=26.08  Aligned_cols=17  Identities=35%  Similarity=0.552  Sum_probs=14.2

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +...+.|+++||.|+|-
T Consensus        40 ~dA~~~gi~~Gd~V~v~   56 (129)
T cd02782          40 DDAAALGLADGDKVRVT   56 (129)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45678899999999984


No 35 
>COG2746 Aminoglycoside N3'-acetyltransferase [Defense mechanisms]
Probab=52.59  E-value=13  Score=31.15  Aligned_cols=25  Identities=48%  Similarity=0.634  Sum_probs=20.0

Q ss_pred             HHHHCChHHHHHHcCCCCCCEEEEc
Q 044269           73 GLEACGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        73 ~Lk~~GV~~aLkkaGakeGDtV~IG   97 (129)
                      ..-+.-+.+.|++.|+|+||||.+.
T Consensus        11 ~~s~~~l~~~l~~lG~k~G~~v~vH   35 (251)
T COG2746          11 PRSSQDLKDDLYKLGLKEGDTVIVH   35 (251)
T ss_pred             cccHHHHHHHHHHhcCCCCCEEEEe
Confidence            3344557889999999999999875


No 36 
>PF03990 DUF348:  Domain of unknown function (DUF348)     ;  InterPro: IPR007137 This domain normally occurs as tandem repeats; however it is found as a single copy in the Saccharomyces cerevisiae (Baker's yeast) DNA-binding nuclear protein YCR593 (P25357 from SWISSPROT).
Probab=51.26  E-value=16  Score=21.86  Aligned_cols=19  Identities=37%  Similarity=0.522  Sum_probs=14.3

Q ss_pred             CChHHHHHHcCCC--CCCEEE
Q 044269           77 CGVTKSLMKLGVK--EGDTVI   95 (129)
Q Consensus        77 ~GV~~aLkkaGak--eGDtV~   95 (129)
                      .-|.++|+++||.  +.|.|.
T Consensus        18 ~tV~~~L~~~gI~l~~~D~v~   38 (43)
T PF03990_consen   18 STVGDALKELGITLGEEDKVS   38 (43)
T ss_pred             CCHHHHHHhCCCCCCCCCEEe
Confidence            3477889999988  777764


No 37 
>PF10015 DUF2258:  Uncharacterized protein conserved in archaea (DUF2258);  InterPro: IPR017140 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.75  E-value=19  Score=25.00  Aligned_cols=34  Identities=18%  Similarity=0.149  Sum_probs=22.7

Q ss_pred             CHHHHHHHHHHHHHCChHHHHH-HcCCCCCCEEEEc
Q 044269           63 YLDSERRFQHGLEACGVTKSLM-KLGVKEGDTVIVG   97 (129)
Q Consensus        63 ~~es~~rF~r~Lk~~GV~~aLk-kaGakeGDtV~IG   97 (129)
                      .++-+.|=.-.|.+. +.+.|. ++|+..||.|+|-
T Consensus        29 ~~~ei~ra~aeLNk~-ly~~lv~~~~i~K~DVVRI~   63 (75)
T PF10015_consen   29 PPEEIVRAAAELNKK-LYEKLVNKMKIDKLDVVRIR   63 (75)
T ss_pred             CHHHHHHHHHHHHHH-HHHHHHHHhCCCcccEEEEE
Confidence            444444444444443 566777 9999999999973


No 38 
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]
Probab=47.36  E-value=19  Score=30.34  Aligned_cols=20  Identities=45%  Similarity=0.594  Sum_probs=15.1

Q ss_pred             HHHHHHcCCCCCCEEEEcCE
Q 044269           80 TKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IGd~   99 (129)
                      .+.|.++||..+|||.++|-
T Consensus        79 a~~~~~~GI~~d~tVVvYdd   98 (285)
T COG2897          79 AKLLGELGIRNDDTVVVYDD   98 (285)
T ss_pred             HHHHHHcCCCCCCEEEEECC
Confidence            34556668889999999873


No 39 
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion]
Probab=46.92  E-value=19  Score=31.74  Aligned_cols=22  Identities=27%  Similarity=0.280  Sum_probs=18.9

Q ss_pred             HcCCCCCCEEEEcCEEEEEEec
Q 044269           85 KLGVKEGDTVIVGDMEMVWHDS  106 (129)
Q Consensus        85 kaGakeGDtV~IGd~EFey~ed  106 (129)
                      -.=++.||++.||+.+++|.+.
T Consensus       121 ~~ivk~Gd~ldlGg~tL~Fi~a  142 (388)
T COG0426         121 FKIVKTGDTLDLGGHTLKFIPA  142 (388)
T ss_pred             eeecCCCCEeccCCcEEEEEeC
Confidence            4458999999999999998765


No 40 
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional
Probab=45.43  E-value=1e+02  Score=25.46  Aligned_cols=57  Identities=14%  Similarity=0.235  Sum_probs=37.6

Q ss_pred             EEEcCCCCeEEEEcch-HHHHHHhcCCC----CHHHHHHHHHHHHHCChHHHHHHcCC--CCCCEEEEcCEEEEEE
Q 044269           36 IFHDSGSNTWNVVGAG-LQRFVQMTNWR----YLDSERRFQHGLEACGVTKSLMKLGV--KEGDTVIVGDMEMVWH  104 (129)
Q Consensus        36 I~k~~e~g~f~V~G~~-IEr~v~~tnfd----~~es~~rF~r~Lk~~GV~~aLkkaGa--keGDtV~IGd~EFey~  104 (129)
                      |.+. ++|.|.|.|.- |+.+...++++    .++.+.=|  +         |...|-  +.||+|.++++.|+-.
T Consensus       204 i~~~-~~~~~~v~G~~~l~dl~~~l~~~l~~~~~~Tl~G~--i---------~~~l~~iP~~Gd~i~~~~~~f~V~  267 (292)
T PRK15094        204 FRQL-SRHTWTVRALASIEDFNEAFGTHFSDEEVDTIGGL--V---------MQAFGHLPARGETIDIDGYQFKVA  267 (292)
T ss_pred             cEEe-CCCeEEEEeccCHHHHHHHhCCCCCCCCCccHHHH--H---------HHHhCcCCCCCCEEEECCEEEEEE
Confidence            5554 47899999974 66666666654    33344322  1         222243  8999999999999943


No 41 
>PF01628 HrcA:  HrcA protein C terminal domain;  InterPro: IPR021153 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress. Commonly, they induce a set of proteins that protect cellular proteins from being denatured by heat. Among such proteins are the GroE and DnaK chaperones whose transcription is regulated by a heat-shock repressor protein HrcA. HrcA is a winged helix-turn-helix repressor that negatively regulates the transcription of dnaK and groE operons by binding the upstream CIRCE (controlling inverted repeat of chaperone expression) element. In Bacillus subtilis this element is a perfect 9 base pair inverted repeat separated by a 9 base pair spacer.   The crystal structure of a heat-inducible transcriptional repressor, HrcA, from Thermotoga maritima has been reported at 2.2A resolution. HrcA is composed of three domains: an N-terminal winged helix-turn-helix domain (WHTH), a GAF-like domain, and an inserted dimerizing domain (IDD). The IDD shows a unique structural fold with an anti-parallel beta-sheet composed of three beta-strands sided by four alpha-helices. HrcA crystallises as a dimer, which is formed through hydrophobic contact between the IDDs and a limited contact that involves conserved residues between the GAF-like domains []. The structural studies suggest that the inactive form of HrcA is the dimer and this is converted to its DNA-binding form by interaction with GroEL, which binds to a conserved C-terminal sequence region [, ]. Comparison of the HrcA-CIRCE complexes from B. subtilis and Bacillus thermoglucosidasius (Geobacillus thermoglucosidasius), which grow at vastly different ranges of temperature shows that the thermostability profiles were consistent with the difference in the growth temperatures suggesting that HrcA can function as a thermosensor to detect temperature changes in cells []. Any increase in temperature causes the dissociation of the HrcA from the CIRCE complex with the concomitant activation of transcription of the groE and dnaK operons.  This entry represents the C terminus of HrcA, consisting of the GAF-like domain with the inserted dimerising domain.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1STZ_A.
Probab=45.04  E-value=32  Score=26.73  Aligned_cols=54  Identities=20%  Similarity=0.245  Sum_probs=34.5

Q ss_pred             CeEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHH-HHHcCCCCCCEEEEcC
Q 044269           43 NTWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKS-LMKLGVKEGDTVIVGD   98 (129)
Q Consensus        43 g~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~a-LkkaGakeGDtV~IGd   98 (129)
                      ..+.+.|  +.+++..-+|++.+.++.+.+.|+....... |...--.+|=.|+||.
T Consensus       129 ~~~~~~G--~~~ll~~pef~d~~~l~~ll~llE~~~~l~~ll~~~~~~~~i~V~IG~  183 (224)
T PF01628_consen  129 ERVYVSG--LSNLLNQPEFSDPEKLRELLELLEDKKILLELLDSLSDDDGISVKIGS  183 (224)
T ss_dssp             -SEEEE---HHHHHHSTT---HHHHHHHHHHTT-HHHHHHH-------SSSEEEEGG
T ss_pred             ceeEEcC--HHHHcCCccccCHHHHHHHHHHHhCcHHHHHHHhhhccCCceEEEECC
Confidence            4578888  8899999999999999999999998885444 4444434566999984


No 42 
>PRK00082 hrcA heat-inducible transcription repressor; Provisional
Probab=44.99  E-value=82  Score=26.74  Aligned_cols=51  Identities=20%  Similarity=0.201  Sum_probs=39.6

Q ss_pred             eEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCC-hHHHHHHcCCCCCCEEEEcC
Q 044269           44 TWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACG-VTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        44 ~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~G-V~~aLkkaGakeGDtV~IGd   98 (129)
                      .+.+.|  ..+++.  .|++.+.++.|.+.|+... +.+.|.+....+|=.|+||+
T Consensus       232 ~~~~~G--~~nll~--ef~d~~~l~~ll~~le~~~~l~~ll~~~~~~~~v~V~IG~  283 (339)
T PRK00082        232 RLIVAG--KANLLN--YLSDLERLRSLLDLLEEKQVLLQLLDESEEAEGVRIFIGS  283 (339)
T ss_pred             eEEEeC--HHHHhh--hhccHHHHHHHHHHHhChHHHHHHHHhhccCCCcEEEEcC
Confidence            577888  778888  8999999999999997755 55666455555788899984


No 43 
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=44.89  E-value=21  Score=23.20  Aligned_cols=16  Identities=44%  Similarity=0.673  Sum_probs=14.1

Q ss_pred             HHHHcCCCCCCEEEEc
Q 044269           82 SLMKLGVKEGDTVIVG   97 (129)
Q Consensus        82 aLkkaGakeGDtV~IG   97 (129)
                      .|...|+++||+|.++
T Consensus        55 ~L~~~gi~~~~~l~l~   70 (71)
T cd01796          55 LLALYGVKDGDLVVLR   70 (71)
T ss_pred             cHHHcCCCCCCEEEEe
Confidence            4888999999999886


No 44 
>PRK11573 hypothetical protein; Provisional
Probab=44.54  E-value=90  Score=27.13  Aligned_cols=57  Identities=14%  Similarity=0.252  Sum_probs=37.7

Q ss_pred             EEEcCCCCeEEEEcc-hHHHHHHhcCCC----CHHHHHHHHHHHHHCChHHHHHHcCC--CCCCEEEEcCEEEEEE
Q 044269           36 IFHDSGSNTWNVVGA-GLQRFVQMTNWR----YLDSERRFQHGLEACGVTKSLMKLGV--KEGDTVIVGDMEMVWH  104 (129)
Q Consensus        36 I~k~~e~g~f~V~G~-~IEr~v~~tnfd----~~es~~rF~r~Lk~~GV~~aLkkaGa--keGDtV~IGd~EFey~  104 (129)
                      +.+. ++|.|.|.|. .|+.+-+.++++    +++.+.=|        |   |...|-  +.||++.++++.|+=.
T Consensus       326 i~~~-~~~~~~v~G~~~l~d~~~~l~~~l~~~~~~Tl~G~--------i---~~~lg~iP~~Ge~~~~~~~~f~V~  389 (413)
T PRK11573        326 VTPQ-NDGSVIIDGTANVREINKAFNWHLPEDDARTVNGV--------I---LEALEEIPVAGTRVRIGEYDIDIL  389 (413)
T ss_pred             eEEe-cCCEEEEEeeeEHHHHHHHhCCCCCCCCCeeHHHH--------H---HHHhCcCCCCCCEEEECCEEEEEE
Confidence            5554 4789999996 566666666654    23444333        1   222233  8999999999999843


No 45 
>PLN02377 3-ketoacyl-CoA synthase
Probab=44.11  E-value=30  Score=31.25  Aligned_cols=45  Identities=16%  Similarity=0.085  Sum_probs=39.5

Q ss_pred             CcEEEEcCCCCeEEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCCh
Q 044269           33 DFEIFHDSGSNTWNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACGV   79 (129)
Q Consensus        33 ~f~I~k~~e~g~f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV   79 (129)
                      +|.-.+.  +..++|.-..+-+.+.++..-++++++.+.|+|++.|+
T Consensus       102 d~~c~~p--~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~ri~~~sgi  146 (502)
T PLN02377        102 DYSCYRA--PDHLKAPFARFMEHSRLTGDFDDSSLEFQRKILERSGL  146 (502)
T ss_pred             eeeeecC--CccccccHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCC
Confidence            6766674  45699999999999999998999999999999999999


No 46 
>cd02780 MopB_CT_Tetrathionate_Arsenate-R This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of tetrathionate reductase, subunit A, (TtrA); respiratory arsenate As(V) reductase, catalytic subunit (ArrA); and other related proteins.
Probab=43.43  E-value=23  Score=25.61  Aligned_cols=16  Identities=50%  Similarity=0.642  Sum_probs=13.2

Q ss_pred             HHHHcCCCCCCEEEEc
Q 044269           82 SLMKLGVKEGDTVIVG   97 (129)
Q Consensus        82 aLkkaGakeGDtV~IG   97 (129)
                      ..++.|+++||.|+|.
T Consensus        38 dA~~lgI~~Gd~V~v~   53 (143)
T cd02780          38 DAAKLGIKTGDRVRVV   53 (143)
T ss_pred             HHHHcCCCCCCEEEEE
Confidence            4567899999999984


No 47 
>COG0186 RpsQ Ribosomal protein S17 [Translation, ribosomal structure and biogenesis]
Probab=42.83  E-value=15  Score=26.13  Aligned_cols=12  Identities=33%  Similarity=0.518  Sum_probs=10.5

Q ss_pred             CCCCCCEEEEcC
Q 044269           87 GVKEGDTVIVGD   98 (129)
Q Consensus        87 GakeGDtV~IGd   98 (129)
                      -+++||+|+|..
T Consensus        55 ~~k~GD~V~I~E   66 (87)
T COG0186          55 EAKVGDIVRIAE   66 (87)
T ss_pred             cCCCCCEEEEEE
Confidence            589999999975


No 48 
>PF02938 GAD:  GAD domain;  InterPro: IPR004115 This entry represetns an 2 layer alpha/beta insertion domain found in some glutamyl-tRNA amidotransferases and aspartyl tRNA synthetases [, ]. The function of this domain is not yet known.; GO: 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0005737 cytoplasm; PDB: 1ZQ1_D 1EQR_B 1IL2_B 1C0A_A 1L0W_A 1G51_B 1EFW_B 2D6F_D.
Probab=41.16  E-value=23  Score=24.36  Aligned_cols=18  Identities=28%  Similarity=0.481  Sum_probs=11.6

Q ss_pred             HHHHHHcCCCCCCEEEEc
Q 044269           80 TKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IG   97 (129)
                      .+.+.+.|+++||+|.+.
T Consensus        67 ~~l~~~~~a~~GD~ll~~   84 (95)
T PF02938_consen   67 KALIERLGAKPGDLLLFV   84 (95)
T ss_dssp             HHHHHHTT--TTEEEEEE
T ss_pred             HHHHHHhCCCCCCEEEEE
Confidence            344566699999999874


No 49 
>TIGR03520 GldE gliding motility-associated protein GldE. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype.
Probab=40.23  E-value=1.3e+02  Score=25.94  Aligned_cols=60  Identities=13%  Similarity=0.170  Sum_probs=37.8

Q ss_pred             EEEcCCCCeEEEEcc-hHHHHHHhcCCC---------CHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEEEEEEe
Q 044269           36 IFHDSGSNTWNVVGA-GLQRFVQMTNWR---------YLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDMEMVWHD  105 (129)
Q Consensus        36 I~k~~e~g~f~V~G~-~IEr~v~~tnfd---------~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~EFey~e  105 (129)
                      +.+. ++|.|.|.|. .|+.+.+.++++         +++.+.=|        |.+.| .+=-+.||.|.++++.|+=.+
T Consensus       325 i~~~-~~~~~~v~G~~~l~~l~~~l~~~~~~~~~~~~~~~Tl~G~--------i~~~l-~~iP~~G~~~~~~~~~f~V~~  394 (408)
T TIGR03520       325 YSKI-DDNNYVFEGKTSLKDFYKILKLEEDMFDEVKGEAETLAGF--------LLEIS-GGFPKKGEKITFENFEFTIEA  394 (408)
T ss_pred             eEEe-CCCeEEEEeccCHHHHHHHhCCCccccCCcCCCCccHHHH--------HHHHh-CcCCCCCCEEEECCEEEEEEE
Confidence            5554 4789999964 677777777665         22333322        11222 111389999999999998433


No 50 
>PF03471 CorC_HlyC:  Transporter associated domain;  InterPro: IPR005170 This small domain is found in a family of proteins with the CBS IPR002550 from INTERPRO domain and two CBS domains with this domain found at the C terminus of the proteins, the domain is also found at the C terminus of some Na+/H+ antiporters. This domain is also found in CorC that is involved in Magnesium and cobalt efflux. The function of this domain is uncertain but might be involved in modulating transport of ion substrates.; PDB: 3DED_F 2PLI_C 2R2Z_A 2P4P_A 2O3G_A 2P3H_A 3LLB_A 3LAE_A 2P13_B 2NQW_A ....
Probab=39.86  E-value=1.1e+02  Score=20.09  Aligned_cols=53  Identities=15%  Similarity=0.152  Sum_probs=31.1

Q ss_pred             CCCeEEEEcc-hHHHHHHhcCCCCHH----HHH-HHHHHHHHCChHHHHHHcCCCCCCEEEEc--CEEEEE
Q 044269           41 GSNTWNVVGA-GLQRFVQMTNWRYLD----SER-RFQHGLEACGVTKSLMKLGVKEGDTVIVG--DMEMVW  103 (129)
Q Consensus        41 e~g~f~V~G~-~IEr~v~~tnfd~~e----s~~-rF~r~Lk~~GV~~aLkkaGakeGDtV~IG--d~EFey  103 (129)
                      ++|.|+|.|. .|+.+.+.++++-++    .+. ++...|.          .=-+.||.|.|.  +++|+=
T Consensus         4 ~~~~~~v~G~~~l~~l~~~~~~~l~~~~~~Tl~G~i~~~l~----------~iP~~Ge~~~i~~~~~~~~V   64 (81)
T PF03471_consen    4 DDGTYIVSGSTPLDDLNELLGLDLPEEDYDTLGGLILEQLG----------RIPEVGERVEIELENYEFEV   64 (81)
T ss_dssp             TTSEEEEETTSBHHHHHHHHTS-TTTTTTSBHHHHHHHHHT----------SS--TTSEEEEEETTEEEEE
T ss_pred             cCCEEEEEecCCHHHHHHHHCcCCCccchhhHHHHHHHHcC----------CCCCCCeEEEEEcCCEEEEE
Confidence            4789999996 466666666655322    232 2222222          223479977777  999984


No 51 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=39.63  E-value=29  Score=21.74  Aligned_cols=17  Identities=35%  Similarity=0.620  Sum_probs=14.3

Q ss_pred             HHHHHHcCCCCCCEEEE
Q 044269           80 TKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~I   96 (129)
                      .+.|...|+++|++|.+
T Consensus        52 ~~~L~~~~i~~g~~l~v   68 (71)
T cd01812          52 AETLDMSGVKDGSKVML   68 (71)
T ss_pred             cCcHHHcCCCCCCEEEE
Confidence            44688999999999976


No 52 
>PF08845 SymE_toxin:  Toxin SymE, type I toxin-antitoxin system;  InterPro: IPR014944 This entry represents a SOS-induced gene whose product shows homology to the antitoxin MazE (SymE), the coding region contains a cis-encoded antisense RNA. The small antisense RNA and the gene have the all the hallmarks of a toxin-antitoxin module. The synthesis of the SymE is tightly repressed at multiple levels; at the transcriptional level by the LexA repressor, at the level of mRNA stability and translation by the SymR RNA and at the level of protein stability by the Lon protease. SymE co-purifies with ribosomes and overproduction of the protein leads to cell growth inhibition, decreased protein synthesis and increased RNA degradation. These properties are shared with several RNA endonuclease toxins of toxin-antitoxin modules. It seems probable that the SymE protein represents an evolutionary derivative of a toxin containing the AbrB fold, whose representatives are typically antitoxins. The SymE promoted cleavage of RNA cleavage may be important for the recycling of RNAs damaged under SOS-inducing conditions []. ; GO: 0003723 RNA binding, 0016788 hydrolase activity, acting on ester bonds, 0016070 RNA metabolic process, 0005737 cytoplasm
Probab=38.93  E-value=27  Score=22.65  Aligned_cols=16  Identities=44%  Similarity=0.461  Sum_probs=13.0

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +-|+++|...||.|.|
T Consensus        31 ~WL~~aGF~~G~~v~V   46 (57)
T PF08845_consen   31 KWLEEAGFTIGDPVKV   46 (57)
T ss_pred             hhhHHhCCCCCCEEEE
Confidence            3478889999998886


No 53 
>TIGR03635 S17_bact 30S ribosomal protein S17. This model describes the bacterial ribosomal small subunit protein S17, while excluding cytosolic eukaryotic homologs and archaeal homologs. The model finds many, but not, chloroplast and mitochondrial counterparts to bacterial S17.
Probab=38.43  E-value=20  Score=24.17  Aligned_cols=12  Identities=33%  Similarity=0.393  Sum_probs=10.3

Q ss_pred             CCCCCCEEEEcC
Q 044269           87 GVKEGDTVIVGD   98 (129)
Q Consensus        87 GakeGDtV~IGd   98 (129)
                      .++.||+|.|..
T Consensus        48 ~~k~GD~V~I~e   59 (71)
T TIGR03635        48 ECKVGDVVRIIE   59 (71)
T ss_pred             CCCCCCEEEEEE
Confidence            589999999974


No 54 
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=37.63  E-value=35  Score=31.72  Aligned_cols=18  Identities=17%  Similarity=0.475  Sum_probs=15.2

Q ss_pred             CCCCEEEEcCEEEEEEec
Q 044269           89 KEGDTVIVGDMEMVWHDS  106 (129)
Q Consensus        89 keGDtV~IGd~EFey~ed  106 (129)
                      ..|.++.|.+++|+|+-.
T Consensus       262 ~~gE~~~iDGV~~~Fq~t  279 (655)
T COG2015         262 ETGETLTIDGVEFEFQMT  279 (655)
T ss_pred             ccCceEEEeceEEEEeeC
Confidence            468899999999999754


No 55 
>PF03459 TOBE:  TOBE domain;  InterPro: IPR005116  The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner. It is probably involved in the recognition of small ligands such as molybdenum (P46930 from SWISSPROT) and sulphate (P16676 from SWISSPROT), and is found in ABC transporters immediately after the ATPase domain.; GO: 0005215 transporter activity, 0005524 ATP binding, 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0006810 transport, 0043190 ATP-binding cassette (ABC) transporter complex; PDB: 1G29_2 1H9M_B 1H9J_A 1H9K_A 1H9R_B 1O7L_C 1H9S_A 1B9N_A 1B9M_A 1GUS_C ....
Probab=37.43  E-value=35  Score=21.04  Aligned_cols=16  Identities=44%  Similarity=0.636  Sum_probs=10.8

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +++.+.|+++||.|.+
T Consensus        40 ~~~~~L~L~~G~~V~~   55 (64)
T PF03459_consen   40 ESAEELGLKPGDEVYA   55 (64)
T ss_dssp             HHHHHCT-STT-EEEE
T ss_pred             HHHHHcCCCCCCEEEE
Confidence            4566779999999985


No 56 
>PF02359 CDC48_N:  Cell division protein 48 (CDC48), N-terminal domain;  InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The VAT protein of the archaebacterium Thermoplasma acidophilum, like all other members of the Cdc48/p97 family of AAA ATPases, has two ATPase domains and a 185-residue amino-terminal substrate-recognition domain, VAT-N. VAT shows activity in protein folding and unfolding and thus shares the common function of these ATPases in disassembly and/or degradation of protein complexes.  VAT-N is composed of two equally sized subdomains. The amino-terminal subdomain VAT-Nn forms a double-psi beta-barrel whose pseudo-twofold symmetry is mirrored by an internal sequence repeat of 42 residues. The carboxy-terminal subdomain VAT-Nc forms a novel six-stranded beta-clam fold []. Together, VAT-Nn and VAT-Nc form a kidney-shaped structure, in close agreement with results from electron microscopy. VAT-Nn is related to numerous proteins including prokaryotic transcription factors, metabolic enzymes, the protease cofactors UFD1 and PrlF, and aspartic proteinases. ; GO: 0005524 ATP binding; PDB: 1CZ4_A 1CZ5_A 3CF3_C 3CF1_A 3CF2_A 1S3S_D 1E32_A 1R7R_A 2PJH_B 1CR5_B ....
Probab=37.34  E-value=32  Score=23.14  Aligned_cols=28  Identities=25%  Similarity=0.559  Sum_probs=19.5

Q ss_pred             HHHHHcCCCCCCEEEEcCEE----EEEEecCC
Q 044269           81 KSLMKLGVKEGDTVIVGDME----MVWHDSAN  108 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd~E----Fey~ed~~  108 (129)
                      +.+.+.|+..||+|.|.+-.    |.|.....
T Consensus        23 ~~m~~l~l~~gd~v~i~g~~~tv~~v~~~~~~   54 (87)
T PF02359_consen   23 EDMEELGLFPGDVVLISGKRKTVAFVFPDRPD   54 (87)
T ss_dssp             HHHHCTTT-TTEEEEEETTTEEEEEEEEECCS
T ss_pred             HHHHHcCCCCccEEEEeCCceEEEEEEECCCC
Confidence            45677899999999997644    66655433


No 57 
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes. Maleylacetate reductases (MAR) play an important role in the degradation of aromatic compounds  in aerobic microbes. In fungi and yeasts, the enzymes are involved in the catabolism of compounds such as phenol, tyrosine, benzoate, 4-hydroxybenzoate and resorcinol. In bacteria, the enzymes contribute to the degradation of resorcinol, 2,4-dihydroxybenzoate ([beta]-resorcylate) and 2,6-dihydroxybenzoate ([gamma]-resorcylate) via hydroxyquinol and maleylacetate. Maleylacetate reductases catalyze NADH- or NADPH-dependent reduction, at the carbon-carbon double bond, of maleylacetate or 2-chloromaleylacetate to 3-oxoadipate. In the case of 2-chloromaleylacetate, Maleylacetate reductases initially catalyses the NAD(P)H-dependent dechlorination to maleylacetate, which is then reduced to 3-oxoadipate. This enzyme is a homodimer. It is inhibited by thiol-blocking reagents such as p-
Probab=37.02  E-value=25  Score=29.24  Aligned_cols=44  Identities=23%  Similarity=0.292  Sum_probs=35.5

Q ss_pred             chHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCE
Q 044269           50 AGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDT   93 (129)
Q Consensus        50 ~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDt   93 (129)
                      ++..++.+.+..+..+.+.++.+.++++|+-..|++.|+.+.|.
T Consensus       266 ~~~~~~a~~l~~~~~~~~~~i~~l~~~lglp~~l~e~gi~~~~~  309 (337)
T cd08177         266 EALARLARALGLGAADAADALADLARSLGAPTSLADLGVPRDDI  309 (337)
T ss_pred             HHHHHHHHHhCccHHHHHHHHHHHHHHcCCCCCHHHcCCCHHHH
Confidence            45666777776666677899999999999999999999887664


No 58 
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=37.00  E-value=56  Score=24.50  Aligned_cols=40  Identities=20%  Similarity=0.280  Sum_probs=26.7

Q ss_pred             CCCCHHHHHHHHHHHHH---------------CChHHHHHHcCCCCCCEEEEcCE
Q 044269           60 NWRYLDSERRFQHGLEA---------------CGVTKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk~---------------~GV~~aLkkaGakeGDtV~IGd~   99 (129)
                      +++..++...+++.|++               +|+.++|+++|++.+..|.|.++
T Consensus       158 ~~~~~~~~~~~~~~l~~~~~~~ai~~~~d~~a~~~~~~l~~~g~~vp~di~v~g~  212 (269)
T cd06288         158 DWSADDGYEAAAALLDLDDRPTAIFCGNDRMAMGAYQALLERGLRIPQDVSVVGF  212 (269)
T ss_pred             CCChHHHHHHHHHHHhCCCCCCEEEEeCcHHHHHHHHHHHHcCCCCcccceEEee
Confidence            44445566666666654               48999999999986555555433


No 59 
>PF03829 PTSIIA_gutA:  PTS system glucitol/sorbitol-specific IIA component;  InterPro: IPR004716 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ].  The Man family is unique in several respects among PTS permease families:   It is the only PTS family in which members possess a IID protein.  It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue.  Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars.   This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria. The system in Escherichia coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0005737 cytoplasm; PDB: 2F9H_A.
Probab=36.62  E-value=32  Score=25.26  Aligned_cols=17  Identities=41%  Similarity=0.704  Sum_probs=11.5

Q ss_pred             CCCCCCEEEEcCEEEEE
Q 044269           87 GVKEGDTVIVGDMEMVW  103 (129)
Q Consensus        87 GakeGDtV~IGd~EFey  103 (129)
                      -+++||++.||+.+|.=
T Consensus        51 ~i~~Gd~l~i~~~~y~I   67 (117)
T PF03829_consen   51 DIKPGDTLIIGGQEYTI   67 (117)
T ss_dssp             ---TT-EEEETTEEEEE
T ss_pred             CcCCCCEEEECCeEEEE
Confidence            58999999999998863


No 60 
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=35.98  E-value=39  Score=23.19  Aligned_cols=43  Identities=26%  Similarity=0.298  Sum_probs=27.7

Q ss_pred             EcchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEE
Q 044269           48 VGAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        48 ~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~I   96 (129)
                      .|.-+..++++.++..    .-+++++..-|-.+.|..  +++||++.+
T Consensus         9 ~GDtLs~iF~~~gls~----~dl~~v~~~~~~~k~L~~--L~pGq~l~f   51 (85)
T PF04225_consen    9 SGDTLSTIFRRAGLSA----SDLYAVLEADGEAKPLTR--LKPGQTLEF   51 (85)
T ss_dssp             TT--HHHHHHHTT--H----HHHHHHHHHGGGT--GGG----TT-EEEE
T ss_pred             CCCcHHHHHHHcCCCH----HHHHHHHhccCccchHhh--CCCCCEEEE
Confidence            4778999999998765    347788888888888876  999999886


No 61 
>TIGR02609 doc_partner putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids.
Probab=35.89  E-value=39  Score=22.47  Aligned_cols=16  Identities=56%  Similarity=0.829  Sum_probs=12.9

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +-|.+.|+++||.|.|
T Consensus        17 ~i~~~lgl~~Gd~v~v   32 (74)
T TIGR02609        17 EVLESLGLKEGDTLYV   32 (74)
T ss_pred             HHHHHcCcCCCCEEEE
Confidence            3467889999999964


No 62 
>PF03120 DNA_ligase_OB:  NAD-dependent DNA ligase OB-fold domain;  InterPro: IPR004150 DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This family is a small domain found after the adenylation domain DNA_ligase_N in NAD+-dependent ligases (IPR001679 from INTERPRO). OB-fold domains generally are involved in nucleic acid binding.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 2OWO_A 1TAE_A 3UQ8_A 1DGS_A 1V9P_B 3SGI_A.
Probab=35.77  E-value=31  Score=23.98  Aligned_cols=15  Identities=40%  Similarity=0.713  Sum_probs=10.2

Q ss_pred             HHHcCCCCCCEEEEc
Q 044269           83 LMKLGVKEGDTVIVG   97 (129)
Q Consensus        83 LkkaGakeGDtV~IG   97 (129)
                      +++.|+..||+|.|.
T Consensus        45 i~~~~i~~Gd~V~V~   59 (82)
T PF03120_consen   45 IKELDIRIGDTVLVT   59 (82)
T ss_dssp             HHHTT-BBT-EEEEE
T ss_pred             HHHcCCCCCCEEEEE
Confidence            446799999999884


No 63 
>PRK11507 ribosome-associated protein; Provisional
Probab=35.45  E-value=27  Score=23.75  Aligned_cols=26  Identities=15%  Similarity=0.199  Sum_probs=20.3

Q ss_pred             CChHHHHHHcCCCCCCEEEEcCEEEE
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGDMEMV  102 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd~EFe  102 (129)
                      .|-.+.=|.+-+.+||+|.+.+.++.
T Consensus        42 NGeve~rRgkKl~~GD~V~~~g~~~~   67 (70)
T PRK11507         42 DGAVETRKRCKIVAGQTVSFAGHSVQ   67 (70)
T ss_pred             CCEEecccCCCCCCCCEEEECCEEEE
Confidence            44555566778999999999998765


No 64 
>PF08817 YukD:  WXG100 protein secretion system (Wss), protein YukD;  InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []. Ubiquitin covalently binds to protein and flags them for protein degradation, however conjugation assays have indicated that YukD lacks the capacity for covalent bond formation with other proteins []. ; PDB: 2BPS_B.
Probab=35.44  E-value=16  Score=24.22  Aligned_cols=17  Identities=29%  Similarity=0.765  Sum_probs=10.8

Q ss_pred             HHHHHHcCCCCCCEEEE
Q 044269           80 TKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~I   96 (129)
                      .+-|.++|+.+||+..+
T Consensus        62 ~~tL~~~gV~dGd~L~L   78 (79)
T PF08817_consen   62 DQTLADAGVRDGDVLVL   78 (79)
T ss_dssp             TSBCGGGT--TT-EEEE
T ss_pred             cCcHhHcCCCCCCEEEe
Confidence            45678889999998875


No 65 
>PLN03111 DNA-directed RNA polymerase II subunit family protein; Provisional
Probab=35.24  E-value=37  Score=27.55  Aligned_cols=13  Identities=31%  Similarity=0.516  Sum_probs=11.5

Q ss_pred             HHcCCCCCCEEEE
Q 044269           84 MKLGVKEGDTVIV   96 (129)
Q Consensus        84 kkaGakeGDtV~I   96 (129)
                      +-.|++.||.|+|
T Consensus       177 ry~g~k~G~vvkI  189 (206)
T PLN03111        177 RYYGLKRGQVVKI  189 (206)
T ss_pred             HhcCCCCCCEEEE
Confidence            4569999999999


No 66 
>PRK11347 antitoxin ChpS; Provisional
Probab=35.10  E-value=41  Score=23.21  Aligned_cols=16  Identities=19%  Similarity=0.345  Sum_probs=13.5

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      ..|++.|+++||+|.|
T Consensus        19 ~il~~l~l~~G~~v~i   34 (83)
T PRK11347         19 IVMKELNLQPGQSVEA   34 (83)
T ss_pred             HHHHHcCCCCCCEEEE
Confidence            3578899999999876


No 67 
>PF08461 HTH_12:  Ribonuclease R winged-helix domain;  InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea. 
Probab=35.05  E-value=31  Score=22.59  Aligned_cols=36  Identities=17%  Similarity=0.186  Sum_probs=29.4

Q ss_pred             EEcchHHHHHHhcCCCC-HHHHHHHHHHHHHCChHHH
Q 044269           47 VVGAGLQRFVQMTNWRY-LDSERRFQHGLEACGVTKS   82 (129)
Q Consensus        47 V~G~~IEr~v~~tnfd~-~es~~rF~r~Lk~~GV~~a   82 (129)
                      +....|.+.+...+++- +++++|-.+.|++.|+.+.
T Consensus        14 ~g~~~l~~~L~~~g~~~se~avRrrLr~me~~Glt~~   50 (66)
T PF08461_consen   14 LGRKQLAEELKLRGEELSEEAVRRRLRAMERDGLTRK   50 (66)
T ss_pred             CCHHHHHHHHHhcChhhhHHHHHHHHHHHHHCCCccc
Confidence            34457888888888886 8999999999999996654


No 68 
>cd01805 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belongs to a family of adaptor molecules having affinity for both the proteasome and ubiquitinylated proteins and thought to shuttle these ubiquitinylated proteins to the proteasome for destruction. RAD23 interacts with ubiquitin through its C-terminal ubiquitin-associated domains (UBA) and with the proteasome through its N-terminal ubiquitin-like domain (UBL).
Probab=34.72  E-value=38  Score=21.64  Aligned_cols=16  Identities=31%  Similarity=0.464  Sum_probs=13.1

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      ..|.+.|+++|++|.+
T Consensus        56 ~~L~~~~i~~~~~i~~   71 (77)
T cd01805          56 TTLEEYKIDEKDFVVV   71 (77)
T ss_pred             CCHHHcCCCCCCEEEE
Confidence            3578889999999875


No 69 
>COG0243 BisC Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion]
Probab=34.61  E-value=32  Score=31.78  Aligned_cols=17  Identities=47%  Similarity=0.710  Sum_probs=14.7

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +-.++.||++||.|+|.
T Consensus       678 ~DA~~~GI~~GD~V~V~  694 (765)
T COG0243         678 EDAAKLGIKDGDLVRVE  694 (765)
T ss_pred             HHHHHcCCCcCCEEEEE
Confidence            55688899999999995


No 70 
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=34.22  E-value=37  Score=21.31  Aligned_cols=20  Identities=25%  Similarity=0.591  Sum_probs=14.5

Q ss_pred             HHHHcCCCCCCEEE-EcCEEE
Q 044269           82 SLMKLGVKEGDTVI-VGDMEM  101 (129)
Q Consensus        82 aLkkaGakeGDtV~-IGd~EF  101 (129)
                      ...++|+++||+|. |++...
T Consensus        24 ~a~~~gl~~GD~I~~ing~~i   44 (79)
T cd00989          24 PAAKAGLKAGDRILAINGQKI   44 (79)
T ss_pred             HHHHcCCCCCCEEEEECCEEC
Confidence            45678999999874 566654


No 71 
>PF12668 DUF3791:  Protein of unknown function (DUF3791);  InterPro: IPR024269 This entry represents proteins of unknown function.
Probab=34.20  E-value=66  Score=20.53  Aligned_cols=30  Identities=17%  Similarity=0.273  Sum_probs=24.2

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHH
Q 044269           51 GLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLM   84 (129)
Q Consensus        51 ~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLk   84 (129)
                      -|+.++++.+.+..++.++|    ++.|+.+-|.
T Consensus         7 ~Ie~~A~~~~~s~~ea~~~~----~~~~~~~~i~   36 (62)
T PF12668_consen    7 CIEEFAKKLNISGEEAYNYF----KRSGVIDYII   36 (62)
T ss_pred             HHHHHHHHHCcCHHHHHHHH----HHcCcHHHHH
Confidence            48899999999999999888    6777777544


No 72 
>PRK14990 anaerobic dimethyl sulfoxide reductase subunit A; Provisional
Probab=34.01  E-value=28  Score=32.37  Aligned_cols=21  Identities=24%  Similarity=0.346  Sum_probs=16.5

Q ss_pred             CChHHHHHHcCCCCCCEEEEcC
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd   98 (129)
                      +.=.+| ++.||++||.|+|.+
T Consensus       726 inp~dA-~~~GI~dGD~V~V~n  746 (814)
T PRK14990        726 INPLDA-QKRGINNGDKVRIFN  746 (814)
T ss_pred             EcHHHH-HHcCCCCCCEEEEEc
Confidence            444554 889999999999964


No 73 
>PF04023 FeoA:  FeoA domain;  InterPro: IPR007167 This entry represents the core domain of the ferrous iron (Fe2+) transport protein FeoA found in bacteria. This domain also occurs at the C terminus in related proteins. The transporter Feo is composed of three proteins: FeoA a small, soluble SH3-domain protein probably located in the cytosol; FeoB, a large protein with a cytosolic N-terminal G-protein domain and a C-terminal integral inner-membrane domain containing two 'Gate' motifs which likely functions as the Fe2+ permease; and FeoC, a small protein apparently functioning as an [Fe-S]-dependent transcriptional repressor [, ]. Feo allows the bacterial cell to acquire iron from its environment. ; GO: 0005506 iron ion binding; PDB: 3HRT_B 3HRS_A 3HRU_B 1G3T_A 1C0W_B 1BI3_A 1QVP_A 1BI1_A 1BYM_A 2QQB_A ....
Probab=34.00  E-value=39  Score=21.45  Aligned_cols=18  Identities=28%  Similarity=0.490  Sum_probs=13.2

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      ..|.++|+.+|..|.+-.
T Consensus        26 ~~L~~lGl~~G~~i~v~~   43 (74)
T PF04023_consen   26 RRLADLGLTPGSEITVIR   43 (74)
T ss_dssp             HHHHHCT-STTEEEEEEE
T ss_pred             HHHHHCCCCCCCEEEEEE
Confidence            446677899999998864


No 74 
>cd01791 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved.  At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers.  ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members.
Probab=33.92  E-value=38  Score=22.43  Aligned_cols=16  Identities=19%  Similarity=0.206  Sum_probs=13.9

Q ss_pred             HHHHcCCCCCCEEEEc
Q 044269           82 SLMKLGVKEGDTVIVG   97 (129)
Q Consensus        82 aLkkaGakeGDtV~IG   97 (129)
                      .|...|+++|.+|..+
T Consensus        56 tL~~ygi~~~stv~l~   71 (73)
T cd01791          56 SLGDYEIHDGMNLELY   71 (73)
T ss_pred             CHHHcCCCCCCEEEEE
Confidence            5889999999999864


No 75 
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=33.72  E-value=27  Score=24.74  Aligned_cols=14  Identities=50%  Similarity=0.795  Sum_probs=7.9

Q ss_pred             HHHcCCCCCCEEEE
Q 044269           83 LMKLGVKEGDTVIV   96 (129)
Q Consensus        83 LkkaGakeGDtV~I   96 (129)
                      +.+.|++.||.|.|
T Consensus        93 ~~~~~i~~Gd~v~~  106 (108)
T PF02643_consen   93 FEKLGIKVGDRVRI  106 (108)
T ss_dssp             HHHHT--TT-EEE-
T ss_pred             hhhcCCCCCCEEEe
Confidence            45669999999986


No 76 
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609.
Probab=33.64  E-value=51  Score=18.70  Aligned_cols=17  Identities=47%  Similarity=0.524  Sum_probs=13.6

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +..+..|+++||.|.|-
T Consensus        14 ~~r~~l~~~~gd~~~i~   30 (43)
T TIGR01439        14 EIREKLGLKEGDRLEVI   30 (43)
T ss_pred             HHHHHcCcCCCCEEEEE
Confidence            34667899999998875


No 77 
>PRK05282 (alpha)-aspartyl dipeptidase; Validated
Probab=33.26  E-value=35  Score=27.64  Aligned_cols=31  Identities=23%  Similarity=0.327  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEc
Q 044269           65 DSERRFQHGLEACGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        65 es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IG   97 (129)
                      .+--++.+.|++.|+.+.|+++ ++.| .|.+|
T Consensus        88 Gnt~~l~~~l~~~gl~~~l~~~-~~~G-~~~~G  118 (233)
T PRK05282         88 GNTFQLLKQLYERGLLAPIREA-VKNG-TPYIG  118 (233)
T ss_pred             ccHHHHHHHHHHCCcHHHHHHH-HHCC-CEEEE
Confidence            3456889999999999999988 7777 66666


No 78 
>PTZ00061 DNA-directed RNA polymerase; Provisional
Probab=32.98  E-value=42  Score=27.25  Aligned_cols=13  Identities=23%  Similarity=0.509  Sum_probs=11.4

Q ss_pred             HHcCCCCCCEEEE
Q 044269           84 MKLGVKEGDTVIV   96 (129)
Q Consensus        84 kkaGakeGDtV~I   96 (129)
                      +-.|++.||.|+|
T Consensus       176 ry~g~k~G~vvkI  188 (205)
T PTZ00061        176 RYFGLSKGQVVKI  188 (205)
T ss_pred             HhcCCCCCCEEEE
Confidence            4569999999999


No 79 
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Pperiplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=32.86  E-value=79  Score=23.77  Aligned_cols=37  Identities=22%  Similarity=0.421  Sum_probs=25.7

Q ss_pred             CCCCHHHHHHHHHHHHH----------------CChHHHHHHcCCCCCCEEEEc
Q 044269           60 NWRYLDSERRFQHGLEA----------------CGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk~----------------~GV~~aLkkaGakeGDtV~IG   97 (129)
                      +++..++...+.+.|.+                +|+.++|+++|++ +|...+|
T Consensus       167 ~~~~~~~~~~~~~~l~~~~~~~~ai~~~~d~~a~g~~~~l~~~g~~-~dv~v~g  219 (275)
T cd06317         167 DWDREKAQVAMEALITKFGDDIDGVYAGDDNMARGALNAAKEAGLA-GGIVIVG  219 (275)
T ss_pred             CCCHHHHHHHHHHHHHhCCCCccEEEECCCcHHHHHHHHHHhcCCc-CCcEEEE
Confidence            34445555566666654                3788999999999 7776664


No 80 
>KOG2500 consensus Uncharacterized conserved protein [Function unknown]
Probab=32.71  E-value=77  Score=26.52  Aligned_cols=64  Identities=22%  Similarity=0.332  Sum_probs=31.6

Q ss_pred             cEEEEcCCCCeEEEEcchHHHHHHhcCCC--CHHHHHHHHHHHHHCChHHH-----HHHcCCCCCCEEEEc
Q 044269           34 FEIFHDSGSNTWNVVGAGLQRFVQMTNWR--YLDSERRFQHGLEACGVTKS-----LMKLGVKEGDTVIVG   97 (129)
Q Consensus        34 f~I~k~~e~g~f~V~G~~IEr~v~~tnfd--~~es~~rF~r~Lk~~GV~~a-----LkkaGakeGDtV~IG   97 (129)
                      |-|+.++++|.+---|=..-.--.-+||+  -.|.++|..+.-+.-.-++.     =-.+|.|||.||+|.
T Consensus        91 FViRv~dgngr~AFiGlGF~eR~dafDfnvaLqDHfkyv~~~~e~ek~eq~~d~~pslDlgFKEGeTIkin  161 (253)
T KOG2500|consen   91 FVIRVEDGNGRHAFIGLGFGERGDAFDFNVALQDHFKYVKRQKEAEKQEQHYDAGPSLDLGFKEGETIKIN  161 (253)
T ss_pred             EEEEEeCCCccEEEEeecccccccccchhhhHHHHHHHHHHHHHHHhhhcccCCCccccccccCCcEEEEE
Confidence            55554434555444443343334445555  34455555443221111000     013699999999985


No 81 
>cd01804 midnolin_N Ubiquitin-like domain of midnolin. midnolin_N   Midnolin (midbrain nucleolar protein) is expressed in the nucleolus and is thought to regulate genes involved in neurogenesis.  Midnolin contains an amino-terminal ubiquitin-like domain.
Probab=32.51  E-value=42  Score=22.16  Aligned_cols=15  Identities=27%  Similarity=0.618  Sum_probs=13.3

Q ss_pred             HHHHcCCCCCCEEEE
Q 044269           82 SLMKLGVKEGDTVIV   96 (129)
Q Consensus        82 aLkkaGakeGDtV~I   96 (129)
                      .|.+.|+++|++|.+
T Consensus        55 ~L~~~gi~~~~~i~l   69 (78)
T cd01804          55 KLQDLGLGDGSKLTL   69 (78)
T ss_pred             cHHHcCCCCCCEEEE
Confidence            589999999999875


No 82 
>PF08133 Nuclease_act:  Anticodon nuclease activator family;  InterPro: IPR012585 This family consists of the anticodon nuclease activator proteins. Pre-existing host tRNAs are reprocessed during Bacteriophage T4 infection of certain Escherichia coli strains. In this pathway, tRNA(Lys) is cleaved 5, by the anticodon nuclease to the wobble base and is later restored in polynucleotide kinase and RNA ligase reactions [].; GO: 0004518 nuclease activity, 0050792 regulation of viral reproduction
Probab=31.92  E-value=27  Score=19.56  Aligned_cols=23  Identities=26%  Similarity=0.423  Sum_probs=18.5

Q ss_pred             hcCCCCHHHHHHHHHHHHHCChH
Q 044269           58 MTNWRYLDSERRFQHGLEACGVT   80 (129)
Q Consensus        58 ~tnfd~~es~~rF~r~Lk~~GV~   80 (129)
                      |.||.++.-+......|+..||.
T Consensus         1 msn~hnehvmqfyr~nlk~~gvf   23 (26)
T PF08133_consen    1 MSNFHNEHVMQFYRHNLKTKGVF   23 (26)
T ss_pred             CcchhHHHHHHHHHhhccccccc
Confidence            57888888887778888888874


No 83 
>PF08939 DUF1917:  Domain of unknown function (DUF1917);  InterPro: IPR015034 This family includes various hypothetical proteins.; PDB: 1ZTP_B 2Q4K_C.
Probab=31.91  E-value=44  Score=27.55  Aligned_cols=24  Identities=17%  Similarity=0.268  Sum_probs=18.1

Q ss_pred             hcCCCCHHHHHHHHHHHHHCChHH
Q 044269           58 MTNWRYLDSERRFQHGLEACGVTK   81 (129)
Q Consensus        58 ~tnfd~~es~~rF~r~Lk~~GV~~   81 (129)
                      .-||.+.+.+.|..+.|+++||..
T Consensus       203 T~Df~D~~DV~RVl~~Lr~~gl~~  226 (243)
T PF08939_consen  203 TPDFRDREDVMRVLRRLRELGLVD  226 (243)
T ss_dssp             ES-TT-HHHHHHHHHHHHHTT--S
T ss_pred             CCCCCCHHHHHHHHHHHHHcCCcc
Confidence            569999999999999999998854


No 84 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=31.30  E-value=29  Score=23.12  Aligned_cols=26  Identities=19%  Similarity=0.208  Sum_probs=14.4

Q ss_pred             CChHHHHHHcCCCCCCEEEEcCEEEE
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGDMEMV  102 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd~EFe  102 (129)
                      .|-.+.=|.+-+++||+|.|++..|.
T Consensus        38 NGe~e~rrg~Kl~~GD~V~~~~~~~~   63 (65)
T PF13275_consen   38 NGEVETRRGKKLRPGDVVEIDGEEYR   63 (65)
T ss_dssp             TTB----SS----SSEEEEETTEEEE
T ss_pred             CCEEccccCCcCCCCCEEEECCEEEE
Confidence            34445556677899999999998875


No 85 
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]
Probab=31.28  E-value=50  Score=27.16  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=17.7

Q ss_pred             HHHHHHcCCCCCCEEEEcCEE
Q 044269           80 TKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IGd~E  100 (129)
                      ..+|..+|+++.|.|.|||--
T Consensus       175 ~~al~~l~v~Pee~vhIgD~l  195 (237)
T KOG3085|consen  175 QLALERLGVKPEECVHIGDLL  195 (237)
T ss_pred             HHHHHHhCCChHHeEEecCcc
Confidence            357889999999999999753


No 86 
>PTZ00237 acetyl-CoA synthetase; Provisional
Probab=31.13  E-value=44  Score=29.87  Aligned_cols=18  Identities=22%  Similarity=0.565  Sum_probs=12.8

Q ss_pred             HHHHHHcCCCCCCEEEEc
Q 044269           80 TKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IG   97 (129)
                      -..|++.|++.||+|.|.
T Consensus       106 A~~L~~~Gv~~GDrV~i~  123 (647)
T PTZ00237        106 SRVLLNLNISKNDNVLIY  123 (647)
T ss_pred             HHHHHHcCCCCCCEEEEE
Confidence            344555678999999874


No 87 
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=30.89  E-value=35  Score=20.84  Aligned_cols=21  Identities=38%  Similarity=0.509  Sum_probs=17.0

Q ss_pred             cCCCCCCEEEEcCEEEEEEec
Q 044269           86 LGVKEGDTVIVGDMEMVWHDS  106 (129)
Q Consensus        86 aGakeGDtV~IGd~EFey~ed  106 (129)
                      .-+++||.|+-|+.=|.....
T Consensus        16 v~V~~G~~VkkGd~L~~ld~~   36 (50)
T PF13533_consen   16 VYVKEGQQVKKGDVLLVLDSP   36 (50)
T ss_pred             EEecCCCEEcCCCEEEEECcH
Confidence            357999999999998886543


No 88 
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit. This model represents the molybdopterin subunit, typically called the alpha subunit, of various proteins that also contain an iron-sulfur subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase, ethylbenzene dehydrogenase, and an archaeal respiratory nitrate reductase. This alpha subunit has a twin-arginine translocation (TAT) signal for Sec-independent translocation across the plasma membrane.
Probab=30.22  E-value=39  Score=32.19  Aligned_cols=17  Identities=35%  Similarity=0.524  Sum_probs=15.2

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +-.++.||++||.|+|.
T Consensus       817 ~DA~~~GI~dGD~V~V~  833 (912)
T TIGR03479       817 KDAAEKGIKDGDQVRIF  833 (912)
T ss_pred             HHHHHcCCCcCCEEEEE
Confidence            66789999999999995


No 89 
>PF04994 TfoX_C:  TfoX C-terminal domain;  InterPro: IPR007077 This domain is found in a number of bacterial proteins including the TfoX gene product of Haemophilus influenzae. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes []. This family corresponds to the C-terminal presumed domain of TfoX. The domain is found in association with the N-terminal domain in some, but not all members of this group, suggesting this is an autonomous and functionally unrelated domain. For example it is found associated with Q9JZR1 from SWISSPROT in IPR002125 from INTERPRO.; PDB: 3BQT_A 3MAB_A.
Probab=30.16  E-value=62  Score=22.03  Aligned_cols=36  Identities=17%  Similarity=0.188  Sum_probs=21.8

Q ss_pred             cchHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCC
Q 044269           49 GAGLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGV   88 (129)
Q Consensus        49 G~~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGa   88 (129)
                      |+.+|+++.+.+..+.+.++..    -....+-.|++.|.
T Consensus        12 g~~~e~~L~~vGI~t~~~L~~~----Ga~~a~~~Lk~~~~   47 (81)
T PF04994_consen   12 GPKSERMLAKVGIHTVEDLREL----GAVEAYLRLKASGP   47 (81)
T ss_dssp             -HHHHHHHHHTT--SHHHHHHH----HHHHHHHHHHHH-T
T ss_pred             CHHHHHHHHHcCCCCHHHHHHh----CHHHHHHHHHHHCC
Confidence            7899999999999999887554    22233444555543


No 90 
>PF08206 OB_RNB:  Ribonuclease B OB domain;  InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies.; PDB: 2ID0_D 2IX1_A 2IX0_A.
Probab=29.99  E-value=36  Score=21.44  Aligned_cols=11  Identities=45%  Similarity=0.788  Sum_probs=7.7

Q ss_pred             cCCCCCCEEEE
Q 044269           86 LGVKEGDTVIV   96 (129)
Q Consensus        86 aGakeGDtV~I   96 (129)
                      .||.+||+|.+
T Consensus        30 ~~A~~gD~V~v   40 (58)
T PF08206_consen   30 NGAMDGDKVLV   40 (58)
T ss_dssp             TTS-TT-EEEE
T ss_pred             CCCCCCCEEEE
Confidence            48999999985


No 91 
>TIGR02164 torA trimethylamine-N-oxide reductase TorA. This very narrowly defined family represents TorA, part of a family of related molybdoenzymes that include biotin sulfoxide reductases, dimethyl sulfoxide reductases, and at least two different subfamilies of trimethylamine-N-oxide reductases. A single enzyme from the larger family may have more than one activity. TorA typically is located in the periplasm, has a Tat (twin-arginine translocation)-dependent signal sequence, and is encoded in a torCAD operon.
Probab=29.97  E-value=44  Score=31.29  Aligned_cols=17  Identities=35%  Similarity=0.362  Sum_probs=14.8

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +.-++.||++||.|+|.
T Consensus       714 ~dA~~~GI~dGD~V~V~  730 (822)
T TIGR02164       714 VDAKARGIKDGDLVRVF  730 (822)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45688999999999995


No 92 
>PRK05610 rpsQ 30S ribosomal protein S17; Reviewed
Probab=29.89  E-value=32  Score=23.92  Aligned_cols=12  Identities=33%  Similarity=0.401  Sum_probs=10.2

Q ss_pred             CCCCCCEEEEcC
Q 044269           87 GVKEGDTVIVGD   98 (129)
Q Consensus        87 GakeGDtV~IGd   98 (129)
                      -++.||+|.|..
T Consensus        53 ~~k~GD~V~I~e   64 (84)
T PRK05610         53 EAKIGDVVRIME   64 (84)
T ss_pred             CCCCCCEEEEEE
Confidence            489999999974


No 93 
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional
Probab=29.35  E-value=73  Score=25.10  Aligned_cols=39  Identities=15%  Similarity=0.188  Sum_probs=26.1

Q ss_pred             CCCCHHHHHHHHHHHHH---------------CChHHHHHHcCCCCCCEEEEcC
Q 044269           60 NWRYLDSERRFQHGLEA---------------CGVTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk~---------------~GV~~aLkkaGakeGDtV~IGd   98 (129)
                      +++..++...+++.|++               +|+.++|+++|++-.+.|.|.+
T Consensus       219 ~~~~~~~~~~~~~~l~~~~~~~ai~~~~d~~A~g~~~al~~~g~~vP~disv~g  272 (328)
T PRK11303        219 SFEREAGAQLFEKWLETHPMPDALFTTSYTLLQGVLDVLLERPGELPSDLAIAT  272 (328)
T ss_pred             CCChHHHHHHHHHHHcCCCCCCEEEEcCcHHHHHHHHHHHHcCCCCCCceEEEE
Confidence            34445555566666653               5899999999998655566543


No 94 
>CHL00142 rps17 ribosomal protein S17; Validated
Probab=29.31  E-value=34  Score=23.93  Aligned_cols=12  Identities=25%  Similarity=0.551  Sum_probs=10.4

Q ss_pred             CCCCCCEEEEcC
Q 044269           87 GVKEGDTVIVGD   98 (129)
Q Consensus        87 GakeGDtV~IGd   98 (129)
                      .++.||+|.|..
T Consensus        50 ~~~~GD~V~I~e   61 (84)
T CHL00142         50 ECNIGDQVLIEE   61 (84)
T ss_pred             CCCCCCEEEEEE
Confidence            589999999974


No 95 
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional
Probab=29.04  E-value=83  Score=24.40  Aligned_cols=39  Identities=8%  Similarity=0.246  Sum_probs=26.0

Q ss_pred             CCCCHHHHHHHHHHHHHC---------------ChHHHHHHcCCCCCCEEEEcC
Q 044269           60 NWRYLDSERRFQHGLEAC---------------GVTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk~~---------------GV~~aLkkaGakeGDtV~IGd   98 (129)
                      +++..++...+.+.|+..               |+.++|+++|++-+|.+.|-+
T Consensus       194 ~~~~~~~~~~~~~~l~~~~~~~ai~~~~d~~a~gv~~al~~~g~~ip~di~vvg  247 (309)
T PRK11041        194 DFTFEAGAKALKQLLDLPQPPTAVFCHSDVMALGALSQAKRMGLRVPQDLSIIG  247 (309)
T ss_pred             CCCHHHHHHHHHHHHcCCCCCCEEEEcCcHHHHHHHHHHHHcCCCCCcceEEEE
Confidence            344455566666666532               899999999998665555443


No 96 
>PRK10461 thiamine biosynthesis lipoprotein ApbE; Provisional
Probab=28.98  E-value=21  Score=30.35  Aligned_cols=31  Identities=19%  Similarity=0.321  Sum_probs=27.3

Q ss_pred             HHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcC
Q 044269           65 DSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        65 es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd   98 (129)
                      =++.+..+.|++.||..+|.++|   ||...+|.
T Consensus       190 yavD~a~~~L~~~Gv~~~lV~~G---Gdi~~~G~  220 (350)
T PRK10461        190 YAADHLARLMEQEGISRYLVSVG---GALSSRGM  220 (350)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEcC---CcEEEECC
Confidence            46888999999999999999999   99888884


No 97 
>PRK15102 trimethylamine N-oxide reductase I catalytic subunit; Provisional
Probab=28.93  E-value=47  Score=31.13  Aligned_cols=17  Identities=35%  Similarity=0.450  Sum_probs=14.7

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +.-++.||++||.|+|.
T Consensus       717 ~DA~~~GI~dGD~V~V~  733 (825)
T PRK15102        717 QDAKARGIKDGDVVRVF  733 (825)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            45688999999999995


No 98 
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N   HOIL-1 (heme-oxidized IRP2 ubiquitin ligase-1) is an E3 ubiquitin-protein ligase that recognizes heme-oxidized IRP2 (iron regulatory protein2) and is thought to affect the turnover of oxidatively damaged proteins.  Hoil-1 has an amino-terminal ubiquitin-like domain as well as an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.
Probab=28.58  E-value=52  Score=21.89  Aligned_cols=17  Identities=24%  Similarity=0.583  Sum_probs=14.2

Q ss_pred             HHHHHcCCC-CCCEEEEc
Q 044269           81 KSLMKLGVK-EGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGak-eGDtV~IG   97 (129)
                      +.|...|++ +||+|.++
T Consensus        56 ~tL~~ygi~~~g~~~~l~   73 (75)
T cd01799          56 ETLYSHGIRTNGDSAFLY   73 (75)
T ss_pred             CCHHHcCCCCCCCEEEEE
Confidence            468889999 99999874


No 99 
>COG3127 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=28.55  E-value=48  Score=32.01  Aligned_cols=25  Identities=36%  Similarity=0.555  Sum_probs=20.6

Q ss_pred             HHHHHcCCCCCCEEEEcCEEEEEEe
Q 044269           81 KSLMKLGVKEGDTVIVGDMEMVWHD  105 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd~EFey~e  105 (129)
                      ..|...|+|.||.|.||+..|.-..
T Consensus       144 ~Ll~~LglkvGd~i~vG~~tlri~~  168 (829)
T COG3127         144 RLLERLGLKVGDRIDVGDATLRIAG  168 (829)
T ss_pred             HHHHHhCCCcCceEeecCceEEEEE
Confidence            3466779999999999999998643


No 100
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only]
Probab=28.38  E-value=26  Score=27.84  Aligned_cols=48  Identities=15%  Similarity=0.326  Sum_probs=34.3

Q ss_pred             chHHHHHHhcCCCCHH-HHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEEEE
Q 044269           50 AGLQRFVQMTNWRYLD-SERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDMEMV  102 (129)
Q Consensus        50 ~~IEr~v~~tnfd~~e-s~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~EFe  102 (129)
                      +++.+++++.+++..- |..=|     ..++.+||+++++..-.+|.|||.=|+
T Consensus        74 ~RV~~~~~~l~v~fi~~A~KP~-----~~~fr~Al~~m~l~~~~vvmVGDqL~T  122 (175)
T COG2179          74 SRVARAAEKLGVPFIYRAKKPF-----GRAFRRALKEMNLPPEEVVMVGDQLFT  122 (175)
T ss_pred             HHHHhhhhhcCCceeecccCcc-----HHHHHHHHHHcCCChhHEEEEcchhhh
Confidence            4566677777766422 22222     335678999999999999999999886


No 101
>PF13180 PDZ_2:  PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C ....
Probab=28.16  E-value=35  Score=22.15  Aligned_cols=19  Identities=21%  Similarity=0.517  Sum_probs=13.3

Q ss_pred             HHHcCCCCCCEEE-EcCEEE
Q 044269           83 LMKLGVKEGDTVI-VGDMEM  101 (129)
Q Consensus        83 LkkaGakeGDtV~-IGd~EF  101 (129)
                      ..++|++.||.|. |++..+
T Consensus        27 A~~aGl~~GD~I~~ing~~v   46 (82)
T PF13180_consen   27 AAKAGLQPGDIILAINGKPV   46 (82)
T ss_dssp             HHHTTS-TTEEEEEETTEES
T ss_pred             HHHCCCCCCcEEEEECCEEc
Confidence            4578999999864 666655


No 102
>COG0828 RpsU Ribosomal protein S21 [Translation, ribosomal structure and biogenesis]
Probab=28.08  E-value=72  Score=21.64  Aligned_cols=25  Identities=20%  Similarity=0.337  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHCChHHHHHHcCC
Q 044269           64 LDSERRFQHGLEACGVTKSLMKLGV   88 (129)
Q Consensus        64 ~es~~rF~r~Lk~~GV~~aLkkaGa   88 (129)
                      +.|+++|-+.+.+-|+...+++.-.
T Consensus        13 d~ALrrFKr~~~k~gil~e~k~r~~   37 (67)
T COG0828          13 DKALRRFKRKVEKEGILREMKEREF   37 (67)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4689999999999999999887543


No 103
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems. Periplasmic binding domain of two-component sensor kinase signaling systems, some of which are fused with a C-terminal histidine kinase A domain (HisK) and/or a signal receiver domain (REC). Members of this group share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily and are predicted to be involved in sensing of environmental stimuli; their substrate specificities, however, are not known in detail.
Probab=27.03  E-value=95  Score=23.55  Aligned_cols=20  Identities=15%  Similarity=0.285  Sum_probs=16.0

Q ss_pred             CChHHHHHHcCCCCCCEEEEc
Q 044269           77 CGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IG   97 (129)
                      .|+.++|+++|++ +|.-.||
T Consensus       195 ~g~~~al~~~g~~-~dv~vvg  214 (270)
T cd06308         195 LGAYLAAKRAGRE-KEIKFIG  214 (270)
T ss_pred             HHHHHHHHHcCCC-CCcEEEE
Confidence            5899999999999 7655543


No 104
>TIGR03089 conserved hypothetical protein TIGR03089. This protein family is found, so far, only in the Actinobacteria (Streptomyces, Mycobacterium, Corynebacterium, Nocardia, Propionibacterium, etc.) and never more than one to a genome. Members show twilight-level sequence similarity to family of AMP-binding enzymes described by Pfam model pfam00501.
Probab=27.02  E-value=61  Score=25.30  Aligned_cols=17  Identities=24%  Similarity=0.364  Sum_probs=12.2

Q ss_pred             HHHHH-cCCCCCCEEEEc
Q 044269           81 KSLMK-LGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkk-aGakeGDtV~IG   97 (129)
                      ..|++ .|+++||.|-|-
T Consensus        42 ~~L~~~~Gv~~GdrV~i~   59 (227)
T TIGR03089        42 NLLQDELDAEPGSRVALD   59 (227)
T ss_pred             HHHHHHhCCCCCCEEEEE
Confidence            34444 489999999874


No 105
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism]
Probab=26.92  E-value=15  Score=33.30  Aligned_cols=41  Identities=24%  Similarity=0.267  Sum_probs=31.7

Q ss_pred             CCCCCCEEEEcCEEEEEEecCCCCCCCcccccccccCCCCC
Q 044269           87 GVKEGDTVIVGDMEMVWHDSANNPGPSKAKKGFEDSIKWPQ  127 (129)
Q Consensus        87 GakeGDtV~IGd~EFey~ed~~~~~~~~~~~~~~~~~~~~~  127 (129)
                      -+++||+|.|.||.+--.+.+--.-...|+=||--.+-||.
T Consensus       144 ~~~~gDiIWVhDYhL~L~P~mlR~~~~~~~IgfFlHiPfPs  184 (486)
T COG0380         144 IYEPGDIIWVHDYHLLLVPQMLRERIPDAKIGFFLHIPFPS  184 (486)
T ss_pred             hcCCCCEEEEEechhhhhHHHHHHhCCCceEEEEEeCCCCC
Confidence            58999999999999877765444444455778888888885


No 106
>TIGR00638 Mop molybdenum-pterin binding domain. This model describes a multigene family of molybdenum-pterin binding proteins of about 70 amino acids in Clostridium pasteurianum, as a tandemly-repeated domain C-terminal to an unrelated domain in ModE, a molybdate transport gene repressor of E. coli, and in single or tandemly paired domains in several related proteins.
Probab=26.74  E-value=73  Score=19.70  Aligned_cols=16  Identities=38%  Similarity=0.638  Sum_probs=12.6

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +++.++++++||.|.+
T Consensus        42 ~~~~~l~l~~G~~v~~   57 (69)
T TIGR00638        42 ESVAELGLKPGKEVYA   57 (69)
T ss_pred             HHHhhCCCCCCCEEEE
Confidence            5566778899999875


No 107
>PTZ00241 40S ribosomal protein S11; Provisional
Probab=26.74  E-value=38  Score=26.50  Aligned_cols=12  Identities=67%  Similarity=1.066  Sum_probs=10.8

Q ss_pred             CCCCCCEEEEcC
Q 044269           87 GVKEGDTVIVGD   98 (129)
Q Consensus        87 GakeGDtV~IGd   98 (129)
                      .++.||+|.|+.
T Consensus       116 ~~kvGD~V~I~E  127 (158)
T PTZ00241        116 DVKEGDIVVVGQ  127 (158)
T ss_pred             CCCCCCEEEEEE
Confidence            599999999995


No 108
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2. hPLIC-1 and hPLIC-2 (human homologs of the yeast ubiquitin-like Dsk2 protein)  are type2 UBL's (ubiquitin-like) proteins that are thought to serve as adaptors that link the ubiquitination machinery to the proteasome.  The hPLIC's have an N-terminal UBL domain that binds the S5a subunit of the proteasome and a C-terminal UBA (ubiquitin-associated) domain that binds a ubiquitylated protein.
Probab=26.65  E-value=63  Score=20.58  Aligned_cols=16  Identities=31%  Similarity=0.470  Sum_probs=13.3

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +.|.+.|+++|++|.+
T Consensus        53 ~tL~~~~i~~~stl~l   68 (71)
T cd01808          53 DTLTQHNIKDGLTVHL   68 (71)
T ss_pred             CcHHHcCCCCCCEEEE
Confidence            3588899999999875


No 109
>PF06253 MTTB:  Trimethylamine methyltransferase (MTTB);  InterPro: IPR010426 This family consists of several trimethylamine methyltransferase (MTTB) proteins from numerous Rhizobium and Methanosarcina species.; GO: 0008168 methyltransferase activity, 0015948 methanogenesis; PDB: 2QNE_A.
Probab=26.58  E-value=83  Score=28.40  Aligned_cols=50  Identities=20%  Similarity=0.150  Sum_probs=24.7

Q ss_pred             EcchHHHHHHhcCCCCHHHHHHH----HHHHHHCCh-------HHHHHHcCCCC---CCEEEEc
Q 044269           48 VGAGLQRFVQMTNWRYLDSERRF----QHGLEACGV-------TKSLMKLGVKE---GDTVIVG   97 (129)
Q Consensus        48 ~G~~IEr~v~~tnfd~~es~~rF----~r~Lk~~GV-------~~aLkkaGake---GDtV~IG   97 (129)
                      ..+.+.+-..++++=+++.+.+.    .++|+..||       .+.|+++|++-   |++|+|-
T Consensus        22 ~~~~~~~~~~~~~~ls~~~ie~IHe~sl~ILee~Gv~~~~eeAlei~k~~Ga~V~~eg~~V~ip   85 (505)
T PF06253_consen   22 RSPYIVRNGPPYNFLSEEEIEQIHEASLRILEETGVEFESEEALEIFKKAGARVDEEGGRVRIP   85 (505)
T ss_dssp             --------------S-HHHHHHHHHHHHHHHHHT-EEE--HHHHHHHHHTT-EE--ETTEEE--
T ss_pred             ccccccccCCCcccCCHHHHHHHHHHHHHHHHHcCCccCCHHHHHHHHHcCCEEecCCCeEecC
Confidence            33444455556666666666655    468999997       58899999987   9999986


No 110
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=26.54  E-value=1e+02  Score=23.67  Aligned_cols=36  Identities=22%  Similarity=0.314  Sum_probs=25.5

Q ss_pred             CCCCHHHHHHHHHHHHH---------------CChHHHHHHcCCCCCCEEEEc
Q 044269           60 NWRYLDSERRFQHGLEA---------------CGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk~---------------~GV~~aLkkaGakeGDtV~IG   97 (129)
                      +++...+...+.+.|++               +|+.++|+++|+  +|...||
T Consensus       164 ~~~~~~~~~~~~~~l~~~~~~~ai~~~nd~~a~g~~~al~~~g~--~di~vvg  214 (272)
T cd06313         164 NWDVSKAARIWETWLTKYPQLDGAFCHNDSMALAAYQIMKAAGR--TKIVIGG  214 (272)
T ss_pred             CCCHHHHHHHHHHHHHhCCCCCEEEECCCcHHHHHHHHHHHcCC--CceEEEe
Confidence            44445566677777765               489999999998  7765543


No 111
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=26.50  E-value=46  Score=21.56  Aligned_cols=21  Identities=10%  Similarity=0.232  Sum_probs=14.8

Q ss_pred             HHHHcCCCCCCEEE-EcCEEEE
Q 044269           82 SLMKLGVKEGDTVI-VGDMEMV  102 (129)
Q Consensus        82 aLkkaGakeGDtV~-IGd~EFe  102 (129)
                      ...++|+++||.|. |++....
T Consensus        22 pa~~aGL~~GDiI~~Ing~~v~   43 (79)
T cd00991          22 PAENAVLHTGDVIYSINGTPIT   43 (79)
T ss_pred             hHHhcCCCCCCEEEEECCEEcC
Confidence            34678999999864 6666553


No 112
>PF14053 DUF4248:  Domain of unknown function (DUF4248)
Probab=26.49  E-value=1.9e+02  Score=19.32  Aligned_cols=50  Identities=10%  Similarity=0.117  Sum_probs=35.2

Q ss_pred             EEEEcchHHHHHHhcC--CCCHHHHHHHHHHHHH-CChHHHHHHcCCCCCCEE
Q 044269           45 WNVVGAGLQRFVQMTN--WRYLDSERRFQHGLEA-CGVTKSLMKLGVKEGDTV   94 (129)
Q Consensus        45 f~V~G~~IEr~v~~tn--fd~~es~~rF~r~Lk~-~GV~~aLkkaGakeGDtV   94 (129)
                      |.|.+-....++.++.  ....-|+++|.+-++. -++.++|.+.|-.+++..
T Consensus         1 f~iR~y~k~ELA~lYfP~~~~~sA~r~L~rwI~~~~~L~~~L~~~Gy~~~~r~   53 (69)
T PF14053_consen    1 FRIRSYGKSELAQLYFPDLTPSSAVRKLRRWIRRNPELLEELEATGYHPRQRS   53 (69)
T ss_pred             CccccccHHHHHHHHcCCCCHHHHHHHHHHHHHHCHHHHHHHHHcCCCCCCEe
Confidence            3444444555555543  4456788889888876 479999999999998864


No 113
>PF01982 CTP-dep_RFKase:  Domain of unknown function DUF120;  InterPro: IPR023602 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2.7.1.26 from EC), which converts it into FMN, and FAD synthetase (2.7.7.2 from EC), which adenylates FMN to FAD. Eukaryotes usually have two separate enzymes, while most prokaryotes have a single bifunctional protein that can carry out both catalyses, although exceptions occur in both cases. While eukaryotic monofunctional riboflavin kinase is orthologous to the bifunctional prokaryotic enzyme [], the monofunctional FAD synthetase differs from its prokaryotic counterpart, and is instead related to the PAPS-reductase family []. The bacterial FAD synthetase that is part of the bifunctional enzyme has remote similarity to nucleotidyl transferases and, hence, it may be involved in the adenylylation reaction of FAD synthetases []. This entry represents a CTP-dependent riboflavin kinase domain, found primarily in archaea, that catalyses the phosphorylation of riboflavin to form flavin mononucleotide in riboflavin biosynthesis. Its structure resembles a RIFT barrel, structurally similar to but topologically distinct from bacterial and eukaryotic examples []. The N-terminal is a winged helix-turn-helix DNA-binding domain, and the C-terminal half is most similar in sequence to a group of cradle-loop barrels.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2VBV_A 2VBU_A 2VBS_A 2VBT_A 2P3M_A 2OYN_A 3CTA_A.
Probab=26.49  E-value=46  Score=24.81  Aligned_cols=11  Identities=64%  Similarity=1.017  Sum_probs=6.8

Q ss_pred             cCCCCCCEEEE
Q 044269           86 LGVKEGDTVIV   96 (129)
Q Consensus        86 aGakeGDtV~I   96 (129)
                      .|++|||.|.|
T Consensus       109 L~L~DGD~V~v  119 (121)
T PF01982_consen  109 LGLKDGDEVEV  119 (121)
T ss_dssp             TT--TT-EEEE
T ss_pred             cCCCCCCEEEE
Confidence            58999999987


No 114
>PF12990 DUF3874:  Domain of unknonw function from B. Theta Gene description (DUF3874);  InterPro: IPR024450 This domain of unknown function if found in uncharacterised proteins from Bacteroides thetaiotaomicron and other Bacteroidetes.
Probab=26.31  E-value=33  Score=23.36  Aligned_cols=47  Identities=13%  Similarity=0.216  Sum_probs=28.3

Q ss_pred             CCCeEEEEcchHHHHHHhcCCC-CHHHHHHHHHHHHHCChHHHHHHcC
Q 044269           41 GSNTWNVVGAGLQRFVQMTNWR-YLDSERRFQHGLEACGVTKSLMKLG   87 (129)
Q Consensus        41 e~g~f~V~G~~IEr~v~~tnfd-~~es~~rF~r~Lk~~GV~~aLkkaG   87 (129)
                      ++|.|---..-++.+=++.+-. .--++.+|.|+|+++||..+--+.|
T Consensus        21 Ee~e~lsa~~If~~L~k~~~~~l~~~~~~~FGriL~~~gi~~khT~~G   68 (73)
T PF12990_consen   21 EEGEWLSAAEIFERLQKKSPAALRGSNPNHFGRILQKLGIPRKHTRKG   68 (73)
T ss_pred             ccceeecHHHHHHHHHHhCccccccCCHHHHHHHHHHcCCCccccCCC
Confidence            4555544444444443333321 1247889999999999987665555


No 115
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs. Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs from other bacteria. The members of this group are highly homologous to a family of periplasmic pentose/hexose sugar-binding proteins that function as the primary receptors for chemotaxis and transport of many sugar based solutes in bacteria and archaea, and that are members of the type I periplasmic binding protein superfamily. The Vibrio harveyi AI-2 receptor consists of two polypeptides, LuxP and LuxQ:  LuxP is a periplasmic binding protein that binds AI-2 by clamping it between two domains, LuxQ is an integral membrane protein belonging to the two-component sensor kinase family. Unlike AI-2 bound to the LsrB receptor in Salmonella typhimurium, the Vibrio harveyi AI-2 signaling molecule has an unusual furanosyl borate 
Probab=26.22  E-value=53  Score=25.40  Aligned_cols=37  Identities=22%  Similarity=0.262  Sum_probs=25.0

Q ss_pred             CCCCHHHHHHHHHHHHH---------------CChHHHHHHcCCCCCCEEEEc
Q 044269           60 NWRYLDSERRFQHGLEA---------------CGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk~---------------~GV~~aLkkaGakeGDtV~IG   97 (129)
                      +++..++...+++.|+.               +|+.++|+++|+. +|...||
T Consensus       171 ~~~~~~~~~~~~~~l~~~~~~~ai~~~nd~~A~g~l~al~~~G~~-~dv~vvg  222 (280)
T cd06303         171 DATRQKAYQATSDILSNNPDVDFIYACSTDIALGASDALKELGRE-DDILING  222 (280)
T ss_pred             CCCHHHHHHHHHHHHHhCCCCcEEEECCcHHHHHHHHHHHHcCCC-CCcEEEe
Confidence            34444555566666543               4899999999996 7766654


No 116
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand is presumed to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=26.15  E-value=54  Score=20.68  Aligned_cols=19  Identities=26%  Similarity=0.448  Sum_probs=14.0

Q ss_pred             HHHcCCCCCCEEE-EcCEEE
Q 044269           83 LMKLGVKEGDTVI-VGDMEM  101 (129)
Q Consensus        83 LkkaGakeGDtV~-IGd~EF  101 (129)
                      ..++|+++||.|. |++..+
T Consensus        25 a~~aGl~~GD~I~~Ing~~v   44 (80)
T cd00990          25 ADKAGLVAGDELVAVNGWRV   44 (80)
T ss_pred             HHHhCCCCCCEEEEECCEEh
Confidence            4568999999874 666654


No 117
>PF06300 Tsp45I:  Tsp45I type II restriction enzyme;  InterPro: IPR010443 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents type II restriction endonucleases such as Tsp45I, which recognises the DNA sequence 5' GTSAC, cleaving prior to G-1 [].
Probab=25.85  E-value=68  Score=26.97  Aligned_cols=29  Identities=21%  Similarity=0.131  Sum_probs=24.9

Q ss_pred             CCHHHHHHHHHHHHHCChHHHHHHcCCCC
Q 044269           62 RYLDSERRFQHGLEACGVTKSLMKLGVKE   90 (129)
Q Consensus        62 d~~es~~rF~r~Lk~~GV~~aLkkaGake   90 (129)
                      .+|+.+.|++.+|.+||+++.+.+.-...
T Consensus        85 rnP~Ti~ri~g~l~emGl~~i~ek~t~Pk  113 (261)
T PF06300_consen   85 RNPETINRICGRLYEMGLDKIYEKCTEPK  113 (261)
T ss_pred             cCcHHHHHHHHHHHHHhHHHHHHHcCCCc
Confidence            58899999999999999999888765443


No 118
>PF02073 Peptidase_M29:  Thermophilic metalloprotease (M29);  InterPro: IPR000787 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M29 (aminopeptidase T family, clan M-). The protein fold of the peptidase domain and the active site residues are not known for any members of the thermophilic metallo-aminopeptidases family.; GO: 0004177 aminopeptidase activity, 0006508 proteolysis; PDB: 2AYI_D 1ZJC_A.
Probab=25.77  E-value=90  Score=27.19  Aligned_cols=28  Identities=18%  Similarity=0.419  Sum_probs=20.5

Q ss_pred             CHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEc
Q 044269           63 YLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        63 ~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IG   97 (129)
                      ..+-+.+++++|-+.||       ++|+||+|.|.
T Consensus         3 ~~~~l~kyA~llV~~gl-------nvq~Gq~v~I~   30 (398)
T PF02073_consen    3 FDERLEKYAELLVKYGL-------NVQPGQKVLIR   30 (398)
T ss_dssp             HHHHHHHHHHHHHHTTT----------TT-EEEEE
T ss_pred             chHHHHHHHHHHHHhcc-------CCCCCCEEEEE
Confidence            45678889999999998       99999999985


No 119
>PRK00285 ihfA integration host factor subunit alpha; Reviewed
Probab=25.59  E-value=73  Score=21.86  Aligned_cols=43  Identities=7%  Similarity=0.104  Sum_probs=30.6

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEE
Q 044269           51 GLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        51 ~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~E  100 (129)
                      -++++.+++.+...++-.-+...++.+.  +     .+.+|+.|.|+++=
T Consensus         8 l~~~ia~~~~~s~~~v~~vl~~~~~~i~--~-----~L~~g~~V~l~gfG   50 (99)
T PRK00285          8 LAEALFEKVGLSKREAKELVELFFEEIR--D-----ALENGEQVKLSGFG   50 (99)
T ss_pred             HHHHHHHHhCcCHHHHHHHHHHHHHHHH--H-----HHHcCCeEEEcCCE
Confidence            4677888888887777766666665432  2     45788899998764


No 120
>PF04724 Glyco_transf_17:  Glycosyltransferase family 17;  InterPro: IPR006813 This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (2.4.1.144 from EC). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumour progression [, ].; GO: 0003830 beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity, 0006487 protein N-linked glycosylation, 0016020 membrane
Probab=25.53  E-value=73  Score=27.50  Aligned_cols=21  Identities=29%  Similarity=0.534  Sum_probs=17.5

Q ss_pred             HHHHHHcCCCCCCEEEEcCEE
Q 044269           80 TKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IGd~E  100 (129)
                      ...++.+|+++||.|.++|..
T Consensus       168 ~~l~~~~~~~~dDliivSDvD  188 (356)
T PF04724_consen  168 NGLLRLAGIQDDDLIIVSDVD  188 (356)
T ss_pred             HHHhhhcCCCCCCEEEEcCcc
Confidence            555678999999999999863


No 121
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines. Periplasmic binding proteins specific to rhizopines, which are simple sugar-like compounds produced in the nodules induced by the symbiotic root nodule bacteria, such as Rhizobium and Sinorhizobium. Rhizopine-binding-like proteins from other bacteria are also included. Two inositol based rhizopine compounds are known to date: L-3-O-methly-scyllo-inosamine (3-O-MSI) and scyllo-inosamine. Bacterial strains that can metabolize rhizopine have a greater competitive advantage in nodulation and rhizopine synthesis is regulated by NifA/NtrA regulatory transcription activators which are maximally expressed at the onset of nitrogen fixation in bacteroids. The members of this group belong to the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily.
Probab=25.51  E-value=52  Score=24.87  Aligned_cols=21  Identities=24%  Similarity=0.392  Sum_probs=15.7

Q ss_pred             CChHHHHHHcCCCCCCEEEEc
Q 044269           77 CGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IG   97 (129)
                      +|+.++|+++|++++|.-.||
T Consensus       196 ~~~~~~l~~~g~~~~di~ivg  216 (272)
T cd06301         196 LGAIMALKAAGKSDKDVPVAG  216 (272)
T ss_pred             HHHHHHHHHcCCCCCCcEEEe
Confidence            588999999999954644433


No 122
>PRK15488 thiosulfate reductase PhsA; Provisional
Probab=25.37  E-value=58  Score=29.98  Aligned_cols=18  Identities=33%  Similarity=0.637  Sum_probs=14.7

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +.-++.||++||.|+|.+
T Consensus       673 ~dA~~~GI~dGD~V~v~n  690 (759)
T PRK15488        673 QTAGKLGIKNGDEIRLEN  690 (759)
T ss_pred             HHHHHhCCCCCCEEEEEc
Confidence            346788999999999953


No 123
>PF10410 DnaB_bind:  DnaB-helicase binding domain of primase;  InterPro: IPR019475  This entry represents the C-terminal region three-helical domain of DNA primase []. Primases synthesise short RNA strands on single-stranded DNA templates, thereby generating the hybrid duplexes required for the initiation of synthesis by DNA polymerases. Primases are recruited to single-stranded DNA by helicases - this domain binds DnaB-helicase []. It is associated with the Toprim domain IPR006171 from INTERPRO, which is the central catalytic core. ; GO: 0016779 nucleotidyltransferase activity; PDB: 1EQN_E 1DD9_A 3B39_B 1DDE_A.
Probab=25.28  E-value=1e+02  Score=18.55  Aligned_cols=26  Identities=4%  Similarity=-0.022  Sum_probs=19.7

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHH
Q 044269           51 GLQRFVQMTNWRYLDSERRFQHGLEA   76 (129)
Q Consensus        51 ~IEr~v~~tnfd~~es~~rF~r~Lk~   76 (129)
                      .++++.+..|+++++.-.+|.+.+..
T Consensus         5 ~~~~l~~~~dl~~~egk~~~~~~~~~   30 (59)
T PF10410_consen    5 LIERLSKGYDLDTPEGKAEAVREAAP   30 (59)
T ss_dssp             HHHHHGGGS-TTSHHHHHHHHHHHHH
T ss_pred             HHHHHHhcCCCCCHHHHHHHHHHHHH
Confidence            46788889999999988888776543


No 124
>TIGR00353 nrfE c-type cytochrome biogenesis protein CcmF. The product of this gene is required for the biogenesis of C-type cytochromes. This gene is thought to have eleven transmembrane helices. Disruption of this gene in Paracoccus denitrificans, encoding a putative transporter, results in formation of an unstable apocytochrome c and deficiency in siderophore production.
Probab=25.28  E-value=70  Score=29.51  Aligned_cols=22  Identities=18%  Similarity=0.302  Sum_probs=18.6

Q ss_pred             CCCCCCEEEEcCEEEEEEecCC
Q 044269           87 GVKEGDTVIVGDMEMVWHDSAN  108 (129)
Q Consensus        87 GakeGDtV~IGd~EFey~ed~~  108 (129)
                      -.++||++.+++++|.|.+-..
T Consensus       456 ~L~pGet~~~~~y~~~y~~~~~  477 (576)
T TIGR00353       456 RLKPGQSVTLGGYTFRFRCVDL  477 (576)
T ss_pred             EECCCCcEEEcCEEEEEeeeee
Confidence            3589999999999999977543


No 125
>PLN02654 acetate-CoA ligase
Probab=25.27  E-value=64  Score=28.97  Aligned_cols=19  Identities=37%  Similarity=0.669  Sum_probs=15.2

Q ss_pred             hHHHHHHcCCCCCCEEEEc
Q 044269           79 VTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~IG   97 (129)
                      +-..|++.|++.||.|.|.
T Consensus       133 lA~~L~~~Gv~~GdrV~i~  151 (666)
T PLN02654        133 LANYLKDVGVKKGDAVVIY  151 (666)
T ss_pred             HHHHHHHcCCCCCCEEEEE
Confidence            4466778899999999885


No 126
>PRK03760 hypothetical protein; Provisional
Probab=24.99  E-value=64  Score=23.47  Aligned_cols=16  Identities=25%  Similarity=0.202  Sum_probs=12.6

Q ss_pred             HHHHcCCCCCCEEEEc
Q 044269           82 SLMKLGVKEGDTVIVG   97 (129)
Q Consensus        82 aLkkaGakeGDtV~IG   97 (129)
                      ...+.|+++||+|.+.
T Consensus       100 ~~~~~gi~~Gd~v~~~  115 (117)
T PRK03760        100 KIRVLKVEVGDEIEWI  115 (117)
T ss_pred             hHHHcCCCCCCEEEEe
Confidence            3567899999999753


No 127
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=24.83  E-value=1.2e+02  Score=22.82  Aligned_cols=24  Identities=13%  Similarity=0.203  Sum_probs=18.9

Q ss_pred             CChHHHHHHcCCCCCCEEEEcCEE
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd~E  100 (129)
                      +|+.++|+++|++.++.|.|.++.
T Consensus       190 ~g~~~al~~~g~~vp~di~i~g~d  213 (269)
T cd06293         190 IGLLEVLRERGLSIPGDMSLVGFD  213 (269)
T ss_pred             HHHHHHHHHcCCCCccceEEEeec
Confidence            489999999999877767775443


No 128
>TIGR00509 bisC_fam molybdopterin guanine dinucleotide-containing S/N-oxide reductases. This enzyme family shares sequence similarity and a requirement for a molydenum cofactor as the only prosthetic group. The form of the cofactor is a single molybdenum atom coordinated by two molybdopterin guanine dinucleotide molecules. Members of the family include biotin sulfoxide reductase, dimethylsulfoxide reductase, and trimethylamine-N-oxide reductase, although a single member may show all those activities and related activities; it may not be possible to resolve the primary function for members of this family by sequence comparison alone. A number of similar molybdoproteins in which the N-terminal region contains a CXXXC motif and may bind an iron-sulfur cluster are excluded from this set, including formate dehydrogenases and nitrate reductases. Also excluded is the A chain of a heteromeric, anaerobic DMSO reductase, which also contains the CXXXC motif.
Probab=24.80  E-value=61  Score=30.00  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=14.9

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +.-++.||++||.|+|.+
T Consensus       664 ~dA~~~GI~dGD~V~V~s  681 (770)
T TIGR00509       664 DDAAARGIADGDIVRVFN  681 (770)
T ss_pred             HHHHHcCCCCCCEEEEEC
Confidence            446788999999999953


No 129
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzyme catalyzes the first step of the mevalonate pathway of IPP biosynthesis. Most bacteria do not use this pathway, but rather the deoxyxylulose pathway.
Probab=24.46  E-value=68  Score=28.66  Aligned_cols=19  Identities=37%  Similarity=0.468  Sum_probs=15.2

Q ss_pred             hHHHHHHcCCCCCCEEEEc
Q 044269           79 VTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~IG   97 (129)
                      +-.+|++.|++.||.|.|.
T Consensus       127 lA~~L~~~Gv~~GdrV~i~  145 (652)
T TIGR01217       127 LAAALRALGVRPGDRVSGY  145 (652)
T ss_pred             HHHHHHHcCCCCCCEEEEE
Confidence            3467777889999999984


No 130
>PF13242 Hydrolase_like:  HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B ....
Probab=24.46  E-value=48  Score=21.23  Aligned_cols=21  Identities=38%  Similarity=0.673  Sum_probs=16.4

Q ss_pred             hHHHHHHcCCCCCCEEEEcCE
Q 044269           79 VTKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~IGd~   99 (129)
                      +..++++.|+...++|.|||-
T Consensus        10 ~~~a~~~~~~~~~~~~~VGD~   30 (75)
T PF13242_consen   10 LEQALKRLGVDPSRCVMVGDS   30 (75)
T ss_dssp             HHHHHHHHTSGGGGEEEEESS
T ss_pred             HHHHHHHcCCCHHHEEEEcCC
Confidence            345666678889999999986


No 131
>PF12143 PPO1_KFDV:  Protein of unknown function (DUF_B2219);  InterPro: IPR022740 This domain represents the C terminus of polyphenol oxidases. This region is primarily found in eukaryotes, although a few bacterial members also exist. It is typically between 138 and 152 amino acids in length and the family is found in association with PF00264 from PFAM and PF12142 from PFAM. Many members are plant or plastid polyphenol oxidases, and there is a highly conserved KFDV sequence motif. ; GO: 0004097 catechol oxidase activity, 0055114 oxidation-reduction process
Probab=24.43  E-value=55  Score=24.55  Aligned_cols=21  Identities=29%  Similarity=0.561  Sum_probs=17.7

Q ss_pred             HHCChHHHHHHcCCCCCCEEE
Q 044269           75 EACGVTKSLMKLGVKEGDTVI   95 (129)
Q Consensus        75 k~~GV~~aLkkaGakeGDtV~   95 (129)
                      -++||.+.|+..|+.+-|+|.
T Consensus        89 ~rlgitdlLedLga~~d~sIv  109 (130)
T PF12143_consen   89 LRLGITDLLEDLGAEDDDSIV  109 (130)
T ss_pred             EEEEhhHHHHHhCCCCCCEEE
Confidence            468999999999999877654


No 132
>PF07775 PaRep2b:  PaRep2b protein;  InterPro: IPR011689 This is a group of proteins, expressed in the crenarchaeon Pyrobaculum aerophilum, whose members are variable in length and level of conservation. The presence of numerous frameshifts and internal stop codons in multiple alignments are thought to indicate that most family members are no longer functional [].
Probab=24.37  E-value=4.2e+02  Score=24.50  Aligned_cols=85  Identities=19%  Similarity=0.213  Sum_probs=49.0

Q ss_pred             HHHHHHhhcccCCCCCcEEEEcCCCCeEEE--EcchHH---HHHHhcCCCCHHHHHHHHHHHHHC-ChHHHHH-------
Q 044269           18 QVADLVNKQRSASINDFEIFHDSGSNTWNV--VGAGLQ---RFVQMTNWRYLDSERRFQHGLEAC-GVTKSLM-------   84 (129)
Q Consensus        18 ~v~~~L~~~~~~~~~~f~I~k~~e~g~f~V--~G~~IE---r~v~~tnfd~~es~~rF~r~Lk~~-GV~~aLk-------   84 (129)
                      ++.+.|+..--+.-.+|++..   +|.|+|  +-+.|-   ++...=+-.-+..+++|..++++. |..+.++       
T Consensus       295 ~~~~~~k~agl~eg~~~~~~~---~g~y~I~iT~~GLr~i~~lA~~Gd~~Aer~ir~Lee~a~aR~G~~~~~~L~E~lrp  371 (512)
T PF07775_consen  295 AVVNALKAAGLEEGKDFTVKS---SGQYVIRITYDGLREIQRLARQGDEEAERAIRRLEEIAEARHGFYDLKKLIEYLRP  371 (512)
T ss_pred             HHHHHHHhcccccCCcceeec---CCeEEEEEcHHHHHHHHHHHHcCcHHHHHHHHHHHHHHHHhcChHHHHhHHhhCCc
Confidence            444444433333346888855   344444  344444   444444444556677888888888 9888777       


Q ss_pred             -------HcCCCCC-----CEEEEcCEEEEEEe
Q 044269           85 -------KLGVKEG-----DTVIVGDMEMVWHD  105 (129)
Q Consensus        85 -------kaGakeG-----DtV~IGd~EFey~e  105 (129)
                             +.|..-.     =+++|-|+..+|.+
T Consensus       372 a~e~gtvd~~l~VeD~er~vkarV~dvk~e~v~  404 (512)
T PF07775_consen  372 AREAGTVDLPLAVEDEERGVKARVVDVKVEWVE  404 (512)
T ss_pred             hhhcccccCCeEEeeCCCceEEEEEEEEEEEee
Confidence                   2232222     24677788888843


No 133
>PF08922 DUF1905:  Domain of unknown function (DUF1905);  InterPro: IPR015018 This family consist of hypothetical bacterial proteins. ; PDB: 2D9R_A.
Probab=24.26  E-value=65  Score=21.71  Aligned_cols=20  Identities=35%  Similarity=0.461  Sum_probs=11.4

Q ss_pred             CChHHHHH-HcCCCCCCEEEE
Q 044269           77 CGVTKSLM-KLGVKEGDTVIV   96 (129)
Q Consensus        77 ~GV~~aLk-kaGakeGDtV~I   96 (129)
                      ++|.++++ +.|+.+||+|.+
T Consensus        58 Lpv~~~vRk~~g~~~Gd~V~v   78 (80)
T PF08922_consen   58 LPVKAAVRKAIGKEAGDTVEV   78 (80)
T ss_dssp             EEE-HHHHHHHT--TTSEEEE
T ss_pred             EEEcHHHHHHcCCCCCCEEEE
Confidence            34555554 468999999986


No 134
>cd04867 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown. The N-terminal domain of the YchF protein belongs to the Obg-like family of GTPases, and some members of the family contain a C-terminal TGS domain. TGS is a small domain of about 50 amino acid residues with a predominantly beta-sheet structure. There is no direct information on the function of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role.
Probab=24.21  E-value=85  Score=22.11  Aligned_cols=9  Identities=33%  Similarity=0.833  Sum_probs=7.0

Q ss_pred             CCCCCEEEE
Q 044269           88 VKEGDTVIV   96 (129)
Q Consensus        88 akeGDtV~I   96 (129)
                      ++|||++.+
T Consensus        73 v~DGDi~~f   81 (83)
T cd04867          73 VQDGDIIFF   81 (83)
T ss_pred             eeCCeEEEE
Confidence            788998763


No 135
>PRK10113 cell division modulator; Provisional
Probab=24.11  E-value=47  Score=23.03  Aligned_cols=37  Identities=16%  Similarity=0.430  Sum_probs=27.0

Q ss_pred             CeEEEEcchH------HHHHHhcCCCCHHHHHHHHHHHHHCCh
Q 044269           43 NTWNVVGAGL------QRFVQMTNWRYLDSERRFQHGLEACGV   79 (129)
Q Consensus        43 g~f~V~G~~I------Er~v~~tnfd~~es~~rF~r~Lk~~GV   79 (129)
                      .+|++.|+++      |++-+.--|..+||..|..+.++.-+.
T Consensus        35 DVW~LrGKYVAFvl~ge~FrRSPaFs~PEsAQRWAnQirQe~~   77 (80)
T PRK10113         35 DVWMLRGKYVAFVLMGESFLRSPAFSVPESAQRWANQIRQEGE   77 (80)
T ss_pred             hhheeccceEEEEEechhhccCCccCCcHHHHHHHHHhhhhhh
Confidence            3677777775      334444559999999999999886554


No 136
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs. Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs, all of which are a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to members of the type I periplasmic binding protein superfamily. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor
Probab=24.00  E-value=1.3e+02  Score=22.67  Aligned_cols=23  Identities=13%  Similarity=0.011  Sum_probs=17.2

Q ss_pred             HCChHHHHHHcCCCCCCEEEEcC
Q 044269           76 ACGVTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        76 ~~GV~~aLkkaGakeGDtV~IGd   98 (129)
                      .+|+.++|+++|++-++-|.|.+
T Consensus       190 A~g~~~al~~~g~~ip~dv~v~g  212 (264)
T cd06274         190 LEGVLRFLRERPGLAPSDLRIAT  212 (264)
T ss_pred             HHHHHHHHHHcCCCCCcceEEEE
Confidence            45889999999998655555543


No 137
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=23.99  E-value=1.2e+02  Score=24.50  Aligned_cols=29  Identities=14%  Similarity=0.334  Sum_probs=21.0

Q ss_pred             hHHHHHHcC--CCCCCEEEEcCEEEEEEecCCC
Q 044269           79 VTKSLMKLG--VKEGDTVIVGDMEMVWHDSANN  109 (129)
Q Consensus        79 V~~aLkkaG--akeGDtV~IGd~EFey~ed~~~  109 (129)
                      +.++|++..  ++++|+|.|  ++|++.+-.+.
T Consensus        82 Li~~LkriYg~lr~ed~VTI--i~Fe~v~~~d~  112 (188)
T COG2411          82 LIEELKRIYGELRDEDIVTI--IEFEVVEKLDK  112 (188)
T ss_pred             HHHHHHHHcCcCCCCceEEE--EEEEEehhccc
Confidence            356677776  999999999  67777654433


No 138
>PRK10050 curli assembly protein CsgF; Provisional
Probab=23.97  E-value=2.7e+02  Score=21.34  Aligned_cols=46  Identities=7%  Similarity=0.061  Sum_probs=36.9

Q ss_pred             CCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEEEEEEec
Q 044269           61 WRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDMEMVWHDS  106 (129)
Q Consensus        61 fd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~EFey~ed  106 (129)
                      +.+.-++.||.+-|++.=+...++..+..+--++..||++.++.++
T Consensus        62 ~~~~sald~F~~sLqs~Lls~L~~~i~~G~~G~~~tgd~~i~i~~~  107 (138)
T PRK10050         62 IETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVTNDYIVDIANR  107 (138)
T ss_pred             ccchhHHHHHHHHHHHHHHHHHHhhccCCCCceEEECCEEEEEEec
Confidence            4666779999999999888888887776566688889999997644


No 139
>PRK10377 PTS system glucitol/sorbitol-specific transporter subunit IIA; Provisional
Probab=23.94  E-value=80  Score=23.32  Aligned_cols=17  Identities=12%  Similarity=0.141  Sum_probs=14.5

Q ss_pred             CCCCCCEEEEcCEEEEE
Q 044269           87 GVKEGDTVIVGDMEMVW  103 (129)
Q Consensus        87 GakeGDtV~IGd~EFey  103 (129)
                      -++.||++.|++.+|.-
T Consensus        51 ~i~~Gd~l~i~~~~Y~I   67 (120)
T PRK10377         51 ALQPGLQFELGQHRYPV   67 (120)
T ss_pred             ccCCCCEEEECCEEEEE
Confidence            48999999999988753


No 140
>PF10431 ClpB_D2-small:  C-terminal, D2-small domain, of ClpB protein ;  InterPro: IPR019489  Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation []. This entry represents the C-terminal domain of Clp ATPases, often referred to as the D2-small domain, which forms a mixed alpha-beta structure. Compared with the adjacent AAA D1-small domain (IPR003959 from INTERPRO) it lacks the long coiled-coil insertion, and instead of helix C4 contains a beta-strand (e3) that is part of a three stranded beta-pleated sheet. In Thermophilus the whole protein forms a hexamer with the D1-small and D2-small domains located on the outside of the hexamer, with the long coiled-coil being exposed on the surface. The D2-small domain is essential for oligomerisation, forming a tight interface with the D2-large domain of a neighbouring subunit, thereby providing enough binding energy to stabilise the functional assembly [].; PDB: 3HWS_A 3HTE_F 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 3PXI_A 1R6B_X ....
Probab=23.86  E-value=1.4e+02  Score=19.39  Aligned_cols=20  Identities=35%  Similarity=0.461  Sum_probs=17.1

Q ss_pred             CChHHHHHHcCCCCCCEEEE
Q 044269           77 CGVTKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~I   96 (129)
                      -=+.++|-...+++|++|+|
T Consensus        62 ~~la~~il~~~~~~g~~v~v   81 (81)
T PF10431_consen   62 PPLADAILSGKIKEGDTVRV   81 (81)
T ss_dssp             HHHHHHHHHSCSCTTCEEEE
T ss_pred             HHHHHHHHcCCCCCcCEeeC
Confidence            35778889999999999987


No 141
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC_UbP (bone marrow stromal cell-derived ubiquitin-like protein) has an N-terminal ubiquitin-like (UBQ) domain and a C-terminal ubiquitin-associated (UBA) domain, a domain architecture similar to those of the UBIN, Chap1, and ubiquilin proteins.  This CD represents the N-terminal ubiquitin-like domain.
Probab=23.83  E-value=74  Score=21.73  Aligned_cols=17  Identities=24%  Similarity=0.505  Sum_probs=14.2

Q ss_pred             HHHHHHcCCCCCCEEEE
Q 044269           80 TKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~I   96 (129)
                      ++-|...||++|++|.+
T Consensus        56 ~~TL~dygI~~gstlhL   72 (75)
T cd01815          56 DQTLDFYGIQSGSTIHI   72 (75)
T ss_pred             CCcHHHcCCCCCCEEEE
Confidence            35788999999999975


No 142
>TIGR02166 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family. Members of this family include known and probable dimethyl sulfoxide reductase (DMSO reductase) A chains. In E. coli, dmsA encodes the canonical anaerobic DMSO reductase A chain. The paralog ynfE, as part of ynfFGH expressed from a multicopy plasmid, could complement a dmsABC deletion, suggesting a similar function and some overlap in specificity, although YnfE could not substitute for DmsA in a mixed complex.
Probab=23.81  E-value=52  Score=30.39  Aligned_cols=18  Identities=28%  Similarity=0.366  Sum_probs=14.8

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      +.-++.||++||.|+|.+
T Consensus       712 ~dA~~lGI~dGD~V~V~s  729 (797)
T TIGR02166       712 IDAQKRGITNGDMVRIFN  729 (797)
T ss_pred             HHHHHhCCCcCCEEEEEe
Confidence            345789999999999953


No 143
>COG0611 ThiL Thiamine monophosphate kinase [Coenzyme metabolism]
Probab=23.77  E-value=53  Score=28.10  Aligned_cols=18  Identities=39%  Similarity=0.660  Sum_probs=15.0

Q ss_pred             HHHHHcCCCCCCEEEEcC
Q 044269           81 KSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IGd   98 (129)
                      .+|.+.|||+||.|.+-+
T Consensus       141 ~~l~R~gAkpGD~v~vtG  158 (317)
T COG0611         141 RALLRSGAKPGDLVAVTG  158 (317)
T ss_pred             chhhccCCCCCCEEEEcC
Confidence            368888999999999854


No 144
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein. Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus.  Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules.
Probab=23.58  E-value=79  Score=19.58  Aligned_cols=17  Identities=24%  Similarity=0.489  Sum_probs=13.7

Q ss_pred             HHHHHHcCCCCCCEEEE
Q 044269           80 TKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~I   96 (129)
                      ..-|...|+++|++|.+
T Consensus        53 ~~~L~~~~i~~~~~l~l   69 (72)
T cd01809          53 DETLSEYKVEDGHTIHL   69 (72)
T ss_pred             cCcHHHCCCCCCCEEEE
Confidence            34677889999999875


No 145
>TIGR00849 gutA PTS system, glucitol/sorbitol-specific IIA component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria.The system in E.Coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.
Probab=23.34  E-value=84  Score=23.27  Aligned_cols=17  Identities=18%  Similarity=0.417  Sum_probs=14.4

Q ss_pred             CCCCCCEEEEcCEEEEE
Q 044269           87 GVKEGDTVIVGDMEMVW  103 (129)
Q Consensus        87 GakeGDtV~IGd~EFey  103 (129)
                      -++.||++.||+.+|.-
T Consensus        51 ~i~~Gd~l~i~~~~Y~I   67 (121)
T TIGR00849        51 TLKPGQVFMIGGIAYPV   67 (121)
T ss_pred             CcCCCCEEEECCEEEEE
Confidence            48999999999988753


No 146
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription]
Probab=23.32  E-value=67  Score=21.95  Aligned_cols=15  Identities=40%  Similarity=0.539  Sum_probs=11.9

Q ss_pred             HHcCCCCCCEEEEcC
Q 044269           84 MKLGVKEGDTVIVGD   98 (129)
Q Consensus        84 kkaGakeGDtV~IGd   98 (129)
                      +..|+++||.|.|..
T Consensus        24 ~~lgi~~Gd~lei~~   38 (89)
T COG2002          24 EALGIKEGDVLEIIV   38 (89)
T ss_pred             HHhCCCCCCEEEEEE
Confidence            456999999988753


No 147
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549). Most likely, these enzymes are phosphatases.
Probab=23.25  E-value=71  Score=23.70  Aligned_cols=20  Identities=15%  Similarity=0.443  Sum_probs=16.5

Q ss_pred             HHHHHHc-CCCCCCEEEEcCE
Q 044269           80 TKSLMKL-GVKEGDTVIVGDM   99 (129)
Q Consensus        80 ~~aLkka-GakeGDtV~IGd~   99 (129)
                      ..+|++. |+++.++|.|||-
T Consensus       159 ~~~~~~~~~~~~~~~v~igD~  179 (224)
T TIGR02254       159 NYALERMPKFSKEEVLMIGDS  179 (224)
T ss_pred             HHHHHHhcCCCchheEEECCC
Confidence            4567777 9999999999985


No 148
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=23.16  E-value=58  Score=22.56  Aligned_cols=14  Identities=64%  Similarity=0.821  Sum_probs=11.6

Q ss_pred             CCCCCCEEEEcCEE
Q 044269           87 GVKEGDTVIVGDME  100 (129)
Q Consensus        87 GakeGDtV~IGd~E  100 (129)
                      ++|+||+|.+.+-.
T Consensus         5 ~Vk~Gd~ViV~~~~   18 (75)
T PF11302_consen    5 SVKPGDTVIVQDEQ   18 (75)
T ss_pred             ccCCCCEEEEecCc
Confidence            68999999987654


No 149
>PRK06342 transcription elongation factor regulatory protein; Validated
Probab=23.12  E-value=89  Score=23.99  Aligned_cols=16  Identities=44%  Similarity=0.607  Sum_probs=13.4

Q ss_pred             CCCCCCEEEEcCEEEE
Q 044269           87 GVKEGDTVIVGDMEMV  102 (129)
Q Consensus        87 GakeGDtV~IGd~EFe  102 (129)
                      |-+.||+|.++.+.|+
T Consensus       140 Gk~vGD~V~v~~~~~e  155 (160)
T PRK06342        140 GKAVGDVVSVGGQELE  155 (160)
T ss_pred             CCCCCCEEEECCEEEE
Confidence            9999999999866654


No 150
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED. HAD subfamilies caused by an overly broad single model.
Probab=23.10  E-value=87  Score=22.29  Aligned_cols=21  Identities=33%  Similarity=0.463  Sum_probs=16.2

Q ss_pred             HHHHHHcCCCCCCEEEEcCEE
Q 044269           80 TKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IGd~E  100 (129)
                      ..++++.|+.++++|.|||-.
T Consensus       147 ~~~~~~~~~~~~~~~~vgD~~  167 (183)
T TIGR01509       147 LLALKKLGLKPEECLFVDDSP  167 (183)
T ss_pred             HHHHHHcCCCcceEEEEcCCH
Confidence            445666788999999999854


No 151
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains and becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=23.01  E-value=81  Score=20.29  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=13.4

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      +.|...|+++|+++.+
T Consensus        52 ~tL~~~~i~~~~tl~l   67 (74)
T cd01810          52 HPLGEYGLKPGCTVFM   67 (74)
T ss_pred             CCHHHcCCCCCCEEEE
Confidence            4678889999999875


No 152
>PF14250 AbrB-like:  AbrB-like transcriptional regulator
Probab=23.01  E-value=69  Score=22.05  Aligned_cols=13  Identities=31%  Similarity=0.659  Sum_probs=9.6

Q ss_pred             HHcCCCCCCEEEE
Q 044269           84 MKLGVKEGDTVIV   96 (129)
Q Consensus        84 kkaGakeGDtV~I   96 (129)
                      +++|.++||...|
T Consensus        49 ~~m~L~PGdEFeI   61 (71)
T PF14250_consen   49 KQMGLKPGDEFEI   61 (71)
T ss_pred             HHhCCCCCCEEEE
Confidence            3458899998665


No 153
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=22.93  E-value=54  Score=23.71  Aligned_cols=14  Identities=43%  Similarity=0.534  Sum_probs=11.5

Q ss_pred             HHcCCCCCCEEEEc
Q 044269           84 MKLGVKEGDTVIVG   97 (129)
Q Consensus        84 kkaGakeGDtV~IG   97 (129)
                      ...|+++||.|.|+
T Consensus        48 ~~~~~~~GD~V~v~   61 (135)
T PF04246_consen   48 NPIGAKVGDRVEVE   61 (135)
T ss_pred             CCCCCCCCCEEEEE
Confidence            35699999999975


No 154
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs. Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs from other bacteria. This group belongs to the the LacI-GalR family repressors that are composed of two functional domains: an N-terminal  HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding.
Probab=22.84  E-value=1.2e+02  Score=23.25  Aligned_cols=23  Identities=26%  Similarity=0.434  Sum_probs=17.9

Q ss_pred             CChHHHHHHcCCCCCCEEEEcCE
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd~   99 (129)
                      +|+.++|+++|++-.|-+.|-++
T Consensus       193 ~g~~~~l~~~g~~vP~di~vvg~  215 (269)
T cd06297         193 LGALQEAVELGLTVGEDVRVVGF  215 (269)
T ss_pred             HHHHHHHHHcCCCCCCceEEEEE
Confidence            68999999999986666665444


No 155
>TIGR01923 menE O-succinylbenzoate-CoA ligase. This model represents an enzyme, O-succinylbenzoate-CoA ligase, which is involved in the fourth step of the menaquinone biosynthesis pathway. O-succinylbenzoate-CoA ligase, together with menB - naphtoate synthase, take 2-succinylbenzoate and convert it into 1,4-di-hydroxy-2- naphtoate.
Probab=22.82  E-value=81  Score=25.60  Aligned_cols=17  Identities=29%  Similarity=0.501  Sum_probs=13.0

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      ..|+++|++.||.|.|.
T Consensus        14 ~~l~~~g~~~gd~v~i~   30 (436)
T TIGR01923        14 KALKAQGIRSGSRVALV   30 (436)
T ss_pred             HHHHHhCCCCCCEEEEE
Confidence            34566788999999883


No 156
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=22.71  E-value=83  Score=19.71  Aligned_cols=16  Identities=13%  Similarity=0.358  Sum_probs=12.9

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      ..|.+.|+++|++|.+
T Consensus        54 ~~L~~~~i~~~~~i~l   69 (76)
T cd01803          54 RTLSDYNIQKESTLHL   69 (76)
T ss_pred             CcHHHcCCCCCCEEEE
Confidence            3577789999999875


No 157
>PRK14132 riboflavin kinase; Provisional
Probab=22.70  E-value=67  Score=24.15  Aligned_cols=11  Identities=45%  Similarity=0.842  Sum_probs=9.8

Q ss_pred             cCCCCCCEEEE
Q 044269           86 LGVKEGDTVIV   96 (129)
Q Consensus        86 aGakeGDtV~I   96 (129)
                      .+.+|||.|.|
T Consensus       114 L~LkDGD~V~I  124 (126)
T PRK14132        114 LNLKDGDVVKI  124 (126)
T ss_pred             cCCCCCCEEEE
Confidence            59999999987


No 158
>TIGR02316 propion_prpE propionate--CoA ligase. This family contains one of three readily separable clades of proteins in the group of acetate and propionate--CoA ligases. Characterized members of this family act on propionate. From propionyl-CoA, there is a cyclic degradation pathway: it is ligated by PrpC to the TCA cycle intermediate oxaloacetate, acted upon further by PrpD and an aconitase, then cleaved by PrpB to pyruvate and the TCA cycle intermediate succinate.
Probab=22.64  E-value=79  Score=27.86  Aligned_cols=19  Identities=37%  Similarity=0.588  Sum_probs=14.5

Q ss_pred             hHHHHHHcCCCCCCEEEEc
Q 044269           79 VTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~IG   97 (129)
                      +-..|++.|++.||.|.|.
T Consensus        96 lA~~L~~~Gv~~Gd~V~i~  114 (628)
T TIGR02316        96 FASALRALGVGRGDRVLIY  114 (628)
T ss_pred             HHHHHHHcCCCCCCEEEEE
Confidence            3456677788999999874


No 159
>cd00591 HU_IHF Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and higher-order nucleoprotein complex assembly. The dimer subunits associate to form a compact globular core from which two beta ribbon arms (one from each subunit) protrude. The beta arms track and bind the DNA minor groove.  Despite sequence and structural similarity, IHF and HU can be distinguished by their different DNA substrate preferences.
Probab=22.63  E-value=1e+02  Score=20.10  Aligned_cols=43  Identities=14%  Similarity=0.173  Sum_probs=29.6

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCEE
Q 044269           51 GLQRFVQMTNWRYLDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        51 ~IEr~v~~tnfd~~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~E  100 (129)
                      -++++..++++...++..-+...+..+.  +     -+.+|+.|.|+++=
T Consensus         5 l~~~ia~~~~~~~~~v~~vl~~~~~~i~--~-----~L~~g~~V~l~~~G   47 (87)
T cd00591           5 LIEAIAEKTGLSKKDAEAAVDAFLDVIT--E-----ALAKGEKVELPGFG   47 (87)
T ss_pred             HHHHHHHHhCcCHHHHHHHHHHHHHHHH--H-----HHhCCCeEEEeCCE
Confidence            4677888888887777766665555432  2     34588899997653


No 160
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenase-like. Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is belonged to the alcohol dehydrogenase-like superfamily. They are distinct from other alcohol dehydrogenases which contain different protein domains.  Proteins of this family have not been characterized. Their specific function is unknown.
Probab=22.36  E-value=70  Score=27.08  Aligned_cols=43  Identities=26%  Similarity=0.267  Sum_probs=32.6

Q ss_pred             chHHHHHHhcCCCC---------HHHHHHHHHHHHHCChHHHHHHcCCCCCC
Q 044269           50 AGLQRFVQMTNWRY---------LDSERRFQHGLEACGVTKSLMKLGVKEGD   92 (129)
Q Consensus        50 ~~IEr~v~~tnfd~---------~es~~rF~r~Lk~~GV~~aLkkaGakeGD   92 (129)
                      +++.++.+.++.+.         .+.+.++.+.++++|+-..|.+.|+.+.|
T Consensus       295 ~~~~~la~~~g~~~~~~~~~~~~~~~~~~i~~l~~~lglp~~L~e~gv~~~~  346 (377)
T cd08188         295 ERYARIAEALGLDVRGLTTEEAALAVIEAVRRLRAALGVPETLGDLGVKRED  346 (377)
T ss_pred             HHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCCHHHcCCCHHH
Confidence            45666666666543         34578888999999999999999987755


No 161
>PF02424 ApbE:  ApbE family;  InterPro: IPR003374 This prokaryotic family of lipoproteins are related to ApbE, from Salmonella typhimurium. ApbE is involved in thiamine synthesis []. More specifically is may be involved in the conversion of aminoimidazole ribotide (AIR) to 4-amino-5-hydroxymethyl-2-methyl pyrimidine (HMP) during the biosynthesis of the pyrimidine moiety of thiamine.; PDB: 2O34_B 2O18_C 1VRM_A 3PND_D.
Probab=22.32  E-value=23  Score=28.49  Aligned_cols=32  Identities=28%  Similarity=0.436  Sum_probs=28.3

Q ss_pred             HHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcCE
Q 044269           65 DSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        65 es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd~   99 (129)
                      -++.+..+.|++.|+..+|.++|   ||...+|..
T Consensus       117 yavD~~~~~L~~~gi~~~lVn~G---Gdi~~~G~~  148 (254)
T PF02424_consen  117 YAVDRAAELLREAGITNALVNAG---GDIRAIGSK  148 (254)
T ss_dssp             HHHHHHHHHHHHTTTSCEEEEET---TEEEEESBC
T ss_pred             HHHHHHHHHHHHcCCCeEEEeCC---CcEEEeccC
Confidence            46788888999999999999999   999998865


No 162
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=22.31  E-value=63  Score=29.58  Aligned_cols=17  Identities=53%  Similarity=0.890  Sum_probs=14.8

Q ss_pred             HHHHHHcCCCCCCEEEE
Q 044269           80 TKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~I   96 (129)
                      -..|+++||+.||+|.+
T Consensus        67 Aa~l~~lGi~~Gd~vlv   83 (542)
T COG1021          67 AAGLRRLGIKPGDTVLV   83 (542)
T ss_pred             HHHHHhcCCCCCCEEEE
Confidence            45788999999999986


No 163
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. ABP is only involved in transport contrary to other related sugar-binding proteins such as the glucose/galactose-binding protein (GGBP) and the ribose-binding protein (RBP), both of which are involved in chemotaxis as well as transport. The periplasmic ABP consists of two alpha/beta globular domains connected by a three-stranded hinge, a Venus flytrap-like domain, which undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, ABP is homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR) and DNA-binding transcriptional repressors such a
Probab=22.19  E-value=65  Score=24.65  Aligned_cols=22  Identities=23%  Similarity=0.430  Sum_probs=16.9

Q ss_pred             HCChHHHHHHcCCCCCCEEEEc
Q 044269           76 ACGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        76 ~~GV~~aLkkaGakeGDtV~IG   97 (129)
                      .+|+.++|+++|+++.|...||
T Consensus       206 a~g~~~al~~~g~~~~di~vig  227 (289)
T cd01540         206 VLGAVRATEQSGIAAADVIGVG  227 (289)
T ss_pred             HHHHHHHHHHcCCCCcceEEEe
Confidence            4578899999999965665554


No 164
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=22.17  E-value=74  Score=23.57  Aligned_cols=15  Identities=27%  Similarity=0.512  Sum_probs=12.1

Q ss_pred             HHcCCCCCCEEEEcC
Q 044269           84 MKLGVKEGDTVIVGD   98 (129)
Q Consensus        84 kkaGakeGDtV~IGd   98 (129)
                      +.+|+++||++...+
T Consensus        30 krr~ik~GD~IiF~~   44 (111)
T COG4043          30 KRRQIKPGDKIIFNG   44 (111)
T ss_pred             hhcCCCCCCEEEEcC
Confidence            457999999998763


No 165
>TIGR03145 cyt_nit_nrfE cytochrome c nitrate reductase biogenesis protein NrfE. Members of this protein family closely resemble the CcmF protein of the CcmABCDEFGH system, or system I, for c-type cytochrome biogenesis (GenProp0678). Members are found, as a rule, next to closely related paralogs of CcmG and CcmH and always located near other genes associated with the cytochrome c nitrite reductase enzyme complex. As a rule, members are found in species that also encode bona fide members of the CcmF, CcmG, and CcmH families.
Probab=22.03  E-value=95  Score=29.01  Aligned_cols=44  Identities=18%  Similarity=0.172  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHCChH------------HHHHHcCCCCCCEEEEcCEEEEEEecCCCC
Q 044269           67 ERRFQHGLEACGVT------------KSLMKLGVKEGDTVIVGDMEMVWHDSANNP  110 (129)
Q Consensus        67 ~~rF~r~Lk~~GV~------------~aLkkaGakeGDtV~IGd~EFey~ed~~~~  110 (129)
                      .++.-..+-+.||-            +.=++.-.++||++.++++++.|.+-....
T Consensus       481 ~~~~G~~laH~Gval~~~Gi~~ss~~~~e~~~~l~~Ge~~~~~~y~~~~~~~~~~~  536 (628)
T TIGR03145       481 LRQLGMVLAHLGVAICAIGAIMVSYFGSEIGVRLAPQQQQPLGGYEFRYQGFENVI  536 (628)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccccceeEEEECCCCeEEEcCEEEEEeeceecC
Confidence            35566666666642            222344568999999999999997754433


No 166
>PLN00045 photosystem I reaction center subunit IV; Provisional
Probab=21.99  E-value=75  Score=23.18  Aligned_cols=21  Identities=29%  Similarity=0.534  Sum_probs=18.7

Q ss_pred             cCCCCCCEEEEcCEEEEEEec
Q 044269           86 LGVKEGDTVIVGDMEMVWHDS  106 (129)
Q Consensus        86 aGakeGDtV~IGd~EFey~ed  106 (129)
                      -|++-|+.|+|-.-|=.|+.+
T Consensus        38 ig~~RGskVrIlR~ESYWyn~   58 (101)
T PLN00045         38 IGPKRGSKVKILRPESYWFND   58 (101)
T ss_pred             cccCCCCEEEEccccceeecC
Confidence            489999999999999888766


No 167
>cd01807 GDX_N ubiquitin-like domain of GDX. GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain.  The function of GDX is unknown.
Probab=21.97  E-value=88  Score=20.05  Aligned_cols=17  Identities=12%  Similarity=0.178  Sum_probs=14.2

Q ss_pred             HHHHHHcCCCCCCEEEE
Q 044269           80 TKSLMKLGVKEGDTVIV   96 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~I   96 (129)
                      +.-|...|+++|++|.+
T Consensus        53 ~~~L~~~~i~~~~~l~l   69 (74)
T cd01807          53 DKRLSDYSIGPNAKLNL   69 (74)
T ss_pred             CCCHHHCCCCCCCEEEE
Confidence            45688999999999975


No 168
>PF00240 ubiquitin:  Ubiquitin family;  InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade. There are many different E3 ligases, which are responsible for the type of ubiquitin chain formed, the specificity of the target protein, and the regulation of the ubiquitinylation process []. Ubiquitinylation is an important regulatory tool that controls the concentration of key signalling proteins, such as those involved in cell cycle control, as well as removing misfolded, damaged or mutant proteins that could be harmful to the cell. Several ubiquitin-like molecules have been discovered, such as Ufm1 (IPR005375 from INTERPRO), SUMO1 (IPR003653 from INTERPRO), NEDD8, Rad23 (IPR004806 from INTERPRO), Elongin B and Parkin (IPR003977 from INTERPRO), the latter being involved in Parkinson's disease []. Ubiquitin is a protein of 76 amino acid residues, found in all eukaryotic cells and whose sequence is extremely well conserved from protozoan to vertebrates. Ubiquitin acts through its post-translational attachment (ubiquitinylation) to other proteins, where these modifications alter the function, location or trafficking of the protein, or targets it for destruction by the 26S proteasome []. The terminal glycine in the C-terminal 4-residue tail of ubiquitin can form an isopeptide bond with a lysine residue in the target protein, or with a lysine in another ubiquitin molecule to form a ubiquitin chain that attaches itself to a target protein. Ubiquitin has seven lysine residues, any one of which can be used to link ubiquitin molecules together, resulting in different structures that alter the target protein in different ways. It appears that Lys(11)-, Lys(29) and Lys(48)-linked poly-ubiquitin chains target the protein to the proteasome for degradation, while mono-ubiquitinylated and Lys(6)- or Lys(63)-linked poly-ubiquitin chains signal reversible modifications in protein activity, location or trafficking []. For example, Lys(63)-linked poly-ubiquitinylation is known to be involved in DNA damage tolerance, inflammatory response, protein trafficking and signal transduction through kinase activation []. In addition, the length of the ubiquitin chain alters the fate of the target protein. Regulatory proteins such as transcription factors and histones are frequent targets of ubquitinylation [].; GO: 0005515 protein binding; PDB: 2DZI_A 2XEW_E 3NOB_E 2KWU_B 2Y5B_F 3PHD_G 2KWV_B 2KOX_A 2XK5_B 3NHE_B ....
Probab=21.93  E-value=41  Score=20.92  Aligned_cols=16  Identities=38%  Similarity=0.744  Sum_probs=11.6

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      ..|.+.|+++|++|.+
T Consensus        49 ~tL~~~~i~~~~~I~l   64 (69)
T PF00240_consen   49 KTLSDYGIKDGSTIHL   64 (69)
T ss_dssp             SBTGGGTTSTTEEEEE
T ss_pred             CcHHHcCCCCCCEEEE
Confidence            4566778888888764


No 169
>PRK10369 heme lyase subunit NrfE; Provisional
Probab=21.93  E-value=86  Score=29.02  Aligned_cols=44  Identities=14%  Similarity=0.171  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHCChHHH------------HHHcCCCCCCEEEEcCEEEEEEecCCCC
Q 044269           67 ERRFQHGLEACGVTKS------------LMKLGVKEGDTVIVGDMEMVWHDSANNP  110 (129)
Q Consensus        67 ~~rF~r~Lk~~GV~~a------------LkkaGakeGDtV~IGd~EFey~ed~~~~  110 (129)
                      .++.--.+-+.|+-=.            =++.-.++||++.+++++|.|.+-....
T Consensus       417 ~~~~g~~laH~Gval~~~Gi~~ss~~~~e~~~~l~~G~~~~~~~y~~~~~~~~~~~  472 (571)
T PRK10369        417 RVQLPALLAHAGVLLFAAGIVVSSVSRQEISLNLQPGQQVTLAGYTFRFERLDLQA  472 (571)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccceeEEEEECCCCcEEEecEEEEEeeeeecc
Confidence            4555666666664221            1233348999999999999997754433


No 170
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=21.81  E-value=63  Score=24.44  Aligned_cols=41  Identities=10%  Similarity=0.117  Sum_probs=29.2

Q ss_pred             CCCCHHHHHHHHHHHH---------------HCChHHHHHHcCCCCCCEEEEcCEE
Q 044269           60 NWRYLDSERRFQHGLE---------------ACGVTKSLMKLGVKEGDTVIVGDME  100 (129)
Q Consensus        60 nfd~~es~~rF~r~Lk---------------~~GV~~aLkkaGakeGDtV~IGd~E  100 (129)
                      +++...+...+.+.|+               .+|+.++|+++|++.++.|.|-++.
T Consensus       153 ~~~~~~~~~~~~~~l~~~~~~~ai~~~~d~~a~g~~~~l~~~g~~~p~di~iig~d  208 (263)
T cd06280         153 APTAEAAEAALAAWLAAPERPEALVASNGLLLLGALRAVRAAGLRIPQDLALAGFD  208 (263)
T ss_pred             ccCHHHHHHHHHHHhcCCCCCcEEEECCcHHHHHHHHHHHHcCCCCCCcEEEEEeC
Confidence            3444555666677775               3488999999999988888775443


No 171
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(pos
Probab=21.71  E-value=69  Score=19.56  Aligned_cols=17  Identities=24%  Similarity=0.710  Sum_probs=13.2

Q ss_pred             HcCCCCCCEEE-EcCEEE
Q 044269           85 KLGVKEGDTVI-VGDMEM  101 (129)
Q Consensus        85 kaGakeGDtV~-IGd~EF  101 (129)
                      ++|++.||.|. |++...
T Consensus        28 ~~gl~~GD~I~~Ing~~v   45 (70)
T cd00136          28 RAGLQAGDVILAVNGTDV   45 (70)
T ss_pred             HcCCCCCCEEEEECCEEC
Confidence            47999999886 666654


No 172
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120. SF3a120_C  Mammalian splicing factor SF3a consists of three subunits of 60, 66, and 120 kDa and functions early during pre-mRNA splicing by converting the U2 snRNP to its active form.  The 120kDa subunit (SF3a120) has a carboxy-terminal ubiquitin-like domain and two SWAP (suppressor-of-white-apricot) domains, referred to collectively as the SURP module, at its amino-terminus.
Probab=21.71  E-value=87  Score=20.34  Aligned_cols=16  Identities=19%  Similarity=0.326  Sum_probs=13.4

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      .-|...|+++|++|.+
T Consensus        51 ~tL~~~~i~~g~~l~v   66 (76)
T cd01800          51 NSLAYYNLANGTIIHL   66 (76)
T ss_pred             CcHHHcCCCCCCEEEE
Confidence            4677889999999976


No 173
>PF01041 DegT_DnrJ_EryC1:  DegT/DnrJ/EryC1/StrS aminotransferase family;  InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions. The family includes StsA P72454 from SWISSPROT, StsC P77952 from SWISSPROT and StsS []. The aminotransferase activity was demonstrated for purified StsC protein as the L-glutamine:scyllo-inosose aminotransferase 2.6.1.50 from EC, which catalyses the first amino transfer in the biosynthesis of the streptidine subunit of streptomycin [].; PDB: 2FNI_A 2FNU_A 2FN6_A 2PO3_A 3UWC_A 1O61_B 1O62_B 1O69_B 1B9I_A 1B9H_A ....
Probab=21.70  E-value=1.3e+02  Score=24.96  Aligned_cols=25  Identities=32%  Similarity=0.470  Sum_probs=19.8

Q ss_pred             CChHHHHHHcCCCCCCEEEEcCEEE
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGDMEM  101 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd~EF  101 (129)
                      .++.-+|+..|+++||.|.+-.+.|
T Consensus        51 ~Al~~al~~l~~~~gdeVi~p~~t~   75 (363)
T PF01041_consen   51 SALHLALRALGLGPGDEVIVPAYTF   75 (363)
T ss_dssp             HHHHHHHHHTTGGTTSEEEEESSS-
T ss_pred             HHHHHHHHhcCCCcCceEecCCCcc
Confidence            3577889999999999999875443


No 174
>TIGR03354 VI_FHA type VI secretion system FHA domain protein. Members of this protein family are FHA (forkhead-associated) domain-containing proteins that are part of type VI secretion loci in a considerable number of bacteria, most of which are known pathogens. Species include Pseudomonas aeruginosa PAO1, Aeromonas hydrophila, Yersinia pestis, Burkholderia mallei, etc.
Probab=21.57  E-value=97  Score=27.00  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=16.4

Q ss_pred             CCCCCEEEEcCEEEEEEe
Q 044269           88 VKEGDTVIVGDMEMVWHD  105 (129)
Q Consensus        88 akeGDtV~IGd~EFey~e  105 (129)
                      +++||+|.||++++.+.-
T Consensus        86 L~~GD~I~iG~~~lrv~~  103 (396)
T TIGR03354        86 LEQGDRLRLGDYEIRVSL  103 (396)
T ss_pred             cCCCCEEEECCEEEEEEe
Confidence            889999999999998865


No 175
>TIGR02693 arsenite_ox_L arsenite oxidase, large subunit. This model represents the large subunit of an arsenite oxidase complex. The small subunit is a Rieske protein. Homologs to both large and small subunits that score in the gray zone between the set trusted and noise bit score cutoffs for the respective models are found in Aeropyrum pernix K1 and in Sulfolobus tokodaii str. 7. This enzyme acts in energy metabolim by arsenite oxidation, rather than detoxification by reduction of arsenate to arsenite prior to export.
Probab=21.46  E-value=77  Score=29.98  Aligned_cols=17  Identities=41%  Similarity=0.544  Sum_probs=14.7

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +.-++.||++||.|+|.
T Consensus       732 ~DA~~lGI~dGD~V~V~  748 (806)
T TIGR02693       732 EDAKRLGLKSGDLVEVY  748 (806)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            55678999999999995


No 176
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=21.39  E-value=65  Score=22.22  Aligned_cols=20  Identities=35%  Similarity=0.647  Sum_probs=15.4

Q ss_pred             HHHHHHcCCCCCCEEEEcCE
Q 044269           80 TKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IGd~   99 (129)
                      ..++++.|+++.++|.|||-
T Consensus       140 ~~~~~~~~~~p~~~~~vgD~  159 (176)
T PF13419_consen  140 RRALEKLGIPPEEILFVGDS  159 (176)
T ss_dssp             HHHHHHHTSSGGGEEEEESS
T ss_pred             HHHHHHcCCCcceEEEEeCC
Confidence            44555569999999999974


No 177
>PRK05609 nusG transcription antitermination protein NusG; Validated
Probab=21.39  E-value=84  Score=23.46  Aligned_cols=34  Identities=26%  Similarity=0.302  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHCChHHHHHHcCCCCCCEEEEcC
Q 044269           64 LDSERRFQHGLEACGVTKSLMKLGVKEGDTVIVGD   98 (129)
Q Consensus        64 ~es~~rF~r~Lk~~GV~~aLkkaGakeGDtV~IGd   98 (129)
                      .+-+..|.+.+.. +....-...+++.||.|+|-+
T Consensus       104 ~~ei~~l~~~~~~-~~~~~~~~~~~~~Gd~VrI~~  137 (181)
T PRK05609        104 EKEVEKILKQLQE-GVEKPKPKVDFEVGEMVRVID  137 (181)
T ss_pred             HHHHHHHHHHhhc-ccccCccccCCCCCCEEEEec
Confidence            3446666554433 322222357899999999954


No 178
>PF15007 CEP44:  Centrosomal spindle body, CEP44
Probab=21.26  E-value=41  Score=25.46  Aligned_cols=30  Identities=20%  Similarity=0.293  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHHHCChHHHHHHcCCCCCCE
Q 044269           64 LDSERRFQHGLEACGVTKSLMKLGVKEGDT   93 (129)
Q Consensus        64 ~es~~rF~r~Lk~~GV~~aLkkaGakeGDt   93 (129)
                      ..++.+|++.|++++-...+-..|+..||.
T Consensus         3 ~~~l~~L~~~Lr~~~yp~~vd~~~l~~G~p   32 (131)
T PF15007_consen    3 KGNLRRLEQELRSLKYPDEVDYQGLYKGDP   32 (131)
T ss_pred             hhHHHHHHHHHHHCCCCCccCHHHHhcCCH
Confidence            357889999999999888888888888875


No 179
>PRK03584 acetoacetyl-CoA synthetase; Provisional
Probab=21.18  E-value=88  Score=27.67  Aligned_cols=19  Identities=37%  Similarity=0.478  Sum_probs=15.0

Q ss_pred             hHHHHHHcCCCCCCEEEEc
Q 044269           79 VTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~IG   97 (129)
                      +-..|++.|++.||+|.|.
T Consensus       127 lA~~L~~~Gv~~gd~V~i~  145 (655)
T PRK03584        127 LAAALRALGVGPGDRVAAY  145 (655)
T ss_pred             HHHHHHHcCCCCCCEEEEE
Confidence            4456778889999999874


No 180
>PF05896 NQRA:  Na(+)-translocating NADH-quinone reductase subunit A (NQRA);  InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins. The Na+-translocating NADH: ubiquinone oxidoreductase (Na+-NQR) generates an electrochemical Na+ potential driven by aerobic respiration [].; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0006814 sodium ion transport, 0055114 oxidation-reduction process
Probab=21.16  E-value=85  Score=26.25  Aligned_cols=18  Identities=44%  Similarity=0.488  Sum_probs=15.6

Q ss_pred             HcCCCCCCEEEEcCEEEE
Q 044269           85 KLGVKEGDTVIVGDMEMV  102 (129)
Q Consensus        85 kaGakeGDtV~IGd~EFe  102 (129)
                      ++=+|+||.|+.|+--|+
T Consensus        42 km~VkeGD~Vk~Gq~LF~   59 (257)
T PF05896_consen   42 KMLVKEGDRVKAGQPLFE   59 (257)
T ss_pred             cEEeccCCEEeCCCeeEe
Confidence            345899999999999997


No 181
>PRK13532 nitrate reductase catalytic subunit; Provisional
Probab=21.12  E-value=64  Score=30.25  Aligned_cols=17  Identities=29%  Similarity=0.405  Sum_probs=14.1

Q ss_pred             HHHHHcCCCCCCEEEEc
Q 044269           81 KSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        81 ~aLkkaGakeGDtV~IG   97 (129)
                      +.-++.||++||.|+|.
T Consensus       753 ~DA~~~GI~dGD~V~V~  769 (830)
T PRK13532        753 EDAKARGLRRGDEVKVV  769 (830)
T ss_pred             HHHHHcCCCCCCEEEEE
Confidence            34468899999999995


No 182
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=21.12  E-value=94  Score=19.44  Aligned_cols=16  Identities=13%  Similarity=0.270  Sum_probs=13.0

Q ss_pred             HHHHHcCCCCCCEEEE
Q 044269           81 KSLMKLGVKEGDTVIV   96 (129)
Q Consensus        81 ~aLkkaGakeGDtV~I   96 (129)
                      .-|...|+++|++|.+
T Consensus        54 ~tl~~~~i~~g~~i~l   69 (76)
T cd01806          54 KTAADYKLEGGSVLHL   69 (76)
T ss_pred             CCHHHcCCCCCCEEEE
Confidence            3577789999999875


No 183
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=20.87  E-value=68  Score=25.46  Aligned_cols=13  Identities=15%  Similarity=0.342  Sum_probs=9.4

Q ss_pred             HcCCCCCCEEEEc
Q 044269           85 KLGVKEGDTVIVG   97 (129)
Q Consensus        85 kaGakeGDtV~IG   97 (129)
                      ..=+++||.|.|=
T Consensus       137 tv~a~aGDvifiP  149 (176)
T COG4766         137 TVIAGAGDVIFIP  149 (176)
T ss_pred             eEecCCCcEEEec
Confidence            3457888888883


No 184
>PRK10524 prpE propionyl-CoA synthetase; Provisional
Probab=20.79  E-value=91  Score=27.31  Aligned_cols=18  Identities=39%  Similarity=0.621  Sum_probs=14.2

Q ss_pred             HHHHHHcCCCCCCEEEEc
Q 044269           80 TKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        80 ~~aLkkaGakeGDtV~IG   97 (129)
                      -..|++.|++.||.|.|.
T Consensus        98 A~~L~~~Gv~~gd~V~i~  115 (629)
T PRK10524         98 AAMLRSLGVQRGDRVLIY  115 (629)
T ss_pred             HHHHHHcCCCCCCEEEEE
Confidence            356677788999999885


No 185
>PLN02860 o-succinylbenzoate-CoA ligase
Probab=20.74  E-value=90  Score=26.90  Aligned_cols=19  Identities=32%  Similarity=0.796  Sum_probs=14.5

Q ss_pred             hHHHHHHcCCCCCCEEEEc
Q 044269           79 VTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        79 V~~aLkkaGakeGDtV~IG   97 (129)
                      +-.+|.++|+++||+|-|.
T Consensus        45 la~~L~~~Gv~~gd~V~v~   63 (563)
T PLN02860         45 LAAGLLRLGLRNGDVVAIA   63 (563)
T ss_pred             HHHHHHHhCCCCCCEEEEE
Confidence            4445677788999999874


No 186
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=20.30  E-value=72  Score=24.06  Aligned_cols=21  Identities=24%  Similarity=0.273  Sum_probs=15.9

Q ss_pred             CChHHHHHHcCCCCCCEEEEc
Q 044269           77 CGVTKSLMKLGVKEGDTVIVG   97 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IG   97 (129)
                      +|+.++|+++|++.++.|.|-
T Consensus       188 ~g~~~~l~~~g~~~p~di~ii  208 (265)
T cd06285         188 IGVMGAARDRGLRVPDDVALV  208 (265)
T ss_pred             HHHHHHHHHcCCCCCcceEEE
Confidence            589999999999855445543


No 187
>COG1827 Predicted small molecule binding protein (contains 3H domain) [General function prediction only]
Probab=20.28  E-value=1.6e+02  Score=23.14  Aligned_cols=30  Identities=20%  Similarity=0.310  Sum_probs=23.3

Q ss_pred             EEEEcchHHHHHHhcCCCCHHHHHHHHHHHHHCC
Q 044269           45 WNVVGAGLQRFVQMTNWRYLDSERRFQHGLEACG   78 (129)
Q Consensus        45 f~V~G~~IEr~v~~tnfd~~es~~rF~r~Lk~~G   78 (129)
                      ..|.|+    +-+..+..+++.+.+|.+.|+..|
T Consensus       101 H~IyG~----i~~~l~v~~~edve~fv~~Le~s~  130 (168)
T COG1827         101 HPIYGE----ITASLDVKDREDVERFVEKLEESG  130 (168)
T ss_pred             eeeecc----cccccccCCHHHHHHHHHHHHHcC
Confidence            445553    345667889999999999999998


No 188
>TIGR02369 trimeth_pyl trimethylamine:corrinoid methyltransferase. This model represents a distinct subfamily of pfam06253. All members here are trimethylamine:corrinoid methyltransferases that contain a critical pyrrolysine residue incorporated during translation via a special tRNA for a TAG (amber) codon. Known members so far are from the genus Methanosarcina. It is one of a suite of three non-homologous enzymes with a critical UAG-encoded pyrrolysine residue in these species (along with dimethylamine methyltransferase and monomethylamine methyltransferase). It demethylates trimethylamine, leaving dimethylamine, and methylates the prosthetic group of its small cognate corrinoid protein, MttC. The methyl group is then transferred by methylcorrinoid:coenzyme M methyltransferase to coenzyme M. Note that the pyrrolysine residue is variously translated as K or X, or as a stop codon that truncates the sequence.
Probab=20.26  E-value=1e+02  Score=28.03  Aligned_cols=26  Identities=19%  Similarity=0.180  Sum_probs=19.4

Q ss_pred             HHHHHCChHH-------HHHHcCCC---CCCEEEEc
Q 044269           72 HGLEACGVTK-------SLMKLGVK---EGDTVIVG   97 (129)
Q Consensus        72 r~Lk~~GV~~-------aLkkaGak---eGDtV~IG   97 (129)
                      ++|+..||.-       .++++|++   +|..|+|.
T Consensus        33 ~iLee~Gi~~~~~eale~~~~aGa~V~~~~~rV~~p   68 (489)
T TIGR02369        33 DVLMNPGVQVSDPEARQIFKENGCEVDEKTNVVKIP   68 (489)
T ss_pred             HHHHHcCCccCCHHHHHHHHHcCCEEcCCCCEEEeC
Confidence            3677777654       67899999   56778876


No 189
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=20.16  E-value=72  Score=20.30  Aligned_cols=20  Identities=30%  Similarity=0.446  Sum_probs=15.3

Q ss_pred             HHHcCCCCCCEE-EEcCEEEE
Q 044269           83 LMKLGVKEGDTV-IVGDMEMV  102 (129)
Q Consensus        83 LkkaGakeGDtV-~IGd~EFe  102 (129)
                      ..++|+++||.| .|++....
T Consensus        37 a~~~gl~~GD~I~~Ing~~i~   57 (90)
T cd00987          37 AAKAGLKPGDVILAVNGKPVK   57 (90)
T ss_pred             HHHcCCCcCCEEEEECCEECC
Confidence            456899999965 78888764


No 190
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. This group includes the periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=20.14  E-value=65  Score=25.43  Aligned_cols=23  Identities=26%  Similarity=0.494  Sum_probs=17.7

Q ss_pred             CChHHHHHHcCCCCCCEEEEcCE
Q 044269           77 CGVTKSLMKLGVKEGDTVIVGDM   99 (129)
Q Consensus        77 ~GV~~aLkkaGakeGDtV~IGd~   99 (129)
                      +|+.++|+++|++-++.|.|-++
T Consensus       215 ~g~~~al~~~g~~vp~di~vig~  237 (305)
T cd06324         215 FGALRAAKEAGRKPGRDVLFGGV  237 (305)
T ss_pred             HHHHHHHHHcCCCcCCCEEEEec
Confidence            68999999999997655555444


No 191
>PRK09798 antitoxin MazE; Provisional
Probab=20.13  E-value=95  Score=21.33  Aligned_cols=15  Identities=20%  Similarity=0.284  Sum_probs=12.5

Q ss_pred             HHHHcCCCCCCEEEE
Q 044269           82 SLMKLGVKEGDTVIV   96 (129)
Q Consensus        82 aLkkaGakeGDtV~I   96 (129)
                      .|+++|+.+||+|.|
T Consensus        21 ~l~~l~l~~g~~vei   35 (82)
T PRK09798         21 LMQALNLNIDDEVKI   35 (82)
T ss_pred             HHHHcCCCCCCEEEE
Confidence            477889999999865


Done!