Query         044290
Match_columns 80
No_of_seqs    101 out of 142
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 13:11:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044290.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044290hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04832 SOUL:  SOUL heme-bindi  99.2 1.1E-11 2.5E-16   86.4   3.0   39   40-79      1-39  (176)
  2 PF10731 Anophelin:  Thrombin i  50.9      17 0.00036   23.0   2.3   34    1-47      1-34  (65)
  3 PF07803 GSG-1:  GSG1-like prot  50.7      26 0.00057   24.4   3.5   19   51-69     76-95  (118)
  4 PF14260 zf-C4pol:  C4-type zin  36.9      24 0.00052   21.1   1.4   17   30-46     53-69  (73)
  5 PRK07868 acyl-CoA synthetase;   29.6      59  0.0013   28.4   3.1   24   40-63     34-57  (994)
  6 PF03366 YEATS:  YEATS family;   25.4      86  0.0019   19.9   2.6   20   40-59     37-57  (84)
  7 TIGR01711 gspJ general secreti  23.9      80  0.0017   22.5   2.5   24   45-68    139-162 (192)
  8 PF14783 BBS2_Mid:  Ciliary BBS  23.4      78  0.0017   21.5   2.3   21   47-67     17-37  (111)
  9 cd01061 RNase_T2_euk Ribonucle  21.8      68  0.0015   22.4   1.8   18   22-41     34-51  (195)
 10 PF00735 Septin:  Septin;  Inte  21.5      73  0.0016   24.1   2.0   31   42-76    199-237 (281)
 11 cd03067 PDI_b_PDIR_N PDIb fami  20.4      24 0.00053   24.4  -0.7   30   37-66     57-92  (112)

No 1  
>PF04832 SOUL:  SOUL heme-binding protein;  InterPro: IPR006917 This family represents a group of putative haem-binding proteins []. It includes archaeal and bacterial homologues.; PDB: 2HVA_A 2GOV_A 4A1M_A 3R85_E 2YC9_A 3R8K_B 3R8J_B.
Probab=99.19  E-value=1.1e-11  Score=86.40  Aligned_cols=39  Identities=44%  Similarity=0.894  Sum_probs=30.7

Q ss_pred             CcCCCCeEEEeecCceeEEeeCCCCeEEecccccCcchhc
Q 044290           40 RIECPSFETVHVGNGFEIRRYDSSMWMSTSPIQDISLVEA   79 (80)
Q Consensus        40 ~~EcP~Y~vv~~~~dYEvR~Y~~skWVST~~V~~~s~~~A   79 (80)
                      ++|||+|+|+++.++||||+|++++||+|. +.+.++++|
T Consensus         1 ~~E~P~Y~v~~~~~~~EiR~Y~~~~w~~t~-~~~~~~~~a   39 (176)
T PF04832_consen    1 DIECPPYEVLKKGDDYEIRRYPPAKWASTT-VSGCSFEEA   39 (176)
T ss_dssp             --BS-SEEEECCCSSCEEEEE--CEEEEEE-EECS-HHHH
T ss_pred             CCcCCCeEEEEeCCCEEEEEECCceEEEEE-ecCCChhHH
Confidence            469999999999999999999999999997 888877765


No 2  
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=50.90  E-value=17  Score=23.03  Aligned_cols=34  Identities=24%  Similarity=0.342  Sum_probs=18.6

Q ss_pred             CcchhhHHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCcCCcCCCCeE
Q 044290            1 MAAGLSMLKLSVLSLLSNLNSGLWPESSKGLKMFPPTCNRIECPSFE   47 (80)
Q Consensus         1 ~~~~~~~~~ls~l~~~~~~~~~~~~~~~~g~~~~P~fC~~~EcP~Y~   47 (80)
                      ||..+  |.++|||+..++.-       |+   .|..-+| |-|.|+
T Consensus         1 MA~Kl--~vialLC~aLva~v-------Q~---APQYa~G-eeP~YD   34 (65)
T PF10731_consen    1 MASKL--IVIALLCVALVAIV-------QS---APQYAPG-EEPSYD   34 (65)
T ss_pred             Ccchh--hHHHHHHHHHHHHH-------hc---CcccCCC-CCCCcC
Confidence            56655  66677555433221       11   4666665 678874


No 3  
>PF07803 GSG-1:  GSG1-like protein;  InterPro: IPR012478 This family contains sequences bearing similarity to a region of GSG1 (Q9Z1H7 from SWISSPROT), a protein specifically expressed in testicular germ cells []. It is possible that over expression of the human homologue may be involved in tumourigenesis of human testicular germ cell tumours []. The region in question has four highly conserved cysteine residues. 
Probab=50.65  E-value=26  Score=24.43  Aligned_cols=19  Identities=26%  Similarity=0.805  Sum_probs=15.8

Q ss_pred             ecCc-eeEEeeCCCCeEEec
Q 044290           51 VGNG-FEIRRYDSSMWMSTS   69 (80)
Q Consensus        51 ~~~d-YEvR~Y~~skWVST~   69 (80)
                      .++| |-.|.+..+.|.|-+
T Consensus        76 TGDDkF~fr~FHtG~W~SCE   95 (118)
T PF07803_consen   76 TGDDKFIFRYFHTGIWLSCE   95 (118)
T ss_pred             cCCceeehhhhhcchhhhhh
Confidence            3445 999999999999976


No 4  
>PF14260 zf-C4pol:  C4-type zinc-finger of DNA polymerase delta
Probab=36.94  E-value=24  Score=21.12  Aligned_cols=17  Identities=29%  Similarity=0.747  Sum_probs=13.6

Q ss_pred             CCCCCCCCcCCcCCCCe
Q 044290           30 GLKMFPPTCNRIECPSF   46 (80)
Q Consensus        30 g~~~~P~fC~~~EcP~Y   46 (80)
                      |....+.-|...|||.|
T Consensus        53 ~~~~~~~~C~s~DCpV~   69 (73)
T PF14260_consen   53 GSLHEEIECDSLDCPVF   69 (73)
T ss_pred             CcCCCCCcccCCCCCcc
Confidence            44446888999999998


No 5  
>PRK07868 acyl-CoA synthetase; Validated
Probab=29.58  E-value=59  Score=28.35  Aligned_cols=24  Identities=21%  Similarity=0.252  Sum_probs=20.5

Q ss_pred             CcCCCCeEEEeecCceeEEeeCCC
Q 044290           40 RIECPSFETVHVGNGFEIRRYDSS   63 (80)
Q Consensus        40 ~~EcP~Y~vv~~~~dYEvR~Y~~s   63 (80)
                      +..+-+++||.+++-+|+|+|.+.
T Consensus        34 ~~~~tp~~vv~~~~~~~l~~y~~~   57 (994)
T PRK07868         34 GSVPSPFQIVESVPMYRLRRYFPP   57 (994)
T ss_pred             cCCCCCCcEEEEcCcEEEEEeCCC
Confidence            345778999999999999999764


No 6  
>PF03366 YEATS:  YEATS family;  InterPro: IPR005033  Named the YEATS family, after `YNK7', `ENL', `AF-9', and `TFIIF small subunit', this family also contains the GAS41 protein. All these proteins are thought to have a transcription stimulatory activity.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3QRL_A 2L7E_A 3FK3_C 3RLS_A.
Probab=25.42  E-value=86  Score=19.91  Aligned_cols=20  Identities=35%  Similarity=0.513  Sum_probs=14.0

Q ss_pred             CcCCCCeEEEeecC-ceeEEe
Q 044290           40 RIECPSFETVHVGN-GFEIRR   59 (80)
Q Consensus        40 ~~EcP~Y~vv~~~~-dYEvR~   59 (80)
                      -++.|+|+|.+.+= +|+++.
T Consensus        37 ~v~~pPFevte~GWGeF~i~I   57 (84)
T PF03366_consen   37 VVTKPPFEVTETGWGEFEIPI   57 (84)
T ss_dssp             ECSSTTEEEEEEESS--EEEE
T ss_pred             EecCCCCEEEEeEeccEEEEE
Confidence            34899999999974 577763


No 7  
>TIGR01711 gspJ general secretion pathway protein J. Both GspI and GspJ are proteins of the type II secretion pathway, or main terminal branch of the general secretion pathway. This pathway carries proteins across the outer membrane. Note that proteins of type II secretion are cryptic in E. coli K-12 - present but not yet demonstrated to act on any target.
Probab=23.91  E-value=80  Score=22.48  Aligned_cols=24  Identities=17%  Similarity=0.250  Sum_probs=19.9

Q ss_pred             CeEEEeecCceeEEeeCCCCeEEe
Q 044290           45 SFETVHVGNGFEIRRYDSSMWMST   68 (80)
Q Consensus        45 ~Y~vv~~~~dYEvR~Y~~skWVST   68 (80)
                      ...+++.-++|++|.|.++.|...
T Consensus       139 ~~~LL~~V~~~~~r~~~~~~W~~~  162 (192)
T TIGR01711       139 IQPVLDGVTALSWRFYDKGNWQGE  162 (192)
T ss_pred             eeehhcCccEEEEEEECCCccccc
Confidence            456777788999999999999864


No 8  
>PF14783 BBS2_Mid:  Ciliary BBSome complex subunit 2, middle region
Probab=23.40  E-value=78  Score=21.53  Aligned_cols=21  Identities=24%  Similarity=0.385  Sum_probs=16.0

Q ss_pred             EEEeecCceeEEeeCCCCeEE
Q 044290           47 ETVHVGNGFEIRRYDSSMWMS   67 (80)
Q Consensus        47 ~vv~~~~dYEvR~Y~~skWVS   67 (80)
                      +++--.+|||||.|+...=+.
T Consensus        17 eLlvGs~D~~IRvf~~~e~~~   37 (111)
T PF14783_consen   17 ELLVGSDDFEIRVFKGDEIVA   37 (111)
T ss_pred             eEEEecCCcEEEEEeCCcEEE
Confidence            466668899999999875544


No 9  
>cd01061 RNase_T2_euk Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far.  This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases).  Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen. Generally, RNases have two distinct binding sites: the primary site (B1 site) and the subsite (B2 site), for nucleotides located at the 5'- and 3'- terminal ends of the sessil bond, respectively. This CD includes the eukaryotic RNase T2 family members.
Probab=21.81  E-value=68  Score=22.42  Aligned_cols=18  Identities=33%  Similarity=1.045  Sum_probs=13.4

Q ss_pred             CCCCCCCCCCCCCCCCcCCc
Q 044290           22 GLWPESSKGLKMFPPTCNRI   41 (80)
Q Consensus        22 ~~~~~~~~g~~~~P~fC~~~   41 (80)
                      ||||+...  +..|.+|++.
T Consensus        34 GLWP~~~~--g~~p~~C~~~   51 (195)
T cd01061          34 GLWPDNCS--GTYPQFCDSS   51 (195)
T ss_pred             ccCCCCCC--CCCCCCCCCc
Confidence            67998665  3469999864


No 10 
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=21.47  E-value=73  Score=24.07  Aligned_cols=31  Identities=16%  Similarity=0.395  Sum_probs=18.0

Q ss_pred             CCCCeEEEeecCceeE--------EeeCCCCeEEecccccCcc
Q 044290           42 ECPSFETVHVGNGFEI--------RRYDSSMWMSTSPIQDISL   76 (80)
Q Consensus        42 EcP~Y~vv~~~~dYEv--------R~Y~~skWVST~~V~~~s~   76 (80)
                      ++++|-|+.+.+.++.        |+|.   |=..+ |.+..+
T Consensus       199 ~~~PFavi~s~~~~~~~~g~~~~gR~Yp---WG~ve-v~n~~h  237 (281)
T PF00735_consen  199 SMLPFAVIGSNTEIENSNGKRVRGRKYP---WGTVE-VENPEH  237 (281)
T ss_dssp             HC-SEEE---SSEEEE-SSSEEEEEEET---TEEEE-TT-TTT
T ss_pred             cceeeEEEecceeeeccCCcEEeeeecC---Ccccc-cccccc
Confidence            5899999998887777        8886   44444 555443


No 11 
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity. The TRX-like b domain of PDIR is critical for its chaperone activity.
Probab=20.39  E-value=24  Score=24.42  Aligned_cols=30  Identities=17%  Similarity=0.431  Sum_probs=21.7

Q ss_pred             CcCCcC----CCCeEEE--eecCceeEEeeCCCCeE
Q 044290           37 TCNRIE----CPSFETV--HVGNGFEIRRYDSSMWM   66 (80)
Q Consensus        37 fC~~~E----cP~Y~vv--~~~~dYEvR~Y~~skWV   66 (80)
                      -|++.|    |-+..|.  .+-+.||+++|..|.|=
T Consensus        57 dCgd~e~kKLCKKlKv~~~~kp~~~~LkHYKdG~fH   92 (112)
T cd03067          57 DCGDSESRKLCKKLKVDPSSKPKPVELKHYKDGDFH   92 (112)
T ss_pred             ecCChHHHHHHHHHccCCCCCCCcchhhcccCCCcc
Confidence            466543    7777777  34567999999999874


Done!