Query         044315
Match_columns 437
No_of_seqs    53 out of 55
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 13:27:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044315.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044315hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05605 zf-Di19:  Drought indu  82.9    0.44 9.6E-06   36.0   0.3   26  338-364     1-26  (54)
  2 PF13894 zf-C2H2_4:  C2H2-type   71.8    0.82 1.8E-05   27.6  -0.8   24  340-363     1-24  (24)
  3 KOG1842 FYVE finger-containing  71.7     1.4   3E-05   47.4   0.3   30  334-363    10-39  (505)
  4 PF12756 zf-C2H2_2:  C2H2 type   59.2     2.6 5.7E-05   33.0  -0.4   33  335-367    46-79  (100)
  5 PF09237 GAGA:  GAGA factor;  I  55.1     3.2   7E-05   33.1  -0.5   30  335-364    20-49  (54)
  6 PF12874 zf-met:  Zinc-finger o  48.7     4.3 9.3E-05   25.6  -0.6   22  340-361     1-22  (25)
  7 cd03024 DsbA_FrnE DsbA family,  46.5      10 0.00022   33.7   1.2   20  335-354     2-21  (201)
  8 PF00096 zf-C2H2:  Zinc finger,  45.3     3.9 8.4E-05   25.3  -1.2   22  340-361     1-22  (23)
  9 cd03021 DsbA_GSTK DsbA family,  40.0      11 0.00024   34.6   0.5   13  335-347     4-16  (209)
 10 PF13909 zf-H2C2_5:  C2H2-type   36.7       6 0.00013   25.0  -1.3   23  340-363     1-23  (24)
 11 PF01323 DSBA:  DSBA-like thior  36.6      14 0.00029   32.4   0.4   12  336-347     4-15  (193)
 12 cd03022 DsbA_HCCA_Iso DsbA fam  36.5      14  0.0003   32.4   0.5   24  335-358     2-25  (192)
 13 COG2761 FrnE Predicted dithiol  35.7      15 0.00033   36.2   0.6   21  333-353     7-27  (225)
 14 PF12171 zf-C2H2_jaz:  Zinc-fin  27.5      24 0.00053   23.0   0.4   22  340-361     2-23  (27)
 15 PF09231 RDV-p3:  Rice dwarf vi  26.8      30 0.00064   39.4   1.1   36   44-83    173-213 (965)
 16 cd02972 DsbA_family DsbA famil  25.3      29 0.00064   25.9   0.5   18  337-354     4-21  (98)
 17 cd03019 DsbA_DsbA DsbA family,  25.3      35 0.00076   29.4   1.0   32  338-372    23-54  (178)
 18 smart00355 ZnF_C2H2 zinc finge  24.4      29 0.00062   20.6   0.3   24  340-364     1-24  (26)
 19 PF12756 zf-C2H2_2:  C2H2 type   22.5      29 0.00062   27.2   0.0   24  342-365     2-25  (100)
 20 PF13871 Helicase_C_4:  Helicas  22.2      56  0.0012   33.1   1.9   32   94-125    86-125 (278)
 21 cd03023 DsbA_Com1_like DsbA fa  21.5      37 0.00081   28.1   0.5   11  338-348    13-23  (154)

No 1  
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=82.90  E-value=0.44  Score=35.99  Aligned_cols=26  Identities=31%  Similarity=0.609  Sum_probs=22.8

Q ss_pred             ccCCCchhhhhcccccchhhhhccccc
Q 044315          338 EDFSCPFCLAKCASFKGLRYHLSSSHD  364 (437)
Q Consensus       338 edFsCPfCl~~C~sfkGL~~HL~ssHD  364 (437)
                      +.|.||||.. =-+..+|..|....|-
T Consensus         1 ~~f~CP~C~~-~~~~~~L~~H~~~~H~   26 (54)
T PF05605_consen    1 DSFTCPYCGK-GFSESSLVEHCEDEHR   26 (54)
T ss_pred             CCcCCCCCCC-ccCHHHHHHHHHhHCc
Confidence            5799999998 5778899999999885


No 2  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=71.82  E-value=0.82  Score=27.58  Aligned_cols=24  Identities=38%  Similarity=0.747  Sum_probs=19.5

Q ss_pred             CCCchhhhhcccccchhhhhcccc
Q 044315          340 FSCPFCLAKCASFKGLRYHLSSSH  363 (437)
Q Consensus       340 FsCPfCl~~C~sfkGL~~HL~ssH  363 (437)
                      |.||.|.....+...|+.|+..-|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            569999999999999999998765


No 3  
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=71.70  E-value=1.4  Score=47.41  Aligned_cols=30  Identities=37%  Similarity=0.748  Sum_probs=28.3

Q ss_pred             eeccccCCCchhhhhcccccchhhhhcccc
Q 044315          334 TEVTEDFSCPFCLAKCASFKGLRYHLSSSH  363 (437)
Q Consensus       334 TEvtedFsCPfCl~~C~sfkGL~~HL~ssH  363 (437)
                      .||+|+|.||+|+..=.+|..|-.|+---|
T Consensus        10 ~~i~egflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   10 GEILEGFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             chhhhcccCchHhhhhhhHHHHHHHHhhhc
Confidence            589999999999999999999999998887


No 4  
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=59.20  E-value=2.6  Score=33.03  Aligned_cols=33  Identities=36%  Similarity=0.667  Sum_probs=24.2

Q ss_pred             eccccCCCchhhhhcccccchhhhhccc-ccccc
Q 044315          335 EVTEDFSCPFCLAKCASFKGLRYHLSSS-HDLFN  367 (437)
Q Consensus       335 EvtedFsCPfCl~~C~sfkGL~~HL~ss-HDlF~  367 (437)
                      .+.+.+.|++|.....+..+|+.||.+. |-...
T Consensus        46 ~~~~~~~C~~C~~~f~s~~~l~~Hm~~~~H~~~~   79 (100)
T PF12756_consen   46 KVKESFRCPYCNKTFRSREALQEHMRSKHHKKRN   79 (100)
T ss_dssp             ---SSEEBSSSS-EESSHHHHHHHHHHTTTTC-S
T ss_pred             ccCCCCCCCccCCCCcCHHHHHHHHcCccCCCcc
Confidence            3566899999999999999999999875 54443


No 5  
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=55.05  E-value=3.2  Score=33.11  Aligned_cols=30  Identities=30%  Similarity=0.491  Sum_probs=21.7

Q ss_pred             eccccCCCchhhhhcccccchhhhhccccc
Q 044315          335 EVTEDFSCPFCLAKCASFKGLRYHLSSSHD  364 (437)
Q Consensus       335 EvtedFsCPfCl~~C~sfkGL~~HL~ssHD  364 (437)
                      +....-+||-|...|.+=..|+.||...|-
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            345567899999999999999999998883


No 6  
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=48.69  E-value=4.3  Score=25.63  Aligned_cols=22  Identities=41%  Similarity=0.665  Sum_probs=20.1

Q ss_pred             CCCchhhhhcccccchhhhhcc
Q 044315          340 FSCPFCLAKCASFKGLRYHLSS  361 (437)
Q Consensus       340 FsCPfCl~~C~sfkGL~~HL~s  361 (437)
                      |.|.-|.+.+.+-..|+.|+.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5799999999999999999976


No 7  
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.
Probab=46.48  E-value=10  Score=33.72  Aligned_cols=20  Identities=20%  Similarity=0.619  Sum_probs=13.9

Q ss_pred             eccccCCCchhhhhcccccc
Q 044315          335 EVTEDFSCPFCLAKCASFKG  354 (437)
Q Consensus       335 EvtedFsCPfCl~~C~sfkG  354 (437)
                      |+--||.||||+.-=..+..
T Consensus         2 ~~~~D~~cP~cyl~~~~l~~   21 (201)
T cd03024           2 DIWSDVVCPWCYIGKRRLEK   21 (201)
T ss_pred             eEEecCcCccHHHHHHHHHH
Confidence            56779999999973333333


No 8  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=45.33  E-value=3.9  Score=25.35  Aligned_cols=22  Identities=27%  Similarity=0.683  Sum_probs=19.4

Q ss_pred             CCCchhhhhcccccchhhhhcc
Q 044315          340 FSCPFCLAKCASFKGLRYHLSS  361 (437)
Q Consensus       340 FsCPfCl~~C~sfkGL~~HL~s  361 (437)
                      |.||.|.....+-..|+.|+..
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5799999999999999999876


No 9  
>cd03021 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase Kappa (GSTK) subfamily; GSTK is a member of the GST family of enzymes which catalyzes the transfer of the thiol of GSH to electrophilic substrates. It is specifically located in the mitochondria and peroxisomes, unlike other members of the canonical GST family, which are mainly cytosolic. The biological substrates of GSTK are not yet known. It is presumed to have a protective role during respiration when large amounts of reactive oxygen species are generated. GSTK has the same general fold as DsbA, consisting of a thioredoxin domain interrupted by an alpha-helical domain and its biological unit is a homodimer. GSTK is closely related to the bacterial enzyme, 2-hydroxychromene-2-carboxylate (HCCA) isomerase. It shows little sequence similarity to the other members of the GST family.
Probab=39.99  E-value=11  Score=34.60  Aligned_cols=13  Identities=23%  Similarity=0.419  Sum_probs=11.2

Q ss_pred             eccccCCCchhhh
Q 044315          335 EVTEDFSCPFCLA  347 (437)
Q Consensus       335 EvtedFsCPfCl~  347 (437)
                      |+--||.||||++
T Consensus         4 d~~~D~vcPwcyl   16 (209)
T cd03021           4 ELYYDVVSPYSYL   16 (209)
T ss_pred             EEEEeCCChHHHH
Confidence            4667999999997


No 10 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=36.68  E-value=6  Score=25.03  Aligned_cols=23  Identities=30%  Similarity=0.723  Sum_probs=17.1

Q ss_pred             CCCchhhhhcccccchhhhhcccc
Q 044315          340 FSCPFCLAKCASFKGLRYHLSSSH  363 (437)
Q Consensus       340 FsCPfCl~~C~sfkGL~~HL~ssH  363 (437)
                      |.|++|...+. -.+|..|+..-|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56999998887 889999987544


No 11 
>PF01323 DSBA:  DSBA-like thioredoxin domain;  InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family []. The efficient and correct folding of bacterial disulphide bonded proteins in vivo is dependent upon a class of periplasmic oxidoreductase proteins called DsbA, after the Escherichia coli enzyme. The bacterial protein-folding factor DsbA is the most oxidizing of the thioredoxin family. DsbA catalyses disulphide-bond formation during the folding of secreted proteins. The extremely oxidizing nature of DsbA has been proposed to result from either domain motion or stabilising active-site interactions in the reduced form. DsbA's highly oxidizing nature is a result of hydrogen bond, electrostatic and helix-dipole interactions that favour the thiolate over the disulphide at the active site []. In the pathogenic bacterium Vibrio cholerae, the DsbA homologue (TcpG) is responsible for the folding, maturation and secretion of virulence factors. While the overall architecture of TcpG and DsbA is similar and the surface features are retained in TcpG, there are significant differences. For example, the kinked active site helix results from a three-residue loop in DsbA, but is caused by a proline in TcpG (making TcpG more similar to thioredoxin in this respect). Furthermore, the proposed peptide binding groove of TcpG is substantially shortened compared with that of DsbA due to a six-residue deletion. Also, the hydrophobic pocket of TcpG is more shallow and the acidic patch is much less extensive than that of E. coli DsbA [].; GO: 0015035 protein disulfide oxidoreductase activity; PDB: 3GL5_A 3DKS_D 3RPP_C 3RPN_B 1YZX_A 3L9V_C 2IMD_A 2IME_A 2IMF_A 2B3S_B ....
Probab=36.65  E-value=14  Score=32.38  Aligned_cols=12  Identities=42%  Similarity=1.024  Sum_probs=10.0

Q ss_pred             ccccCCCchhhh
Q 044315          336 VTEDFSCPFCLA  347 (437)
Q Consensus       336 vtedFsCPfCl~  347 (437)
                      +--|+.||||+.
T Consensus         4 ~~~D~~Cp~cy~   15 (193)
T PF01323_consen    4 FFFDFICPWCYL   15 (193)
T ss_dssp             EEEBTTBHHHHH
T ss_pred             EEEeCCCHHHHH
Confidence            446899999996


No 12 
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).
Probab=36.52  E-value=14  Score=32.38  Aligned_cols=24  Identities=21%  Similarity=0.340  Sum_probs=15.8

Q ss_pred             eccccCCCchhhhhcccccchhhh
Q 044315          335 EVTEDFSCPFCLAKCASFKGLRYH  358 (437)
Q Consensus       335 EvtedFsCPfCl~~C~sfkGL~~H  358 (437)
                      |+--|+.||||+.-=..+.-+..+
T Consensus         2 ~~~~D~~cP~cy~~~~~l~~~~~~   25 (192)
T cd03022           2 DFYFDFSSPYSYLAHERLPALAAR   25 (192)
T ss_pred             eEEEeCCChHHHHHHHHHHHHHHH
Confidence            355699999999844445544443


No 13 
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=35.74  E-value=15  Score=36.22  Aligned_cols=21  Identities=24%  Similarity=0.629  Sum_probs=15.0

Q ss_pred             eeeccccCCCchhhhhccccc
Q 044315          333 RTEVTEDFSCPFCLAKCASFK  353 (437)
Q Consensus       333 kTEvtedFsCPfCl~~C~sfk  353 (437)
                      +-+|..|+.||||++-=..|+
T Consensus         7 ~I~v~sD~vCPwC~ig~~rL~   27 (225)
T COG2761           7 EIDVFSDVVCPWCYIGKRRLE   27 (225)
T ss_pred             EEEEEeCCcCchhhcCHHHHH
Confidence            346889999999998333333


No 14 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=27.48  E-value=24  Score=23.04  Aligned_cols=22  Identities=32%  Similarity=0.502  Sum_probs=20.2

Q ss_pred             CCCchhhhhcccccchhhhhcc
Q 044315          340 FSCPFCLAKCASFKGLRYHLSS  361 (437)
Q Consensus       340 FsCPfCl~~C~sfkGL~~HL~s  361 (437)
                      |.|+.|-....+-..|+.|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999986


No 15 
>PF09231 RDV-p3:  Rice dwarf virus p3;  InterPro: IPR015312 Members of this family are core structural proteins found in the double-stranded RNA virus Phytoreovirus. They are large proteins without apparent domain division, with a number of all-alpha regions and one all beta domain near the C-terminal end []. ; GO: 0005198 structural molecule activity; PDB: 1UF2_A.
Probab=26.81  E-value=30  Score=39.42  Aligned_cols=36  Identities=42%  Similarity=0.776  Sum_probs=23.6

Q ss_pred             cCCCHHH----Hhhhhcccc-cccchhhHHHHHHHhhhcCChhhh
Q 044315           44 VHLSAEE----EIAAEESLS-IYCKPVELYNILQRRAIRNPSFLQ   83 (437)
Q Consensus        44 ~~Ls~eE----~lAAeeSLs-lYCKPVELYNiiqrRa~~nP~FLQ   83 (437)
                      +.+.+.|    ++ |-+=|. -||.|.-.||-||+||   |.||-
T Consensus       173 VPfh~iELaLy~l-A~~lL~~QYCHPtvvy~yL~~RA---PpFL~  213 (965)
T PF09231_consen  173 VPFHPIELALYNL-ANQLLDIQYCHPTVVYKYLQDRA---PPFLR  213 (965)
T ss_dssp             ESS-HHHHCHHHH-HHHHHHHHEE-HHHHHHHHHHC-----TTEE
T ss_pred             ccccHHHHHHHHH-HHHHHhhhccchHHHHHHHHhcC---CCeEE
Confidence            6667766    23 334443 4999999999999999   99984


No 16 
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins. Members of this family contain a redox active CXXC motif (except GSTK and HCCA isomerase) imbedded in a TRX fold, and an alpha helical insert of about 75 residues (shorter in DsbC and DsbG) relative to TRX. DsbA is involved in the oxidative protein folding pathway in prokaryotes, catalyzing disulfide bond formation of proteins secreted into the bacterial periplasm. DsbC and DsbG function as protein disulfide isomerases and chaperones to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins.
Probab=25.28  E-value=29  Score=25.93  Aligned_cols=18  Identities=22%  Similarity=0.436  Sum_probs=12.1

Q ss_pred             cccCCCchhhhhcccccc
Q 044315          337 TEDFSCPFCLAKCASFKG  354 (437)
Q Consensus       337 tedFsCPfCl~~C~sfkG  354 (437)
                      --|+.||||...=-.++.
T Consensus         4 f~d~~Cp~C~~~~~~l~~   21 (98)
T cd02972           4 FFDPLCPYCYLFEPELEK   21 (98)
T ss_pred             EECCCCHhHHhhhHHHHH
Confidence            358999999974433433


No 17 
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.
Probab=25.25  E-value=35  Score=29.44  Aligned_cols=32  Identities=19%  Similarity=0.285  Sum_probs=18.2

Q ss_pred             ccCCCchhhhhcccccchhhhhcccccccceeeee
Q 044315          338 EDFSCPFCLAKCASFKGLRYHLSSSHDLFNFEFWV  372 (437)
Q Consensus       338 edFsCPfCl~~C~sfkGL~~HL~ssHDlF~FeF~~  372 (437)
                      .||.||||...=.....|..-+   =+...|++++
T Consensus        23 ~D~~Cp~C~~~~~~~~~~~~~~---~~~v~~~~~~   54 (178)
T cd03019          23 FSYGCPHCYNFEPILEAWVKKL---PKDVKFEKVP   54 (178)
T ss_pred             ECCCCcchhhhhHHHHHHHHhC---CCCceEEEcC
Confidence            4899999986544444443332   2344555444


No 18 
>smart00355 ZnF_C2H2 zinc finger.
Probab=24.44  E-value=29  Score=20.65  Aligned_cols=24  Identities=29%  Similarity=0.611  Sum_probs=19.9

Q ss_pred             CCCchhhhhcccccchhhhhccccc
Q 044315          340 FSCPFCLAKCASFKGLRYHLSSSHD  364 (437)
Q Consensus       340 FsCPfCl~~C~sfkGL~~HL~ssHD  364 (437)
                      +.|+.|-....+-..|..|+. .|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~-~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR-THX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH-Hhc
Confidence            469999988888899999987 554


No 19 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=22.54  E-value=29  Score=27.16  Aligned_cols=24  Identities=29%  Similarity=0.616  Sum_probs=0.0

Q ss_pred             Cchhhhhcccccchhhhhcccccc
Q 044315          342 CPFCLAKCASFKGLRYHLSSSHDL  365 (437)
Q Consensus       342 CPfCl~~C~sfkGL~~HL~ssHDl  365 (437)
                      |++|-....+...|..||...|..
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~   25 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGF   25 (100)
T ss_dssp             ------------------------
T ss_pred             cccccccccccccccccccccccc
Confidence            999999999999999999998863


No 20 
>PF13871 Helicase_C_4:  Helicase_C-like
Probab=22.23  E-value=56  Score=33.10  Aligned_cols=32  Identities=25%  Similarity=0.487  Sum_probs=27.6

Q ss_pred             ccceeeeeEEeeccccccccc--------cCCcceEEEee
Q 044315           94 HNRRIQMTISLSETVNEGLQA--------RFPFPLYILLG  125 (437)
Q Consensus        94 ~krRIqmTISLsg~~n~~~q~--------qniFPLyvlLA  125 (437)
                      +++|++|+..++++.+.-+|.        |--=|+|++|.
T Consensus        86 qr~Rv~i~le~pwsad~aiQ~~GR~hRsnQ~~~P~y~~l~  125 (278)
T PF13871_consen   86 QRRRVHITLELPWSADKAIQQFGRTHRSNQVSAPEYRFLV  125 (278)
T ss_pred             CCceEEEEeeCCCCHHHHHHHhccccccccccCCEEEEee
Confidence            689999999999999988886        55678999876


No 21 
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti. It contains a CXXC motif, assumed to be imbedded in a DsbA-like structure. Its homology to DsbA suggests that the protein is a protein disulfide oxidoreductase. The role of such a protein in pathogenesis is unknown.
Probab=21.54  E-value=37  Score=28.09  Aligned_cols=11  Identities=27%  Similarity=0.869  Sum_probs=9.2

Q ss_pred             ccCCCchhhhh
Q 044315          338 EDFSCPFCLAK  348 (437)
Q Consensus       338 edFsCPfCl~~  348 (437)
                      .|+.||||...
T Consensus        13 ~D~~Cp~C~~~   23 (154)
T cd03023          13 FDYNCGYCKKL   23 (154)
T ss_pred             ECCCChhHHHh
Confidence            59999999864


Done!