BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044404
(76 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2NUD|C Chain C, The Structure Of The Type Iii Effector Avrb Complexed
With A High-Affinity Rin4 Peptide
pdb|2NUD|D Chain D, The Structure Of The Type Iii Effector Avrb Complexed
With A High-Affinity Rin4 Peptide
Length = 35
Score = 42.4 bits (98), Expect = 7e-05, Method: Compositional matrix adjust.
Identities = 15/31 (48%), Positives = 25/31 (80%)
Query: 8 STLPKFGEWDVNDPATADGFSFVFIKASEEK 38
+ +PKFG+WD N+P++ADG++ +F K EE+
Sbjct: 5 TVVPKFGDWDENNPSSADGYTHIFNKVREER 35
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.127 0.400
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,527,918
Number of Sequences: 62578
Number of extensions: 74913
Number of successful extensions: 146
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 144
Number of HSP's gapped (non-prelim): 4
length of query: 76
length of database: 14,973,337
effective HSP length: 45
effective length of query: 31
effective length of database: 12,157,327
effective search space: 376877137
effective search space used: 376877137
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)