BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044432
         (584 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HO6|A Chain A, Structure-Function Analysis Of Inositol Hexakisphosphate-
           Induced Autoprocessing In Clostridium Difficile Toxin A
 pdb|3HO6|B Chain B, Structure-Function Analysis Of Inositol Hexakisphosphate-
           Induced Autoprocessing In Clostridium Difficile Toxin A
          Length = 267

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 16/74 (21%)

Query: 302 NLKWYDFCFREVFPGRVVKS-MDDLGTVLPSVQRQETVLVVSLFGASDAVTRNLLCQFE- 359
           N+  YDF   E +PG+++ S MD + + LP V +    +     GA+         Q+E 
Sbjct: 159 NMFSYDFNVEETYPGKLLLSIMDKITSTLPDVNKNSITI-----GAN---------QYEV 204

Query: 360 RINSQNHIFLGSHS 373
           RINS+    L +HS
Sbjct: 205 RINSEGRKELLAHS 218


>pdb|2JAE|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In The Unbound State
 pdb|2JAE|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In The Unbound State
 pdb|2JB1|A Chain A, The L-Amino Acid Oxidase From Rhodococcus Opacus In
           Complex With L-Alanine
 pdb|2JB1|B Chain B, The L-Amino Acid Oxidase From Rhodococcus Opacus In
           Complex With L-Alanine
 pdb|2JB3|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With O-Aminobenzoate
 pdb|2JB3|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With O-Aminobenzoate
 pdb|2JB2|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With L-Phenylalanine.
 pdb|2JB2|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With L-Phenylalanine
          Length = 489

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 9/101 (8%)

Query: 135 TANAGLQAQWLEAWWPTSDHEFAFVVEDDLEVSPLFYKF-----LRGLIVNYYYHAPSNL 189
           +++  L  ++   WW T D  +      D ++S + + +      RG++V YY    S  
Sbjct: 318 SSSGKLGIEYSRRWWETEDRIYGGASNTDKDISQIMFPYDHYNSDRGVVVAYY---SSGK 374

Query: 190 TRSIYGASLQRPRFVPG-KHGNKIHLDNGTQLFLYQLVGTW 229
            +  + +   R R       G++IH +  T+       G+W
Sbjct: 375 RQEAFESLTHRQRLAKAIAEGSEIHGEKYTRDISSSFSGSW 415


>pdb|3HDQ|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDY|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HE3|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3MJ4|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
          Length = 397

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 437 ANFLPFSNDLFLEPIDATSDFYYGE 461
           A+F+PF + ++  P+DA  DF YG+
Sbjct: 247 ADFIPFQHMIYTGPVDAFFDFCYGK 271


>pdb|4B9Y|A Chain A, Crystal Structure Of Apo Agd31b, Alpha-transglucosylase In
           Glycoside Hydrolase Family 31
 pdb|4B9Z|A Chain A, Crystal Structure Of Agd31b, Alpha-transglucosylase,
           Complexed With Acarbose
 pdb|4BA0|A Chain A, Crystal Structure Of Agd31b, Alpha-transglucosylase,
           Complexed With 5f-alpha-glcf
          Length = 817

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 17/33 (51%)

Query: 81  SAADYLTDRVHLHVYVDHSAPLADQSSSESDSR 113
           +  DY +D + +H Y D S PLA     E D +
Sbjct: 680 TTEDYRSDSLEIHYYADASVPLAQGEIFEDDGK 712


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,268,835
Number of Sequences: 62578
Number of extensions: 710783
Number of successful extensions: 1357
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1355
Number of HSP's gapped (non-prelim): 4
length of query: 584
length of database: 14,973,337
effective HSP length: 104
effective length of query: 480
effective length of database: 8,465,225
effective search space: 4063308000
effective search space used: 4063308000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)