BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044432
(584 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3HO6|A Chain A, Structure-Function Analysis Of Inositol Hexakisphosphate-
Induced Autoprocessing In Clostridium Difficile Toxin A
pdb|3HO6|B Chain B, Structure-Function Analysis Of Inositol Hexakisphosphate-
Induced Autoprocessing In Clostridium Difficile Toxin A
Length = 267
Score = 33.1 bits (74), Expect = 0.39, Method: Compositional matrix adjust.
Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 16/74 (21%)
Query: 302 NLKWYDFCFREVFPGRVVKS-MDDLGTVLPSVQRQETVLVVSLFGASDAVTRNLLCQFE- 359
N+ YDF E +PG+++ S MD + + LP V + + GA+ Q+E
Sbjct: 159 NMFSYDFNVEETYPGKLLLSIMDKITSTLPDVNKNSITI-----GAN---------QYEV 204
Query: 360 RINSQNHIFLGSHS 373
RINS+ L +HS
Sbjct: 205 RINSEGRKELLAHS 218
>pdb|2JAE|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
Opacus In The Unbound State
pdb|2JAE|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
Opacus In The Unbound State
pdb|2JB1|A Chain A, The L-Amino Acid Oxidase From Rhodococcus Opacus In
Complex With L-Alanine
pdb|2JB1|B Chain B, The L-Amino Acid Oxidase From Rhodococcus Opacus In
Complex With L-Alanine
pdb|2JB3|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
Opacus In Complex With O-Aminobenzoate
pdb|2JB3|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
Opacus In Complex With O-Aminobenzoate
pdb|2JB2|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
Opacus In Complex With L-Phenylalanine.
pdb|2JB2|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
Opacus In Complex With L-Phenylalanine
Length = 489
Score = 30.4 bits (67), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 9/101 (8%)
Query: 135 TANAGLQAQWLEAWWPTSDHEFAFVVEDDLEVSPLFYKF-----LRGLIVNYYYHAPSNL 189
+++ L ++ WW T D + D ++S + + + RG++V YY S
Sbjct: 318 SSSGKLGIEYSRRWWETEDRIYGGASNTDKDISQIMFPYDHYNSDRGVVVAYY---SSGK 374
Query: 190 TRSIYGASLQRPRFVPG-KHGNKIHLDNGTQLFLYQLVGTW 229
+ + + R R G++IH + T+ G+W
Sbjct: 375 RQEAFESLTHRQRLAKAIAEGSEIHGEKYTRDISSSFSGSW 415
>pdb|3HDQ|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDY|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HE3|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3MJ4|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
Length = 397
Score = 29.3 bits (64), Expect = 6.1, Method: Compositional matrix adjust.
Identities = 11/25 (44%), Positives = 18/25 (72%)
Query: 437 ANFLPFSNDLFLEPIDATSDFYYGE 461
A+F+PF + ++ P+DA DF YG+
Sbjct: 247 ADFIPFQHMIYTGPVDAFFDFCYGK 271
>pdb|4B9Y|A Chain A, Crystal Structure Of Apo Agd31b, Alpha-transglucosylase In
Glycoside Hydrolase Family 31
pdb|4B9Z|A Chain A, Crystal Structure Of Agd31b, Alpha-transglucosylase,
Complexed With Acarbose
pdb|4BA0|A Chain A, Crystal Structure Of Agd31b, Alpha-transglucosylase,
Complexed With 5f-alpha-glcf
Length = 817
Score = 28.9 bits (63), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 17/33 (51%)
Query: 81 SAADYLTDRVHLHVYVDHSAPLADQSSSESDSR 113
+ DY +D + +H Y D S PLA E D +
Sbjct: 680 TTEDYRSDSLEIHYYADASVPLAQGEIFEDDGK 712
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,268,835
Number of Sequences: 62578
Number of extensions: 710783
Number of successful extensions: 1357
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1355
Number of HSP's gapped (non-prelim): 4
length of query: 584
length of database: 14,973,337
effective HSP length: 104
effective length of query: 480
effective length of database: 8,465,225
effective search space: 4063308000
effective search space used: 4063308000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)