Citrus Sinensis ID: 044458

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGTETRMTPTQISDEEANLFAMQLTSASVLPMVLKSAIELDLLEVIAKAGPGAFMSPKQIASQLPTKNSDAHILLDRILRLLASYSVLNCSLHTLPDGGVERLYGLAPVCKFLTKNEDGVSLSDICLLCQDKIVMESWYHLKDAVLEGGIPFNMAYGMNAFDYHGKDLRLNKIFNNGMFSHSTITMKKFLENYKGFEGLQSVVDVGGGIGASLDMIISKYPSIKGINFDLPHVIQDAPAYP
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccHHHHHHcccccccccccHHHHHHHHHHHcccccccccccccccccccEEcccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccEEEccccHHHccccccc
******************LFAMQLTSASVLPMVLKSAIELDLLEVIAKAGPGAFMSPKQIASQLPTKNSDAHILLDRILRLLASYSVLNCSLHTLPDGGVERLYGLAPVCKFLTKNEDGVSLSDICLLCQDKIVMESWYHLKDAVLEGGIPFNMAYGMNAFDYHGKDLRLNKIFNNGMFSHSTITMKKFLENYKGFEGLQSVVDVGGGIGASLDMIISKYPSIKGINFDLPHVIQD**AY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTETRMTPTQISDEEANLFAMQLTSASVLPMVLKSAIELDLLEVIAKAGPGAFMSPKQIASQLPTKNSDAHILLDRILRLLASYSVLNCSLHTLPDGGVERLYGLAPVCKFLTKNEDGVSLSDICLLCQDKIVMESWYHLKDAVLEGGIPFNMAYGMNAFDYHGKDLRLNKIFNNGMFSHSTITMKKFLENYKGFEGLQSVVDVGGGIGASLDMIISKYPSIKGINFDLPHVIQDAPAYP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavone 3'-O-methyltransferase 1 Methylates OH residues of flavonoid compounds. Substrate preference is quercetin > myricetin >> luteolin. Dihydroquercetin is not a substrate.probableQ9FK25
Caffeic acid 3-O-methyltransferase Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.probableO81646
Caffeic acid 3-O-methyltransferase Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.probableQ6T1F5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3REO, chain A
Confidence level:very confident
Coverage over the Query: 13-240
View the alignment between query and template
View the model in PyMOL