BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044495
(276 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2PJX|A Chain A, Crystal Structure Of The Munc18cSYNTAXIN4 N-Peptide
Complex
pdb|2PJX|B Chain B, Crystal Structure Of The Munc18cSYNTAXIN4 N-Peptide
Complex
pdb|3PUK|A Chain A, Re-Refinement Of The Crystal Structure Of Munc18-3 And
Syntaxin4 N- Peptide Complex
pdb|3PUK|B Chain B, Re-Refinement Of The Crystal Structure Of Munc18-3 And
Syntaxin4 N- Peptide Complex
Length = 592
Score = 28.1 bits (61), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 13/38 (34%), Positives = 19/38 (50%)
Query: 80 YLKANLDNLTRAIITEFGYQEVGHLRCGHALLQCHKVC 117
YL+ + N +R II G +RC + + Q HK C
Sbjct: 521 YLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSC 558
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.139 0.443
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,673,018
Number of Sequences: 62578
Number of extensions: 279149
Number of successful extensions: 478
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 477
Number of HSP's gapped (non-prelim): 1
length of query: 276
length of database: 14,973,337
effective HSP length: 97
effective length of query: 179
effective length of database: 8,903,271
effective search space: 1593685509
effective search space used: 1593685509
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 51 (24.3 bits)