Citrus Sinensis ID: 044496

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--

MDYSLAALKLLCVQLKDARESPSQNAVTLGGILFQRVWLQGVLVSPPDDDGRLLLDDGTGVVQIYLSGDFRIRRWNTGVFFFDFWMYVMVVGGFVIRTDDIPVIKVHKIVDLSAFPDREAMWYLEVMEAYKLFYQPLIEDFV

ccccHHHHHHHHHHHHHccccccccccccccEEEEEEEEEEEEEECcccccEEEECcccEEEEEEEccccccCCcccccccccccEEEEEEEEEEECcccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHcHHHcc

***SLAALKLLCVQLKD*******NAVTLGGILFQRVWLQGVLVSPPDDDGRLLLDDGTGVVQIYLSGDFRIRRWNTGVFFFDFWMYVMVVGGFVIRTDDIPVIKVHKIVDLSAFPDREAMWYLEVMEAYKLFYQPLIEDF*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDYSLAALKLLCVQLKDARESPSQNAVTLGGILFQRVWLQGVLVSPPDDDGRLLLDDGTGVVQIYLSGDFRIRRWNTGVFFFDFWMYVMVVGGFVIRTDDIPVIKVHKIVDLSAFPDREAMWYLEVMEAYKLFYQPLIEDFV

Annotation	Function Description	Confidence Level	Reference Protein
RecQ-mediated genome instability protein 2	Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. The complex is therefore essential for the stability, localization, and function of complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.	probable	Q5ZM20

No EC number assigned to the protein, probably not an enzyme!

Template: 3MXN, chain B
Confidence level:very confident
Coverage over the Query: 3-133
View the alignment between query and template
View the model in PyMOL