BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044503
(113 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VJY|B Chain B, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VJY|C Chain C, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VJY|D Chain D, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VK4|A Chain A, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
pdb|2VK4|B Chain B, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
pdb|2VK4|C Chain C, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
pdb|2VK4|D Chain D, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
Length = 563
Score = 26.9 bits (58), Expect = 2.8, Method: Composition-based stats.
Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 5/35 (14%)
Query: 32 SGNWGRLTNIGRIEDDT-----EVLMPTEDSRRHL 61
+G W +LT + +D+T EV++PT D+ +L
Sbjct: 515 TGEWNKLTTDEKFQDNTRIRLIEVMLPTMDAPSNL 549
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.133 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,116,162
Number of Sequences: 62578
Number of extensions: 110992
Number of successful extensions: 213
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 210
Number of HSP's gapped (non-prelim): 10
length of query: 113
length of database: 14,973,337
effective HSP length: 77
effective length of query: 36
effective length of database: 10,154,831
effective search space: 365573916
effective search space used: 365573916
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)