Query         044503
Match_columns 113
No_of_seqs    140 out of 214
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 03:51:20 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044503.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044503hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03222 rapid alkalinization  100.0 7.5E-37 1.6E-41  221.9   3.4   98   13-110    15-119 (119)
  2 PLN03221 rapid alkalinization  100.0 3.2E-35   7E-40  217.4   5.6   75   36-110    45-137 (137)
  3 PF05498 RALF:  Rapid ALkaliniz 100.0 3.4E-29 7.3E-34  165.9   2.8   65   46-110     2-66  (66)
  4 PF07172 GRP:  Glycine rich pro  91.7    0.23 5.1E-06   34.8   3.4   20    1-21      1-20  (95)
  5 PF07172 GRP:  Glycine rich pro  65.8     6.2 0.00013   27.6   2.5   18   13-30      9-26  (95)
  6 PF09680 Tiny_TM_bacill:  Prote  63.5     6.9 0.00015   21.6   1.9   16    4-19      4-19  (24)
  7 PF15240 Pro-rich:  Proline-ric  61.4     5.9 0.00013   31.1   1.9   22   13-34      3-24  (179)
  8 TIGR01732 tiny_TM_bacill conse  61.1     7.7 0.00017   21.8   1.8   18    4-21      6-23  (26)
  9 PF06387 Calcyon:  D1 dopamine   37.5      50  0.0011   26.2   3.6   52    6-63     87-147 (186)
 10 PF13179 DUF4006:  Family of un  36.3      58  0.0012   21.9   3.3   24    2-25     12-35  (66)
 11 PF06900 DUF1270:  Protein of u  35.3      59  0.0013   21.0   3.1   19    4-22      6-24  (53)
 12 PF05782 ECM1:  Extracellular m  34.0      40 0.00086   30.6   2.9   21    1-25      1-21  (544)
 13 PRK11874 petL cytochrome b6-f   32.4      75  0.0016   18.3   2.9   20    1-20      1-20  (30)
 14 PRK06287 cobalt transport prot  29.6      60  0.0013   23.1   2.7   19   18-36     16-36  (107)
 15 PF10717 ODV-E18:  Occlusion-de  28.3      67  0.0015   22.6   2.7   22    8-29     31-52  (85)
 16 PRK10894 lipopolysaccharide tr  25.3      91   0.002   23.4   3.2   14    9-22      6-19  (180)
 17 PRK01470 tatA twin arginine tr  23.2      90   0.002   19.7   2.4   16    1-16      1-16  (51)
 18 PRK00442 tatA twin arginine tr  22.7      78  0.0017   22.4   2.2   12    1-12      1-13  (92)
 19 PF04360 Serglycin:  Serglycin   21.8      89  0.0019   24.1   2.5   32   31-62     31-67  (150)
 20 PF12911 OppC_N:  N-terminal TM  21.5 1.4E+02   0.003   17.8   2.9   17    8-24     19-35  (56)
 21 PRK00191 tatA twin arginine tr  20.4 1.1E+02  0.0023   21.4   2.5   16    1-16      1-16  (84)

No 1  
>PLN03222 rapid alkalinization factor 23-like protein; Provisional
Probab=100.00  E-value=7.5e-37  Score=221.94  Aligned_cols=98  Identities=42%  Similarity=0.749  Sum_probs=81.6

Q ss_pred             HHHHHHHHHHHhhhcccc-CCCC-C-CCccc-e-eccc--CcccccCCCccccccccCCCccccccccCCCCCCCCCCCC
Q 044503           13 FLALGIVMAMMASETNAF-DSGN-W-GRLTN-I-GRIE--DDTEVLMPTEDSRRHLNAAGFISYRALQGNSVPCNRRGAS   85 (113)
Q Consensus        13 ~~~~~~~la~~~~~~~~~-~~~~-~-~~C~g-v-ec~~--~eeE~~m~se~~RR~L~~~~yIsY~aL~~~~vpC~~~g~s   85 (113)
                      +|.+.+++|.+.+...+. +++- . ..|+| + ||+.  +|+|++||||++||+|++++||||+||++|++||+++|+|
T Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~Gsi~EC~~~~~e~e~~mdSe~sRR~L~~~rYISYgALrrd~vPCsrrG~S   94 (119)
T PLN03222         15 ILTVHFLFAAVTSQSTGFSGDFMPIDSKCNGTIAECSLSTAEEEFEMDSEINRRILATTKYISYGALRRNTVPCSRRGAS   94 (119)
T ss_pred             hhHHHHHHHHhhcccccccccccCCCCcCCCCHHHhhcccccchhccccHHHHHHHhhcCeecHHHhcCCCCCCCCCCCC
Confidence            344555666676665443 2221 1 46999 8 9985  4778999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCCCCCCcccccccC
Q 044503           86 YYNCNGGGPTNPYRRGCTAITNCQR  110 (113)
Q Consensus        86 Y~nC~~~~~aNPYtRGCs~itrCrr  110 (113)
                      ||||++++|+|||+|||++||||||
T Consensus        95 YynC~~~~~ANPY~RGCs~ITrCrR  119 (119)
T PLN03222         95 YYNCRRGAQANPYSRGCSAITRCRR  119 (119)
T ss_pred             ccccCCCCCCCCCCCCchhhccccC
Confidence            9999998999999999999999997


No 2  
>PLN03221 rapid alkalinization factor 23; Provisional
Probab=100.00  E-value=3.2e-35  Score=217.41  Aligned_cols=75  Identities=48%  Similarity=0.866  Sum_probs=68.8

Q ss_pred             CCccc-e-ecc-------------cCcc---cccCCCccccccccCCCccccccccCCCCCCCCCCCCccCCCCCCCCCC
Q 044503           36 GRLTN-I-GRI-------------EDDT---EVLMPTEDSRRHLNAAGFISYRALQGNSVPCNRRGASYYNCNGGGPTNP   97 (113)
Q Consensus        36 ~~C~g-v-ec~-------------~~ee---E~~m~se~~RR~L~~~~yIsY~aL~~~~vpC~~~g~sY~nC~~~~~aNP   97 (113)
                      ..|.| + ||+             +++|   |++||||++||+|++++||||+||++|++||+++|+|||||++++|+||
T Consensus        45 ~~C~GsiaEC~~~~~~~~d~e~~~g~~~~~~e~~MdSE~sRR~L~~~rYISYgALrrd~vPCsrrG~SYynC~~~~pANP  124 (137)
T PLN03221         45 TECRGTIAECSVSAALGDDGDLFYGGGEMGAEFEMDSEINRRILATRRYISYGALRRNTIPCSRRGASYYNCRRGAQANP  124 (137)
T ss_pred             CcccCCHHHHhhhhccccccccccccchhhhhhhcccHHHHHHHhcCCccCHHHhccCCCCCCCCCCCccccCCCCCCCC
Confidence            45999 8 996             2222   7899999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcccccccC
Q 044503           98 YRRGCTAITNCQR  110 (113)
Q Consensus        98 YtRGCs~itrCrr  110 (113)
                      |+|||++||||||
T Consensus       125 Y~RGCs~ITRCrR  137 (137)
T PLN03221        125 YSRGCSAITRCRR  137 (137)
T ss_pred             CCCCcccccccCC
Confidence            9999999999997


No 3  
>PF05498 RALF:  Rapid ALkalinization Factor (RALF) ;  InterPro: IPR008801 RALF, a 5 kDa ubiquitous polypeptide in plants, arrests root growth and development.
Probab=99.95  E-value=3.4e-29  Score=165.90  Aligned_cols=65  Identities=54%  Similarity=1.031  Sum_probs=62.0

Q ss_pred             CcccccCCCccccccccCCCccccccccCCCCCCCCCCCCccCCCCCCCCCCCCCCCcccccccC
Q 044503           46 DDTEVLMPTEDSRRHLNAAGFISYRALQGNSVPCNRRGASYYNCNGGGPTNPYRRGCTAITNCQR  110 (113)
Q Consensus        46 ~eeE~~m~se~~RR~L~~~~yIsY~aL~~~~vpC~~~g~sY~nC~~~~~aNPYtRGCs~itrCrr  110 (113)
                      +|+|+.|+||++||+|++++||||+||++|++||.++|.+|++|.+++|+|||+|||++||||||
T Consensus         2 ee~~~~~~s~~~~R~~a~~~yIsYgaL~~~~~pc~~~g~~~~~c~~~~paNpY~RGC~~~~rCrr   66 (66)
T PF05498_consen    2 EEEEVVMESEASRRILAARRYISYGALRRDRVPCSPRGCSYYNCCPRQPANPYSRGCSKITRCRR   66 (66)
T ss_pred             hhHHhhhhhHHHHHHHhcCCeecchhccCCCCCCCcccCCCcccCCCCCCCCCCCCCCccccCCC
Confidence            46789999999999999989999999999999999999999999888999999999999999997


No 4  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=91.72  E-value=0.23  Score=34.83  Aligned_cols=20  Identities=25%  Similarity=0.416  Sum_probs=10.4

Q ss_pred             CchhHHHHHHHHHHHHHHHHH
Q 044503            1 MGTAKQLLISMVFLALGIVMA   21 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~la   21 (113)
                      |. +|.++++.+|||++|+|+
T Consensus         1 Ma-SK~~llL~l~LA~lLlis   20 (95)
T PF07172_consen    1 MA-SKAFLLLGLLLAALLLIS   20 (95)
T ss_pred             Cc-hhHHHHHHHHHHHHHHHH
Confidence            77 555555544555544443


No 5  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=65.79  E-value=6.2  Score=27.64  Aligned_cols=18  Identities=22%  Similarity=0.150  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHhhhcccc
Q 044503           13 FLALGIVMAMMASETNAF   30 (113)
Q Consensus        13 ~~~~~~~la~~~~~~~~~   30 (113)
                      |.+++++|.+++|++++.
T Consensus         9 L~l~LA~lLlisSevaa~   26 (95)
T PF07172_consen    9 LGLLLAALLLISSEVAAR   26 (95)
T ss_pred             HHHHHHHHHHHHhhhhhH
Confidence            333444555666666653


No 6  
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=63.48  E-value=6.9  Score=21.62  Aligned_cols=16  Identities=38%  Similarity=0.461  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHHHHHH
Q 044503            4 AKQLLISMVFLALGIV   19 (113)
Q Consensus         4 ~~~~~~~~~~~~~~~~   19 (113)
                      ..|.+++.+|++|+++
T Consensus         4 ~~FalivVLFILLiIv   19 (24)
T PF09680_consen    4 SGFALIVVLFILLIIV   19 (24)
T ss_pred             ccchhHHHHHHHHHHh
Confidence            4678888877776543


No 7  
>PF15240 Pro-rich:  Proline-rich
Probab=61.41  E-value=5.9  Score=31.09  Aligned_cols=22  Identities=9%  Similarity=0.229  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHhhhccccCCCC
Q 044503           13 FLALGIVMAMMASETNAFDSGN   34 (113)
Q Consensus        13 ~~~~~~~la~~~~~~~~~~~~~   34 (113)
                      +|+|.+||-+++||-+...+++
T Consensus         3 lVLLSvALLALSSAQ~~dEdv~   24 (179)
T PF15240_consen    3 LVLLSVALLALSSAQSTDEDVS   24 (179)
T ss_pred             hHHHHHHHHHhhhccccccccc
Confidence            3344444444566665554554


No 8  
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=61.07  E-value=7.7  Score=21.82  Aligned_cols=18  Identities=39%  Similarity=0.401  Sum_probs=12.6

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 044503            4 AKQLLISMVFLALGIVMA   21 (113)
Q Consensus         4 ~~~~~~~~~~~~~~~~la   21 (113)
                      ..|.+++.+|++|+++.+
T Consensus         6 ~gf~livVLFILLIIiga   23 (26)
T TIGR01732         6 GGFALIVVLFILLVIVGA   23 (26)
T ss_pred             cchHHHHHHHHHHHHhhe
Confidence            457788888887766544


No 9  
>PF06387 Calcyon:  D1 dopamine receptor-interacting protein (calcyon);  InterPro: IPR009431 This family consists of several D1 dopamine receptor-interacting (calcyon) proteins. D1/D5 dopamine receptors in the basal ganglia, hippocampus, and cerebral cortex modulate motor, reward, and cognitive behaviour. D1-like dopamine receptors likely modulate neocortical and hippocampal neuronal excitability and synaptic function via Ca2+ as well as cAMP-dependent signalling []. Defective calcyon proteins have been implicated in both attention-deficit/hyperactivity disorder (ADHD) [] and schizophrenia.; GO: 0050780 dopamine receptor binding, 0007212 dopamine receptor signaling pathway, 0016021 integral to membrane
Probab=37.46  E-value=50  Score=26.23  Aligned_cols=52  Identities=15%  Similarity=0.118  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhccccCCCCCCCc-cc-e----ecccCccc---ccCCCccccccccC
Q 044503            6 QLLISMVFLALGIVMAMMASETNAFDSGNWGRL-TN-I----GRIEDDTE---VLMPTEDSRRHLNA   63 (113)
Q Consensus         6 ~~~~~~~~~~~~~~la~~~~~~~~~~~~~~~~C-~g-v----ec~~~eeE---~~m~se~~RR~L~~   63 (113)
                      ..++.++|++-++.|.|-    -+.+ .+ .+| +| +    -|....=|   -+||.+.+||+++.
T Consensus        87 lI~~alAfl~Cv~~Lv~Y----Ka~w-YD-qsCPdGFv~khk~C~P~~LemYY~eqdp~~~~~~~ta  147 (186)
T PF06387_consen   87 LIAFALAFLGCVVFLVMY----KAIW-YD-QSCPDGFVLKHKRCTPLTLEMYYTEQDPERRRSLYTA  147 (186)
T ss_pred             HHHHHHHHHHHHHHHHhh----eeee-ec-ccCCCcceeecccccchhhhheecccCCCcccchhhh
Confidence            344555566655555543    2220 11 477 56 3    48643223   36889999999975


No 10 
>PF13179 DUF4006:  Family of unknown function (DUF4006)
Probab=36.31  E-value=58  Score=21.86  Aligned_cols=24  Identities=17%  Similarity=0.286  Sum_probs=16.0

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHhh
Q 044503            2 GTAKQLLISMVFLALGIVMAMMAS   25 (113)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~la~~~~   25 (113)
                      |+.-++++++++|++++.|...+-
T Consensus        12 Gi~G~LIAvvLLLsIl~~lt~~ai   35 (66)
T PF13179_consen   12 GITGMLIAVVLLLSILAFLTYWAI   35 (66)
T ss_pred             chHhHHHHHHHHHHHHHHHHHHHH
Confidence            556677888877777666655443


No 11 
>PF06900 DUF1270:  Protein of unknown function (DUF1270);  InterPro: IPR009682 This entry is represented by Bacteriophage 92, Orf86. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Staphylococcus aureus and phage proteins of 53 residues in length. The function of this family is unknown.
Probab=35.30  E-value=59  Score=21.04  Aligned_cols=19  Identities=21%  Similarity=0.382  Sum_probs=15.2

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 044503            4 AKQLLISMVFLALGIVMAM   22 (113)
Q Consensus         4 ~~~~~~~~~~~~~~~~la~   22 (113)
                      -||+++.+.|.+|.++|..
T Consensus         6 kSylIA~l~ftvlsi~L~~   24 (53)
T PF06900_consen    6 KSYLIANLCFTVLSIALMP   24 (53)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4788999988888777764


No 12 
>PF05782 ECM1:  Extracellular matrix protein 1 (ECM1);  InterPro: IPR008605 This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness [].; GO: 0005576 extracellular region
Probab=34.03  E-value=40  Score=30.57  Aligned_cols=21  Identities=29%  Similarity=0.362  Sum_probs=13.4

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHhh
Q 044503            1 MGTAKQLLISMVFLALGIVMAMMAS   25 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~la~~~~   25 (113)
                      |||.+-+++++    ++|||+.+|+
T Consensus         1 MGt~srAALvL----acLAvaSaAS   21 (544)
T PF05782_consen    1 MGTMSRAALVL----ACLAVASAAS   21 (544)
T ss_pred             CchHHHHHHHH----HHHHHHHHhh
Confidence            89888776666    5555554444


No 13 
>PRK11874 petL cytochrome b6-f complex subunit PetL; Reviewed
Probab=32.38  E-value=75  Score=18.30  Aligned_cols=20  Identities=25%  Similarity=0.218  Sum_probs=14.2

Q ss_pred             CchhHHHHHHHHHHHHHHHH
Q 044503            1 MGTAKQLLISMVFLALGIVM   20 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~l   20 (113)
                      ||+..|...+.+|+.+.+.|
T Consensus         1 mgvv~y~~~l~~~~g~A~gl   20 (30)
T PRK11874          1 MGIVFFLGYLGVFTGIALGL   20 (30)
T ss_pred             CchHHHHHHHHHHHHHHHHH
Confidence            78888888877776654444


No 14 
>PRK06287 cobalt transport protein CbiN; Validated
Probab=29.61  E-value=60  Score=23.05  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=9.9

Q ss_pred             HHHHHHhh--hccccCCCCCC
Q 044503           18 IVMAMMAS--ETNAFDSGNWG   36 (113)
Q Consensus        18 ~~la~~~~--~~~~~~~~~~~   36 (113)
                      +++|.+.+  |++.-+.|+|.
T Consensus        16 ll~a~~~s~~AS~~PDGLEws   36 (107)
T PRK06287         16 LLIAILAPFLASGDPDGLESA   36 (107)
T ss_pred             HHHHHHHHhhhcCCCcHHHHH
Confidence            34444444  33444677883


No 15 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=28.32  E-value=67  Score=22.59  Aligned_cols=22  Identities=32%  Similarity=0.418  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhccc
Q 044503            8 LISMVFLALGIVMAMMASETNA   29 (113)
Q Consensus         8 ~~~~~~~~~~~~la~~~~~~~~   29 (113)
                      +++++.++|++.|..++|-.+.
T Consensus        31 LivLVIIiLlImlfqsSS~~~~   52 (85)
T PF10717_consen   31 LIVLVIIILLIMLFQSSSNGNS   52 (85)
T ss_pred             HHHHHHHHHHHHHHhccCCCCC
Confidence            3444444455555555554433


No 16 
>PRK10894 lipopolysaccharide transport periplasmic protein LptA; Provisional
Probab=25.34  E-value=91  Score=23.36  Aligned_cols=14  Identities=0%  Similarity=0.228  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHH
Q 044503            9 ISMVFLALGIVMAM   22 (113)
Q Consensus         9 ~~~~~~~~~~~la~   22 (113)
                      +.+++++++|+++.
T Consensus         6 ~~~~~~~~ll~~~~   19 (180)
T PRK10894          6 LNLLLASSLLAASI   19 (180)
T ss_pred             HHHHHHHHHHHHHH
Confidence            44445555555443


No 17 
>PRK01470 tatA twin arginine translocase protein A; Provisional
Probab=23.23  E-value=90  Score=19.68  Aligned_cols=16  Identities=19%  Similarity=0.434  Sum_probs=9.1

Q ss_pred             CchhHHHHHHHHHHHH
Q 044503            1 MGTAKQLLISMVFLAL   16 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (113)
                      ||..-..+++.++++|
T Consensus         1 mgig~~elliI~vi~l   16 (51)
T PRK01470          1 MGMSFSHLLIVLLIIF   16 (51)
T ss_pred             CCCCHHHHHHHHHHHH
Confidence            6666666666644444


No 18 
>PRK00442 tatA twin arginine translocase protein A; Provisional
Probab=22.73  E-value=78  Score=22.42  Aligned_cols=12  Identities=25%  Similarity=0.293  Sum_probs=5.6

Q ss_pred             CchhHH-HHHHHH
Q 044503            1 MGTAKQ-LLISMV   12 (113)
Q Consensus         1 ~~~~~~-~~~~~~   12 (113)
                      ||..+. ++++++
T Consensus         1 Mg~~g~~elliIl   13 (92)
T PRK00442          1 MGIFDWKHWIVIL   13 (92)
T ss_pred             CCCccHHHHHHHH
Confidence            554433 555543


No 19 
>PF04360 Serglycin:  Serglycin ;  InterPro: IPR007455 Serglycin is the most prevalent proteoglycan produced in haemopoietic cells. Serglycin is a proteinase resistant secretory granule proteoglycan [].
Probab=21.77  E-value=89  Score=24.06  Aligned_cols=32  Identities=22%  Similarity=0.236  Sum_probs=18.9

Q ss_pred             CCCCCCCcc--c-e-ecccC-cccccCCCcccccccc
Q 044503           31 DSGNWGRLT--N-I-GRIED-DTEVLMPTEDSRRHLN   62 (113)
Q Consensus        31 ~~~~~~~C~--g-v-ec~~~-eeE~~m~se~~RR~L~   62 (113)
                      .-..|-.|+  + - .|+++ .--|.+....+-||+.
T Consensus        31 ArYqWVrC~PDsnsANCieEKGP~FdL~pGesnrI~p   67 (150)
T PF04360_consen   31 ARYQWVRCNPDSNSANCIEEKGPLFDLLPGESNRILP   67 (150)
T ss_pred             cceeEEecCCCCCCCccccccCCceecCCCccccCCC
Confidence            335588896  3 3 89864 2236664445566663


No 20 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=21.50  E-value=1.4e+02  Score=17.76  Aligned_cols=17  Identities=24%  Similarity=0.606  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 044503            8 LISMVFLALGIVMAMMA   24 (113)
Q Consensus         8 ~~~~~~~~~~~~la~~~   24 (113)
                      ++.++++++++++|..+
T Consensus        19 ~~gl~il~~~vl~ai~~   35 (56)
T PF12911_consen   19 VIGLIILLILVLLAIFA   35 (56)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            33444444444444443


No 21 
>PRK00191 tatA twin arginine translocase protein A; Provisional
Probab=20.44  E-value=1.1e+02  Score=21.40  Aligned_cols=16  Identities=19%  Similarity=0.173  Sum_probs=8.9

Q ss_pred             CchhHHHHHHHHHHHH
Q 044503            1 MGTAKQLLISMVFLAL   16 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (113)
                      ||..-..++++++++|
T Consensus         1 m~ig~~ElliI~vI~l   16 (84)
T PRK00191          1 MSLGPWEIGIIVLLII   16 (84)
T ss_pred             CCCcHHHHHHHHHHHH
Confidence            6666666666644433


Done!