Query         044541
Match_columns 237
No_of_seqs    95 out of 97
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 04:16:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044541.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044541hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA00616 hypothetical protein   97.8 3.9E-06 8.4E-11   58.6  -0.1   29  209-237     1-29  (44)
  2 PF00096 zf-C2H2:  Zinc finger,  97.7 5.8E-06 1.2E-10   48.0  -0.5   23  210-232     1-23  (23)
  3 PHA02768 hypothetical protein;  97.7 1.2E-05 2.5E-10   58.5   0.7   25  209-233     5-29  (55)
  4 PF13912 zf-C2H2_6:  C2H2-type   97.6 1.2E-05 2.5E-10   48.3  -0.3   26  209-234     1-26  (27)
  5 PF13894 zf-C2H2_4:  C2H2-type   97.6 1.5E-05 3.3E-10   45.1   0.1   24  210-233     1-24  (24)
  6 KOG2462 C2H2-type Zn-finger pr  97.4 5.5E-05 1.2E-09   69.8   1.0   29  209-237   187-215 (279)
  7 smart00355 ZnF_C2H2 zinc finge  97.2 0.00014   3E-09   41.1   0.7   25  210-234     1-25  (26)
  8 KOG1074 Transcriptional repres  97.1 0.00022 4.8E-09   74.0   2.2   38  200-237   344-381 (958)
  9 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00022 4.7E-09   43.5   0.3   24  209-232     1-24  (27)
 10 KOG2462 C2H2-type Zn-finger pr  96.8 0.00052 1.1E-08   63.5   1.2   31  207-237   213-243 (279)
 11 PF12874 zf-met:  Zinc-finger o  96.7 0.00031 6.8E-09   41.4  -0.7   24  210-233     1-24  (25)
 12 PHA00732 hypothetical protein   96.4  0.0012 2.7E-08   50.2   1.0   26  209-234     1-27  (79)
 13 KOG3623 Homeobox transcription  96.3  0.0011 2.3E-08   68.7   0.3   31  207-237   279-309 (1007)
 14 smart00451 ZnF_U1 U1-like zinc  96.2  0.0017 3.7E-08   40.5   0.7   27  207-233     1-27  (35)
 15 KOG1074 Transcriptional repres  96.2  0.0015 3.3E-08   68.0   0.7   30  208-237   878-907 (958)
 16 PF09237 GAGA:  GAGA factor;  I  95.3  0.0064 1.4E-07   44.5   0.6   33  205-237    20-52  (54)
 17 PHA00733 hypothetical protein   94.8   0.012 2.7E-07   47.9   1.2   27  208-234    98-124 (128)
 18 PF13909 zf-H2C2_5:  C2H2-type   94.7   0.008 1.7E-07   35.3  -0.1   24  210-234     1-24  (24)
 19 PHA00733 hypothetical protein   94.4   0.018 3.8E-07   47.1   1.1   27  207-233    71-97  (128)
 20 PF12756 zf-C2H2_2:  C2H2 type   94.3   0.017 3.7E-07   41.7   0.7   27  208-234    49-75  (100)
 21 KOG3623 Homeobox transcription  94.2   0.015 3.2E-07   60.6   0.5   31  207-237   920-950 (1007)
 22 PF13913 zf-C2HC_2:  zinc-finge  94.1   0.017 3.7E-07   35.4   0.4   21  210-231     3-23  (25)
 23 KOG3576 Ovo and related transc  93.6   0.022 4.7E-07   52.2   0.3   30  208-237   144-173 (267)
 24 KOG3993 Transcription factor (  92.3   0.053 1.1E-06   53.6   0.9   26  209-234   295-320 (500)
 25 PF13465 zf-H2C2_2:  Zinc-finge  91.1   0.067 1.5E-06   32.6   0.1   14  208-221    13-26  (26)
 26 PF13465 zf-H2C2_2:  Zinc-finge  90.3    0.11 2.4E-06   31.7   0.6   14  224-237     1-14  (26)
 27 KOG3408 U1-like Zn-finger-cont  89.8   0.083 1.8E-06   44.5  -0.4   27  207-233    55-81  (129)
 28 KOG3576 Ovo and related transc  89.6    0.09 1.9E-06   48.2  -0.4   29  207-235   171-199 (267)
 29 KOG3993 Transcription factor (  87.1    0.14   3E-06   50.7  -0.9   30  206-235   353-382 (500)
 30 PF02892 zf-BED:  BED zinc fing  84.0    0.27 5.9E-06   32.4  -0.4   26  208-233    15-44  (45)
 31 PHA00732 hypothetical protein   83.8    0.46   1E-05   36.3   0.8   22  209-233    27-48  (79)
 32 PF05443 ROS_MUCR:  ROS/MUCR tr  83.5    0.41 8.8E-06   40.1   0.4   26  207-235    70-95  (132)
 33 PF05605 zf-Di19:  Drought indu  83.1    0.65 1.4E-05   32.3   1.2   24  209-234    31-54  (54)
 34 PRK04860 hypothetical protein;  81.9    0.67 1.5E-05   39.6   1.1   26  208-237   118-143 (160)
 35 PF05605 zf-Di19:  Drought indu  81.7    0.65 1.4E-05   32.3   0.8   26  209-235     2-27  (54)
 36 PF03066 Nucleoplasmin:  Nucleo  77.9     0.7 1.5E-05   38.9   0.0    9  134-142   139-147 (149)
 37 smart00614 ZnF_BED BED zinc fi  77.9    0.97 2.1E-05   31.0   0.7   24  209-232    18-46  (50)
 38 PF12013 DUF3505:  Protein of u  73.3     1.3 2.9E-05   34.3   0.4   27  208-234    79-109 (109)
 39 KOG4167 Predicted DNA-binding   71.7     1.5 3.3E-05   46.1   0.6   27  207-233   790-816 (907)
 40 PF14353 CpXC:  CpXC protein     69.6     1.9   4E-05   34.2   0.5   28  206-233    35-62  (128)
 41 COG5112 UFD2 U1-like Zn-finger  69.1    0.89 1.9E-05   38.0  -1.4   26  207-232    53-78  (126)
 42 PHA02768 hypothetical protein;  65.8     2.9 6.3E-05   30.6   0.8   20  208-227    30-49  (55)
 43 PTZ00448 hypothetical protein;  65.4     3.5 7.6E-05   40.1   1.6   27  206-232   311-337 (373)
 44 KOG3608 Zn finger proteins [Ge  65.0     2.5 5.3E-05   41.7   0.5   29  208-236   351-379 (467)
 45 KOG0717 Molecular chaperone (D  64.4     2.4 5.3E-05   42.5   0.3   26  208-233   290-316 (508)
 46 KOG0717 Molecular chaperone (D  64.4     6.7 0.00015   39.5   3.3   31  200-232   453-483 (508)
 47 COG4957 Predicted transcriptio  64.4     2.5 5.4E-05   36.5   0.3   25  208-235    75-99  (148)
 48 PF04959 ARS2:  Arsenite-resist  64.2     1.3 2.8E-05   39.7  -1.5   29  207-235    75-103 (214)
 49 PF04147 Nop14:  Nop14-like fam  63.8      13 0.00028   39.0   5.4   11  219-229   489-499 (840)
 50 COG5048 FOG: Zn-finger [Genera  62.0     4.4 9.5E-05   34.7   1.4   27  209-235   289-317 (467)
 51 PLN03086 PRLI-interacting fact  61.5     4.1   9E-05   41.4   1.3   25  208-233   452-476 (567)
 52 PLN03086 PRLI-interacting fact  60.5     3.9 8.5E-05   41.5   0.9   25  211-237   480-504 (567)
 53 COG3677 Transposase and inacti  60.4     3.8 8.2E-05   33.8   0.7   16  208-223    52-67  (129)
 54 KOG3608 Zn finger proteins [Ge  56.1     1.6 3.4E-05   43.0  -2.5   25  209-233   237-261 (467)
 55 COG4049 Uncharacterized protei  56.0     2.7 5.9E-05   31.8  -0.7   27  208-234    16-42  (65)
 56 KOG4124 Putative transcription  53.2     7.5 0.00016   38.3   1.5   50  179-229   178-232 (442)
 57 PF02724 CDC45:  CDC45-like pro  48.1      19 0.00042   36.5   3.5   16   27-42     96-111 (622)
 58 KOG2038 CAATT-binding transcri  46.7      28 0.00061   37.5   4.5    8  169-176   978-985 (988)
 59 COG5189 SFP1 Putative transcri  46.5     7.8 0.00017   37.9   0.5   23  208-230   397-419 (423)
 60 PF14812 PBP1_TM:  Transmembran  45.8     6.9 0.00015   30.8   0.0    8  135-142    50-57  (81)
 61 COG5048 FOG: Zn-finger [Genera  45.3      10 0.00022   32.5   1.0   29  208-236   320-350 (467)
 62 PF09538 FYDLN_acid:  Protein o  44.0      12 0.00026   30.3   1.2   17  208-224    25-41  (108)
 63 KOG1146 Homeobox protein [Gene  43.4     7.4 0.00016   43.3  -0.2   29  209-237  1328-1356(1406)
 64 PRK00464 nrdR transcriptional   41.9      10 0.00022   32.4   0.4   15  209-223    28-42  (154)
 65 PF03153 TFIIA:  Transcription   41.2     9.6 0.00021   35.3   0.2    7   72-78    273-279 (375)
 66 smart00154 ZnF_AN1 AN1-like Zi  41.1      13 0.00028   25.0   0.8   15  208-222    11-25  (39)
 67 PF08790 zf-LYAR:  LYAR-type C2  39.3     8.6 0.00019   24.9  -0.3   20  210-230     1-20  (28)
 68 smart00834 CxxC_CXXC_SSSS Puta  37.3      13 0.00029   23.6   0.4   14  209-222     5-18  (41)
 69 TIGR02605 CxxC_CxxC_SSSS putat  36.6      13 0.00029   25.1   0.3   14  209-222     5-18  (52)
 70 PF01428 zf-AN1:  AN1-like Zinc  34.7      12 0.00026   25.1  -0.2   14  208-221    12-25  (43)
 71 smart00734 ZnF_Rad18 Rad18-lik  34.1      18 0.00038   22.4   0.5   20  210-230     2-21  (26)
 72 KOG2071 mRNA cleavage and poly  33.3      20 0.00042   36.9   1.0   27  207-233   416-442 (579)
 73 PF09723 Zn-ribbon_8:  Zinc rib  32.4      16 0.00035   24.5   0.2   17  209-225     5-21  (42)
 74 KOG3456 NADH:ubiquinone oxidor  32.3      16 0.00035   30.6   0.2   16  206-221   101-116 (120)
 75 KOG0127 Nucleolar protein fibr  31.9      41 0.00089   35.0   3.0    7  179-185   327-333 (678)
 76 COG5593 Nucleic-acid-binding p  31.1      41 0.00089   35.3   2.8   12   74-85    702-713 (821)
 77 KOG2141 Protein involved in hi  30.3      88  0.0019   33.5   5.0    7  182-188   300-306 (822)
 78 PF10276 zf-CHCC:  Zinc-finger   29.6      15 0.00033   25.2  -0.3   12  208-219    28-39  (40)
 79 COG5189 SFP1 Putative transcri  29.5      25 0.00055   34.5   1.0   25  207-231   347-373 (423)
 80 KOG3130 Uncharacterized conser  28.3      54  0.0012   33.1   3.0   14  136-149   317-330 (514)
 81 KOG0943 Predicted ubiquitin-pr  27.9      40 0.00086   38.7   2.2   13  218-230  1926-1938(3015)
 82 COG4547 CobT Cobalamin biosynt  26.5      94   0.002   32.1   4.3   10  130-139   289-298 (620)
 83 PF13717 zinc_ribbon_4:  zinc-r  26.2      36 0.00078   22.4   1.0   18  203-220    19-36  (36)
 84 PF12907 zf-met2:  Zinc-binding  25.5      14 0.00029   25.6  -1.2   26  210-235     2-30  (40)
 85 PF03966 Trm112p:  Trm112p-like  25.3      19 0.00042   26.0  -0.5   15  207-221    51-65  (68)
 86 KOG4727 U1-like Zn-finger prot  23.4      32 0.00068   31.0   0.4   29  203-231    68-97  (193)
 87 KOG4364 Chromatin assembly fac  22.9      63  0.0014   34.4   2.5    8  199-206   639-646 (811)
 88 KOG1999 RNA polymerase II tran  22.7      93   0.002   34.2   3.7   12  138-149   102-113 (1024)
 89 PF10013 DUF2256:  Uncharacteri  22.5      41 0.00089   23.7   0.8   13  209-221     8-20  (42)
 90 KOG2593 Transcription initiati  21.8      32  0.0007   34.3   0.2   19  208-226   127-145 (436)
 91 KOG2236 Uncharacterized conser  21.7 1.3E+02  0.0028   30.6   4.3   19  207-225   254-272 (483)
 92 COG4391 Uncharacterized protei  21.1      38 0.00083   25.7   0.4   14  207-220    46-59  (62)
 93 PRK00398 rpoP DNA-directed RNA  21.0      39 0.00085   22.7   0.4   16  209-224     3-18  (46)
 94 PF04780 DUF629:  Protein of un  20.9      37  0.0008   34.0   0.4   31  205-235    53-83  (466)
 95 KOG2482 Predicted C2H2-type Zn  20.5      42 0.00091   33.2   0.6   30  207-236   193-222 (423)
 96 smart00659 RPOLCX RNA polymera  20.3      44 0.00095   23.1   0.5   14  209-222     2-15  (44)
 97 PLN02748 tRNA dimethylallyltra  20.3      44 0.00095   33.2   0.7   26  208-233   417-443 (468)
 98 PF13878 zf-C2H2_3:  zinc-finge  20.2      72  0.0016   21.5   1.6   27  207-233    11-39  (41)

No 1  
>PHA00616 hypothetical protein
Probab=97.82  E-value=3.9e-06  Score=58.62  Aligned_cols=29  Identities=17%  Similarity=0.386  Sum_probs=27.3

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      ||.|..||+.|...++|..|.|.|||+.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            69999999999999999999999999863


No 2  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.71  E-value=5.8e-06  Score=47.99  Aligned_cols=23  Identities=26%  Similarity=0.808  Sum_probs=21.9

Q ss_pred             ccCCcCCCCccCcccchhhhhhh
Q 044541          210 FPCKSCNRSFTTEGGLQSHTKAK  232 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~Rah  232 (237)
                      |.|..|++.|.....|+.|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999985


No 3  
>PHA02768 hypothetical protein; Provisional
Probab=97.69  E-value=1.2e-05  Score=58.51  Aligned_cols=25  Identities=12%  Similarity=0.535  Sum_probs=24.3

Q ss_pred             cccCCcCCCCccCcccchhhhhhhc
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      .|.|..|||.|+..++|+.|+|+|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC
Confidence            6899999999999999999999999


No 4  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.60  E-value=1.2e-05  Score=48.34  Aligned_cols=26  Identities=23%  Similarity=0.751  Sum_probs=24.7

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      +|.|..|++.|.+..+|..|+|.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            69999999999999999999999986


No 5  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.59  E-value=1.5e-05  Score=45.09  Aligned_cols=24  Identities=33%  Similarity=0.872  Sum_probs=21.1

Q ss_pred             ccCCcCCCCccCcccchhhhhhhc
Q 044541          210 FPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      |.|..|++.|.+...|..|+++||
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999999987


No 6  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=97.39  E-value=5.5e-05  Score=69.85  Aligned_cols=29  Identities=24%  Similarity=0.520  Sum_probs=25.4

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      ++.|..|||.|+..--||.|.|+|||||+
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKP  215 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKP  215 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCC
Confidence            88888899999888889999999998885


No 7  
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.17  E-value=0.00014  Score=41.14  Aligned_cols=25  Identities=20%  Similarity=0.707  Sum_probs=22.8

Q ss_pred             ccCCcCCCCccCcccchhhhhhhcC
Q 044541          210 FPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      |.|..|+++|.....|+.|++.|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhcc
Confidence            7899999999999999999997753


No 8  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=97.12  E-value=0.00022  Score=73.95  Aligned_cols=38  Identities=21%  Similarity=0.426  Sum_probs=33.7

Q ss_pred             CCCCCCCCCcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          200 KQQPHKSGGSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       200 K~qTPkSgGpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      ....++-...|.|..|.|.|++.++||+|.|.|||||+
T Consensus       344 ~~~~~~~~~khkCr~CakvfgS~SaLqiHlRSHTGERP  381 (958)
T KOG1074|consen  344 EGPSEKPFFKHKCRFCAKVFGSDSALQIHLRSHTGERP  381 (958)
T ss_pred             ccCCccccccchhhhhHhhcCchhhhhhhhhccCCCCC
Confidence            34456667899999999999999999999999999985


No 9  
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.96  E-value=0.00022  Score=43.47  Aligned_cols=24  Identities=38%  Similarity=0.879  Sum_probs=21.9

Q ss_pred             cccCCcCCCCccCcccchhhhhhh
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAK  232 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~Rah  232 (237)
                      +|.|..|+|.|+++.+|.+|++.+
T Consensus         1 q~~C~~C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    1 QFYCDACDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             -CBBTTTTBBBSSHHHHHCCTTSH
T ss_pred             CCCcccCCCCcCCHHHHHHHHccC
Confidence            589999999999999999999875


No 10 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=96.77  E-value=0.00052  Score=63.52  Aligned_cols=31  Identities=19%  Similarity=0.590  Sum_probs=28.7

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      ..||.|.+|+|+|.-.+||..|+++|.+-|+
T Consensus       213 EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  213 EKPFSCPHCGKAFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             CCCccCCcccchhcchHHHHHHHHhhcCCcc
Confidence            5799999999999999999999999998764


No 11 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.66  E-value=0.00031  Score=41.35  Aligned_cols=24  Identities=42%  Similarity=0.926  Sum_probs=22.3

Q ss_pred             ccCCcCCCCccCcccchhhhhhhc
Q 044541          210 FPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      |.|..|++.|++..+|++|.+.|.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~~   24 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSKK   24 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTHH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcCC
Confidence            789999999999999999999874


No 12 
>PHA00732 hypothetical protein
Probab=96.40  E-value=0.0012  Score=50.22  Aligned_cols=26  Identities=23%  Similarity=0.352  Sum_probs=23.0

Q ss_pred             cccCCcCCCCccCcccchhhhhh-hcC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKA-KHG  234 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~Ra-hhG  234 (237)
                      ||.|..|++.|.+..+|+.|+++ |++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC
Confidence            68999999999999999999996 554


No 13 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=96.32  E-value=0.0011  Score=68.66  Aligned_cols=31  Identities=23%  Similarity=0.548  Sum_probs=29.4

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .+-|.|+.|||+|...-.|+.|.|||.|||+
T Consensus       279 lRKFKCtECgKAFKfKHHLKEHlRIHSGEKP  309 (1007)
T KOG3623|consen  279 LRKFKCTECGKAFKFKHHLKEHLRIHSGEKP  309 (1007)
T ss_pred             hccccccccchhhhhHHHHHhhheeecCCCC
Confidence            4789999999999999999999999999985


No 14 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.22  E-value=0.0017  Score=40.55  Aligned_cols=27  Identities=44%  Similarity=0.778  Sum_probs=23.8

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhc
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      .|+|.|..|++.|.+..+|..|.+.+.
T Consensus         1 ~~~~~C~~C~~~~~~~~~~~~H~~gk~   27 (35)
T smart00451        1 TGGFYCKLCNVTFTDEISVEAHLKGKK   27 (35)
T ss_pred             CcCeEccccCCccCCHHHHHHHHChHH
Confidence            378999999999999999999988653


No 15 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=96.21  E-value=0.0015  Score=68.00  Aligned_cols=30  Identities=20%  Similarity=0.627  Sum_probs=27.7

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .-+.|+.|||.|++.++|+.|+|+|+|+|+
T Consensus       878 n~h~C~vCgk~FsSSsALqiH~rTHtg~KP  907 (958)
T KOG1074|consen  878 NAHVCNVCGKQFSSSAALEIHMRTHTGPKP  907 (958)
T ss_pred             chhhhccchhcccchHHHHHhhhcCCCCCC
Confidence            468899999999999999999999999974


No 16 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.27  E-value=0.0064  Score=44.50  Aligned_cols=33  Identities=18%  Similarity=0.336  Sum_probs=24.7

Q ss_pred             CCCCcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          205 KSGGSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       205 kSgGpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .|--|..|+.|+..|.+.-+|.+|..++|+.++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            355699999999999999999999999999874


No 17 
>PHA00733 hypothetical protein
Probab=94.80  E-value=0.012  Score=47.92  Aligned_cols=27  Identities=26%  Similarity=0.471  Sum_probs=20.1

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      .+|.|..|++.|....+|..|++.+|+
T Consensus        98 ~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         98 HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            467777777777777777777777775


No 18 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=94.72  E-value=0.008  Score=35.32  Aligned_cols=24  Identities=29%  Similarity=0.652  Sum_probs=19.3

Q ss_pred             ccCCcCCCCccCcccchhhhhhhcC
Q 044541          210 FPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      |.|..|+=+.+ ...|..|.+.||+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            78999996666 8899999999986


No 19 
>PHA00733 hypothetical protein
Probab=94.39  E-value=0.018  Score=47.07  Aligned_cols=27  Identities=19%  Similarity=0.448  Sum_probs=24.7

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhc
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      ..||.|..|++.|.+..+|.+|+++|+
T Consensus        71 ~kPy~C~~Cgk~Fss~s~L~~H~r~h~   97 (128)
T PHA00733         71 VSPYVCPLCLMPFSSSVSLKQHIRYTE   97 (128)
T ss_pred             CCCccCCCCCCcCCCHHHHHHHHhcCC
Confidence            579999999999999999999999763


No 20 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.27  E-value=0.017  Score=41.74  Aligned_cols=27  Identities=41%  Similarity=0.843  Sum_probs=23.3

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      ..|.|..|++.|.+..+|+.|++.|+.
T Consensus        49 ~~~~C~~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             SSEEBSSSS-EESSHHHHHHHHHHTTT
T ss_pred             CCCCCCccCCCCcCHHHHHHHHcCccC
Confidence            369999999999999999999998643


No 21 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=94.22  E-value=0.015  Score=60.56  Aligned_cols=31  Identities=19%  Similarity=0.546  Sum_probs=24.9

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .+||.|-.|.|+|.+.-.|+.|.|-|.|||+
T Consensus       920 qRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP  950 (1007)
T KOG3623|consen  920 QRPYQCIICKKAFKHKHHLTEHKRLHSGEKP  950 (1007)
T ss_pred             CCCcccchhhHhhhhhhhhhhhhhhccCCCc
Confidence            3788888888888888888888888888874


No 22 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.13  E-value=0.017  Score=35.43  Aligned_cols=21  Identities=38%  Similarity=0.852  Sum_probs=18.1

Q ss_pred             ccCCcCCCCccCcccchhhhhh
Q 044541          210 FPCKSCNRSFTTEGGLQSHTKA  231 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~Ra  231 (237)
                      ..|..|||.| ....|..|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 77889999875


No 23 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=93.63  E-value=0.022  Score=52.15  Aligned_cols=30  Identities=23%  Similarity=0.511  Sum_probs=23.1

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .-|.|..|||.|+---.|.+|.|+|||-|+
T Consensus       144 kr~lct~cgkgfndtfdlkrh~rthtgvrp  173 (267)
T KOG3576|consen  144 KRHLCTFCGKGFNDTFDLKRHTRTHTGVRP  173 (267)
T ss_pred             HHHHHhhccCcccchhhhhhhhccccCccc
Confidence            456777777878877888888888888764


No 24 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=92.32  E-value=0.053  Score=53.58  Aligned_cols=26  Identities=23%  Similarity=0.639  Sum_probs=23.8

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      -|.|..|+|.|+...||-+|.|-|.-
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKP  320 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKP  320 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCC
Confidence            58899999999999999999999864


No 25 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=91.09  E-value=0.067  Score=32.62  Aligned_cols=14  Identities=29%  Similarity=0.918  Sum_probs=12.3

Q ss_pred             CcccCCcCCCCccC
Q 044541          208 GSFPCKSCNRSFTT  221 (237)
Q Consensus       208 Gpy~CKsCgKtFsS  221 (237)
                      .||.|..|+++|.+
T Consensus        13 k~~~C~~C~k~F~~   26 (26)
T PF13465_consen   13 KPYKCPYCGKSFSN   26 (26)
T ss_dssp             SSEEESSSSEEESS
T ss_pred             CCCCCCCCcCeeCc
Confidence            58999999999964


No 26 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=90.33  E-value=0.11  Score=31.67  Aligned_cols=14  Identities=21%  Similarity=0.501  Sum_probs=12.5

Q ss_pred             cchhhhhhhcCCCC
Q 044541          224 GLQSHTKAKHGAPA  237 (237)
Q Consensus       224 aLqsH~RahhGek~  237 (237)
                      +|+.|+|+|+|+++
T Consensus         1 ~l~~H~~~H~~~k~   14 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP   14 (26)
T ss_dssp             HHHHHHHHHSSSSS
T ss_pred             CHHHHhhhcCCCCC
Confidence            58999999999985


No 27 
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=89.84  E-value=0.083  Score=44.51  Aligned_cols=27  Identities=41%  Similarity=0.771  Sum_probs=25.3

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhc
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      +|+|-|-.|-|.|....+|+-|.|++-
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~ktK~   81 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKTKV   81 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhccH
Confidence            699999999999999999999999864


No 28 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=89.60  E-value=0.09  Score=48.24  Aligned_cols=29  Identities=34%  Similarity=0.701  Sum_probs=26.8

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      .+||.|..|+|+|.+...|.+|.+.=||-
T Consensus       171 vrpykc~~c~kaftqrcsleshl~kvhgv  199 (267)
T KOG3576|consen  171 VRPYKCSLCEKAFTQRCSLESHLKKVHGV  199 (267)
T ss_pred             ccccchhhhhHHHHhhccHHHHHHHHcCc
Confidence            58999999999999999999999988874


No 29 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=87.07  E-value=0.14  Score=50.71  Aligned_cols=30  Identities=30%  Similarity=0.680  Sum_probs=27.2

Q ss_pred             CCCcccCCcCCCCccCcccchhhhhhhcCC
Q 044541          206 SGGSFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       206 SgGpy~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      +.|-|.|.+|+|.|....-|..|+-+||-.
T Consensus       353 s~gi~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  353 SSGIFSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             cCceeecHHhhhhhHHHHHHHHhHHhhhcc
Confidence            468999999999999999999999999853


No 30 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=83.98  E-value=0.27  Score=32.38  Aligned_cols=26  Identities=31%  Similarity=0.574  Sum_probs=17.2

Q ss_pred             CcccCCcCCCCccCc----ccchhhhhhhc
Q 044541          208 GSFPCKSCNRSFTTE----GGLQSHTKAKH  233 (237)
Q Consensus       208 Gpy~CKsCgKtFsSe----saLqsH~Rahh  233 (237)
                      ....|+.|++.|...    ++|..|.+.+|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            578999999987765    78899986554


No 31 
>PHA00732 hypothetical protein
Probab=83.79  E-value=0.46  Score=36.26  Aligned_cols=22  Identities=27%  Similarity=0.547  Sum_probs=18.8

Q ss_pred             cccCCcCCCCccCcccchhhhhhhc
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      +|.|..|+++|.   .|..|.++|-
T Consensus        27 ~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732         27 LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CCccCCCCCEeC---ChhhhhcccC
Confidence            468999999997   6999998764


No 32 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=83.51  E-value=0.41  Score=40.10  Aligned_cols=26  Identities=27%  Similarity=0.634  Sum_probs=17.8

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      ....+|=.|||.|   ..|.+|.+.|||=
T Consensus        70 ~d~i~clecGk~~---k~LkrHL~~~~gl   95 (132)
T PF05443_consen   70 PDYIICLECGKKF---KTLKRHLRTHHGL   95 (132)
T ss_dssp             SS-EE-TBT--EE---SBHHHHHHHTT-S
T ss_pred             cCeeEEccCCccc---chHHHHHHHccCC
Confidence            4578999999999   5679999999984


No 33 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=83.14  E-value=0.65  Score=32.26  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=15.4

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      .|.|+.|...|.  .+|+.|.+.+|+
T Consensus        31 ~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen   31 NVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CccCCCchhhhh--hHHHHHHHHhcC
Confidence            466777766544  377777776664


No 34 
>PRK04860 hypothetical protein; Provisional
Probab=81.88  E-value=0.67  Score=39.58  Aligned_cols=26  Identities=19%  Similarity=0.525  Sum_probs=22.5

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      =+|.|. |++   ....+..|+|+|+|+++
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~  143 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV  143 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc
Confidence            379998 997   77889999999999863


No 35 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=81.68  E-value=0.65  Score=32.26  Aligned_cols=26  Identities=35%  Similarity=0.802  Sum_probs=21.4

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcCC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      .|.|+.|++.|+ ..+|..|....|..
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~   27 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRS   27 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcC
Confidence            599999999766 57899998887754


No 36 
>PF03066 Nucleoplasmin:  Nucleoplasmin;  InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins. They function as nuclear chaperones which are needed for the proper assembly of nucleosomes and the attainment of proper higher order chromatin structures [].; GO: 0003676 nucleic acid binding; PDB: 2P1B_E 1XB9_I 1XE0_C 1NLQ_A 2VTX_E 1K5J_D 1EJY_N 1EE5_B 3T30_J.
Probab=77.93  E-value=0.7  Score=38.92  Aligned_cols=9  Identities=56%  Similarity=0.877  Sum_probs=0.0

Q ss_pred             CCCCCcccc
Q 044541          134 EDEETPKKA  142 (237)
Q Consensus       134 eEEeTPkK~  142 (237)
                      +++.+|+|.
T Consensus       139 ~ee~~p~K~  147 (149)
T PF03066_consen  139 EEEESPVKK  147 (149)
T ss_dssp             ---------
T ss_pred             ccccCCCcc
Confidence            355677653


No 37 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=77.88  E-value=0.97  Score=30.99  Aligned_cols=24  Identities=25%  Similarity=0.612  Sum_probs=19.3

Q ss_pred             cccCCcCCCCccCc-----ccchhhhhhh
Q 044541          209 SFPCKSCNRSFTTE-----GGLQSHTKAK  232 (237)
Q Consensus       209 py~CKsCgKtFsSe-----saLqsH~Rah  232 (237)
                      --.|+.|++.++..     ++|.+|.+..
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~   46 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRK   46 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhH
Confidence            46799999988776     5899999843


No 38 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=73.30  E-value=1.3  Score=34.34  Aligned_cols=27  Identities=19%  Similarity=0.554  Sum_probs=25.5

Q ss_pred             CcccC----CcCCCCccCcccchhhhhhhcC
Q 044541          208 GSFPC----KSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       208 Gpy~C----KsCgKtFsSesaLqsH~RahhG  234 (237)
                      ..|.|    ..|+-.+.+...|+.|.|.+||
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            56999    9999999999999999999997


No 39 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=71.72  E-value=1.5  Score=46.15  Aligned_cols=27  Identities=30%  Similarity=0.714  Sum_probs=25.0

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhc
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      -|.|.|..|+|.|-.=..+-.|+|+|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            589999999999999999999999984


No 40 
>PF14353 CpXC:  CpXC protein
Probab=69.57  E-value=1.9  Score=34.24  Aligned_cols=28  Identities=39%  Similarity=0.486  Sum_probs=23.7

Q ss_pred             CCCcccCCcCCCCccCcccchhhhhhhc
Q 044541          206 SGGSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       206 SgGpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      +.-.|.|++||..|.....|.-|-..|+
T Consensus        35 ~l~~~~CP~Cg~~~~~~~p~lY~D~~~~   62 (128)
T PF14353_consen   35 SLFSFTCPSCGHKFRLEYPLLYHDPEKK   62 (128)
T ss_pred             CcCEEECCCCCCceecCCCEEEEcCCCC
Confidence            3568999999999999999998877663


No 41 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=69.10  E-value=0.89  Score=38.03  Aligned_cols=26  Identities=42%  Similarity=0.653  Sum_probs=24.1

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhh
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAK  232 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~Rah  232 (237)
                      +|+|-|-.|-|-|.++.+|..|.|-+
T Consensus        53 lGqhYCieCaryf~t~~aL~~Hkkgk   78 (126)
T COG5112          53 LGQHYCIECARYFITEKALMEHKKGK   78 (126)
T ss_pred             CceeeeehhHHHHHHHHHHHHHhccc
Confidence            68999999999999999999998765


No 42 
>PHA02768 hypothetical protein; Provisional
Probab=65.79  E-value=2.9  Score=30.63  Aligned_cols=20  Identities=15%  Similarity=0.262  Sum_probs=17.8

Q ss_pred             CcccCCcCCCCccCcccchh
Q 044541          208 GSFPCKSCNRSFTTEGGLQS  227 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqs  227 (237)
                      .+|.|..|+|.|+..+.|+.
T Consensus        30 k~~kc~~C~k~f~~~s~l~~   49 (55)
T PHA02768         30 TNLKLSNCKRISLRTGEYIE   49 (55)
T ss_pred             CcccCCcccceecccceeEE
Confidence            38999999999999998874


No 43 
>PTZ00448 hypothetical protein; Provisional
Probab=65.45  E-value=3.5  Score=40.10  Aligned_cols=27  Identities=15%  Similarity=0.520  Sum_probs=23.4

Q ss_pred             CCCcccCCcCCCCccCcccchhhhhhh
Q 044541          206 SGGSFPCKSCNRSFTTEGGLQSHTKAK  232 (237)
Q Consensus       206 SgGpy~CKsCgKtFsSesaLqsH~Rah  232 (237)
                      +.+.|.|..|+..|.+......|.|+-
T Consensus       311 ~~~~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        311 KSNMLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             ccCCccccccccccCCHHHHHHHhhhh
Confidence            447899999999999888889999874


No 44 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=65.03  E-value=2.5  Score=41.69  Aligned_cols=29  Identities=34%  Similarity=0.654  Sum_probs=26.7

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcCCC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHGAP  236 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhGek  236 (237)
                      -+|.|.-|.|.|.+..+|..|.+.+||=+
T Consensus       351 ~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  351 ILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             CceeeecchhhhccchhHHHHHHHhhccc
Confidence            58999999999999999999999999843


No 45 
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=64.45  E-value=2.4  Score=42.53  Aligned_cols=26  Identities=38%  Similarity=0.805  Sum_probs=23.0

Q ss_pred             Cc-ccCCcCCCCccCcccchhhhhhhc
Q 044541          208 GS-FPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       208 Gp-y~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      |. +-|--|+|+|.++.+|..|...+.
T Consensus       290 ge~lyC~vCnKsFKseKq~kNHEnSKK  316 (508)
T KOG0717|consen  290 GEVLYCVVCNKSFKSEKQLKNHENSKK  316 (508)
T ss_pred             CCceEEeeccccccchHHHHhhHHHHH
Confidence            44 899999999999999999988764


No 46 
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=64.43  E-value=6.7  Score=39.53  Aligned_cols=31  Identities=26%  Similarity=0.514  Sum_probs=25.8

Q ss_pred             CCCCCCCCCcccCCcCCCCccCcccchhhhhhh
Q 044541          200 KQQPHKSGGSFPCKSCNRSFTTEGGLQSHTKAK  232 (237)
Q Consensus       200 K~qTPkSgGpy~CKsCgKtFsSesaLqsH~Rah  232 (237)
                      +.++|.  ...+|-.|...|.+.+-|-.|.++-
T Consensus       453 ~~~~ps--a~~~C~tCr~~FdSRnkLF~Hlk~t  483 (508)
T KOG0717|consen  453 SSQTPS--ALISCTTCRESFDSRNKLFAHLKKT  483 (508)
T ss_pred             CCCCcc--hhHhhhhhhhhccchhHHHHHhhhc
Confidence            446773  4799999999999999999998753


No 47 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=64.41  E-value=2.5  Score=36.48  Aligned_cols=25  Identities=20%  Similarity=0.361  Sum_probs=21.9

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcCC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      -..+|=.|||.|   ..|++|.++|+|=
T Consensus        75 D~IicLEDGkkf---KSLKRHL~t~~gm   99 (148)
T COG4957          75 DYIICLEDGKKF---KSLKRHLTTHYGL   99 (148)
T ss_pred             CeEEEeccCcch---HHHHHHHhcccCC
Confidence            468999999999   5699999999984


No 48 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=64.17  E-value=1.3  Score=39.71  Aligned_cols=29  Identities=21%  Similarity=0.411  Sum_probs=23.5

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      ..-|.|..|+|.|...-=...|++.+|.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            35699999999999999999999999975


No 49 
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=63.83  E-value=13  Score=38.95  Aligned_cols=11  Identities=27%  Similarity=0.359  Sum_probs=4.8

Q ss_pred             ccCcccchhhh
Q 044541          219 FTTEGGLQSHT  229 (237)
Q Consensus       219 FsSesaLqsH~  229 (237)
                      |..-..|+.|.
T Consensus       489 ~~~ld~L~~~L  499 (840)
T PF04147_consen  489 FEVLDSLIPHL  499 (840)
T ss_pred             HHHHHHHHHHH
Confidence            44444444443


No 50 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=61.95  E-value=4.4  Score=34.72  Aligned_cols=27  Identities=30%  Similarity=0.551  Sum_probs=21.7

Q ss_pred             cccCCcCCCCccCcccchhhhh--hhcCC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTK--AKHGA  235 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~R--ahhGe  235 (237)
                      +|.|..|...|+....|..|.+  .|+++
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~  317 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGE  317 (467)
T ss_pred             CCCCccccCCccccccccccccccccccc
Confidence            6888888888888888888888  67776


No 51 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=61.52  E-value=4.1  Score=41.36  Aligned_cols=25  Identities=28%  Similarity=0.760  Sum_probs=15.4

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhc
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      ..+.|..|++.|. ...|..|.++||
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H  476 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH  476 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC
Confidence            3556666666664 455666666655


No 52 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=60.47  E-value=3.9  Score=41.54  Aligned_cols=25  Identities=12%  Similarity=0.308  Sum_probs=20.6

Q ss_pred             cCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          211 PCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       211 ~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .|+ ||+.| ....|..|.+.|.+.|.
T Consensus       480 ~Cp-Cg~~~-~R~~L~~H~~thCp~Kp  504 (567)
T PLN03086        480 QCP-CGVVL-EKEQMVQHQASTCPLRL  504 (567)
T ss_pred             cCC-CCCCc-chhHHHhhhhccCCCCc
Confidence            598 99866 56899999999988763


No 53 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=60.41  E-value=3.8  Score=33.81  Aligned_cols=16  Identities=44%  Similarity=0.945  Sum_probs=13.5

Q ss_pred             CcccCCcCCCCccCcc
Q 044541          208 GSFPCKSCNRSFTTEG  223 (237)
Q Consensus       208 Gpy~CKsCgKtFsSes  223 (237)
                      --|.|+.|+++|.-..
T Consensus        52 qRyrC~~C~~tf~~~~   67 (129)
T COG3677          52 QRYKCKSCGSTFTVET   67 (129)
T ss_pred             cccccCCcCcceeeec
Confidence            4799999999997654


No 54 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=56.13  E-value=1.6  Score=42.98  Aligned_cols=25  Identities=40%  Similarity=0.659  Sum_probs=23.5

Q ss_pred             cccCCcCCCCccCcccchhhhhhhc
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      +|.|+.|.|.|.++..|..|++.|-
T Consensus       237 ~fqC~~C~KrFaTeklL~~Hv~rHv  261 (467)
T KOG3608|consen  237 SFQCAQCFKRFATEKLLKSHVVRHV  261 (467)
T ss_pred             chHHHHHHHHHhHHHHHHHHHHHhh
Confidence            9999999999999999999999884


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=56.02  E-value=2.7  Score=31.76  Aligned_cols=27  Identities=22%  Similarity=0.493  Sum_probs=23.6

Q ss_pred             CcccCCcCCCCccCcccchhhhhhhcC
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTKAKHG  234 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~RahhG  234 (237)
                      -.+.|+.|+..|......+.|...-||
T Consensus        16 ~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          16 EFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             eeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            478999999999999999999876665


No 56 
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=53.18  E-value=7.5  Score=38.29  Aligned_cols=50  Identities=16%  Similarity=0.261  Sum_probs=35.5

Q ss_pred             ccccCCCCCCCCCCCCCCCC--CCC--CC-CCCCCcccCCcCCCCccCcccchhhh
Q 044541          179 HIATPHPSKKSAKTPANNDQ--TKQ--QP-HKSGGSFPCKSCNRSFTTEGGLQSHT  229 (237)
Q Consensus       179 HvATPhPaKKaGKTP~n~~g--~K~--qT-PkSgGpy~CKsCgKtFsSesaLqsH~  229 (237)
                      ||++|-|+-+...-++|..+  ++.  .| --++.||.| .||++..+.++|+-|.
T Consensus       178 ~~S~~vp~~~~~~~~~Ns~~~~S~~~~~T~~t~~~p~k~-~~~~~~~T~~~l~~HS  232 (442)
T KOG4124|consen  178 RVSVVVPAAAAAAAAANSSDMSSDEASSTAETTGTPKKM-PESLVMDTSSPLSDHS  232 (442)
T ss_pred             cccccCchhhhhhhccccccccccccccccccccCCccC-cccccccccchhhhcc
Confidence            88888887666666666543  111  11 124789999 6999999999999885


No 57 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=48.12  E-value=19  Score=36.52  Aligned_cols=16  Identities=13%  Similarity=0.206  Sum_probs=11.1

Q ss_pred             ccceeeccCCcccccc
Q 044541           27 KMDIRLVSNGKPELQA   42 (237)
Q Consensus        27 ~~~~~~~~ngk~e~k~   42 (237)
                      ...|++...|..+...
T Consensus        96 ~~~v~v~ddg~~~~~l  111 (622)
T PF02724_consen   96 NDQVIVFDDGDIEEEL  111 (622)
T ss_pred             CCcEEEEECCChhhhc
Confidence            4467778888776664


No 58 
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription]
Probab=46.66  E-value=28  Score=37.52  Aligned_cols=8  Identities=50%  Similarity=0.684  Sum_probs=3.4

Q ss_pred             CccCCCcc
Q 044541          169 QKTEEKKG  176 (237)
Q Consensus       169 qKTggKKg  176 (237)
                      |..|.|+|
T Consensus       978 ~d~~~k~~  985 (988)
T KOG2038|consen  978 QDRGKKKG  985 (988)
T ss_pred             cccccccc
Confidence            34444443


No 59 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=46.51  E-value=7.8  Score=37.86  Aligned_cols=23  Identities=26%  Similarity=0.781  Sum_probs=21.6

Q ss_pred             CcccCCcCCCCccCcccchhhhh
Q 044541          208 GSFPCKSCNRSFTTEGGLQSHTK  230 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLqsH~R  230 (237)
                      .||.|..|+|.+..-++|+-|.+
T Consensus       397 KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         397 KPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceeccccchhhccCccceeccc
Confidence            69999999999999999999965


No 60 
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=45.76  E-value=6.9  Score=30.76  Aligned_cols=8  Identities=38%  Similarity=0.800  Sum_probs=0.0

Q ss_pred             CCCCcccc
Q 044541          135 DEETPKKA  142 (237)
Q Consensus       135 EEeTPkK~  142 (237)
                      |+..|+|.
T Consensus        50 ee~m~rK~   57 (81)
T PF14812_consen   50 EEPMPRKG   57 (81)
T ss_dssp             --------
T ss_pred             cccccccc
Confidence            55667664


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=45.26  E-value=10  Score=32.52  Aligned_cols=29  Identities=21%  Similarity=0.524  Sum_probs=26.6

Q ss_pred             CcccCC--cCCCCccCcccchhhhhhhcCCC
Q 044541          208 GSFPCK--SCNRSFTTEGGLQSHTKAKHGAP  236 (237)
Q Consensus       208 Gpy~CK--sCgKtFsSesaLqsH~RahhGek  236 (237)
                      .+|.|.  .|++.|.....|..|...|++-+
T Consensus       320 ~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         320 KPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             CceeeeccCCCccccccccccCCcccccCCC
Confidence            599999  89999999999999999998754


No 62 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=44.01  E-value=12  Score=30.31  Aligned_cols=17  Identities=24%  Similarity=0.593  Sum_probs=11.5

Q ss_pred             CcccCCcCCCCccCccc
Q 044541          208 GSFPCKSCNRSFTTEGG  224 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesa  224 (237)
                      .|.+|+.||..|.-...
T Consensus        25 ~PivCP~CG~~~~~~~~   41 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPEPP   41 (108)
T ss_pred             CCccCCCCCCccCcccc
Confidence            46678888877776633


No 63 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=43.42  E-value=7.4  Score=43.34  Aligned_cols=29  Identities=17%  Similarity=0.425  Sum_probs=25.1

Q ss_pred             cccCCcCCCCccCcccchhhhhhhcCCCC
Q 044541          209 SFPCKSCNRSFTTEGGLQSHTKAKHGAPA  237 (237)
Q Consensus       209 py~CKsCgKtFsSesaLqsH~RahhGek~  237 (237)
                      .|-|..|.+.|+...+|++|+|+-+++++
T Consensus      1328 ~~~c~~c~~~~~~~~alqihm~~~~~~~k 1356 (1406)
T KOG1146|consen 1328 TYHCLACEVLLSGREALQIHMRSSAHRRK 1356 (1406)
T ss_pred             cccchHHHhhcchhHHHHHHHHHhhhccc
Confidence            34499999999999999999998877654


No 64 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=41.87  E-value=10  Score=32.45  Aligned_cols=15  Identities=33%  Similarity=0.629  Sum_probs=12.9

Q ss_pred             cccCCcCCCCccCcc
Q 044541          209 SFPCKSCNRSFTTEG  223 (237)
Q Consensus       209 py~CKsCgKtFsSes  223 (237)
                      .|.|..||++|++.-
T Consensus        28 ~~~c~~c~~~f~~~e   42 (154)
T PRK00464         28 RRECLACGKRFTTFE   42 (154)
T ss_pred             eeeccccCCcceEeE
Confidence            599999999998754


No 65 
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=41.22  E-value=9.6  Score=35.26  Aligned_cols=7  Identities=43%  Similarity=0.786  Sum_probs=0.0

Q ss_pred             cCCCCCC
Q 044541           72 ADGSDSD   78 (237)
Q Consensus        72 ~~~~~~d   78 (237)
                      .|+..++
T Consensus       273 ~DG~~d~  279 (375)
T PF03153_consen  273 LDGAGDD  279 (375)
T ss_dssp             -------
T ss_pred             ccCCCCC
Confidence            3444333


No 66 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=41.10  E-value=13  Score=24.96  Aligned_cols=15  Identities=33%  Similarity=0.862  Sum_probs=12.3

Q ss_pred             CcccCCcCCCCccCc
Q 044541          208 GSFPCKSCNRSFTTE  222 (237)
Q Consensus       208 Gpy~CKsCgKtFsSe  222 (237)
                      .||.|..|++.|=..
T Consensus        11 ~~f~C~~C~~~FC~~   25 (39)
T smart00154       11 TGFKCRHCGNLFCGE   25 (39)
T ss_pred             cCeECCccCCccccc
Confidence            389999999999543


No 67 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=39.26  E-value=8.6  Score=24.92  Aligned_cols=20  Identities=35%  Similarity=0.865  Sum_probs=13.8

Q ss_pred             ccCCcCCCCccCcccchhhhh
Q 044541          210 FPCKSCNRSFTTEGGLQSHTK  230 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~R  230 (237)
                      |.|-.|++.| .....+.|..
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            6899999999 5566677754


No 68 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=37.29  E-value=13  Score=23.63  Aligned_cols=14  Identities=21%  Similarity=0.850  Sum_probs=11.1

Q ss_pred             cccCCcCCCCccCc
Q 044541          209 SFPCKSCNRSFTTE  222 (237)
Q Consensus       209 py~CKsCgKtFsSe  222 (237)
                      -|.|..||..|...
T Consensus         5 ~y~C~~Cg~~fe~~   18 (41)
T smart00834        5 EYRCEDCGHTFEVL   18 (41)
T ss_pred             EEEcCCCCCEEEEE
Confidence            48999999988643


No 69 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=36.59  E-value=13  Score=25.12  Aligned_cols=14  Identities=21%  Similarity=0.797  Sum_probs=11.1

Q ss_pred             cccCCcCCCCccCc
Q 044541          209 SFPCKSCNRSFTTE  222 (237)
Q Consensus       209 py~CKsCgKtFsSe  222 (237)
                      -|.|..||..|...
T Consensus         5 ey~C~~Cg~~fe~~   18 (52)
T TIGR02605         5 EYRCTACGHRFEVL   18 (52)
T ss_pred             EEEeCCCCCEeEEE
Confidence            48999999888654


No 70 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=34.70  E-value=12  Score=25.15  Aligned_cols=14  Identities=43%  Similarity=0.925  Sum_probs=9.3

Q ss_pred             CcccCCcCCCCccC
Q 044541          208 GSFPCKSCNRSFTT  221 (237)
Q Consensus       208 Gpy~CKsCgKtFsS  221 (237)
                      =+|.|..|++.|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            48999999998843


No 71 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=34.10  E-value=18  Score=22.43  Aligned_cols=20  Identities=30%  Similarity=0.564  Sum_probs=16.3

Q ss_pred             ccCCcCCCCccCcccchhhhh
Q 044541          210 FPCKSCNRSFTTEGGLQSHTK  230 (237)
Q Consensus       210 y~CKsCgKtFsSesaLqsH~R  230 (237)
                      ..|+.|++.| ....+.+|..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            4799999998 6678888865


No 72 
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=33.30  E-value=20  Score=36.93  Aligned_cols=27  Identities=22%  Similarity=0.418  Sum_probs=22.9

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhc
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKH  233 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~Rahh  233 (237)
                      -.+..|+.||+.|........|+-.|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            367999999999999988888887773


No 73 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=32.41  E-value=16  Score=24.48  Aligned_cols=17  Identities=18%  Similarity=0.712  Sum_probs=12.8

Q ss_pred             cccCCcCCCCccCcccc
Q 044541          209 SFPCKSCNRSFTTEGGL  225 (237)
Q Consensus       209 py~CKsCgKtFsSesaL  225 (237)
                      -|.|..||..|.....+
T Consensus         5 ey~C~~Cg~~fe~~~~~   21 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSI   21 (42)
T ss_pred             EEEeCCCCCEEEEEEEc
Confidence            48999999888655443


No 74 
>KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion]
Probab=32.33  E-value=16  Score=30.62  Aligned_cols=16  Identities=25%  Similarity=0.580  Sum_probs=13.5

Q ss_pred             CCCcccCCcCCCCccC
Q 044541          206 SGGSFPCKSCNRSFTT  221 (237)
Q Consensus       206 SgGpy~CKsCgKtFsS  221 (237)
                      ..|+++|.+||-.|..
T Consensus       101 k~~~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  101 KPGPHICGYCGLRFVQ  116 (120)
T ss_pred             CCCCcccccchhhhhh
Confidence            3589999999998865


No 75 
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=31.86  E-value=41  Score=35.02  Aligned_cols=7  Identities=29%  Similarity=0.254  Sum_probs=3.1

Q ss_pred             ccccCCC
Q 044541          179 HIATPHP  185 (237)
Q Consensus       179 HvATPhP  185 (237)
                      |-+|-|+
T Consensus       327 ~k~T~~s  333 (678)
T KOG0127|consen  327 DKDTGHS  333 (678)
T ss_pred             ccCCCCc
Confidence            4444444


No 76 
>COG5593 Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis]
Probab=31.13  E-value=41  Score=35.26  Aligned_cols=12  Identities=50%  Similarity=0.722  Sum_probs=5.4

Q ss_pred             CCCCCCCCCCCC
Q 044541           74 GSDSDDSDLNTS   85 (237)
Q Consensus        74 ~~~~d~~~~~~d   85 (237)
                      +.|+++|+++..
T Consensus       702 e~d~ddse~d~~  713 (821)
T COG5593         702 EDDSDDSELDFA  713 (821)
T ss_pred             ccCccccccchh
Confidence            344444555443


No 77 
>KOG2141 consensus Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]
Probab=30.30  E-value=88  Score=33.55  Aligned_cols=7  Identities=43%  Similarity=0.543  Sum_probs=3.0

Q ss_pred             cCCCCCC
Q 044541          182 TPHPSKK  188 (237)
Q Consensus       182 TPhPaKK  188 (237)
                      .||--||
T Consensus       300 PPslRkk  306 (822)
T KOG2141|consen  300 PPSLRKK  306 (822)
T ss_pred             CHHHHHH
Confidence            4444333


No 78 
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=29.58  E-value=15  Score=25.21  Aligned_cols=12  Identities=25%  Similarity=0.858  Sum_probs=10.5

Q ss_pred             CcccCCcCCCCc
Q 044541          208 GSFPCKSCNRSF  219 (237)
Q Consensus       208 Gpy~CKsCgKtF  219 (237)
                      ++..|++||+.|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            578999999887


No 79 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=29.46  E-value=25  Score=34.49  Aligned_cols=25  Identities=28%  Similarity=0.828  Sum_probs=22.2

Q ss_pred             CCcccC--CcCCCCccCcccchhhhhh
Q 044541          207 GGSFPC--KSCNRSFTTEGGLQSHTKA  231 (237)
Q Consensus       207 gGpy~C--KsCgKtFsSesaLqsH~Ra  231 (237)
                      +.||.|  ..|+|++...++|+-|+.-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lh  373 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLH  373 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhc
Confidence            589999  6899999999999999753


No 80 
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=28.29  E-value=54  Score=33.08  Aligned_cols=14  Identities=14%  Similarity=0.221  Sum_probs=7.5

Q ss_pred             CCCcccccccCCCC
Q 044541          136 EETPKKAESSKKRP  149 (237)
Q Consensus       136 EeTPkK~e~GKKR~  149 (237)
                      ++.++++..|+...
T Consensus       317 ep~~~~I~T~~~tt  330 (514)
T KOG3130|consen  317 EPKRVRINTGKNTT  330 (514)
T ss_pred             CcccceeeccchhH
Confidence            35566665555444


No 81 
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=27.85  E-value=40  Score=38.74  Aligned_cols=13  Identities=15%  Similarity=0.416  Sum_probs=7.7

Q ss_pred             CccCcccchhhhh
Q 044541          218 SFTTEGGLQSHTK  230 (237)
Q Consensus       218 tFsSesaLqsH~R  230 (237)
                      .|++.+.|.+..|
T Consensus      1926 rfssrssflSN~R 1938 (3015)
T KOG0943|consen 1926 RFSSRSSFLSNLR 1938 (3015)
T ss_pred             cccchhhhhhhcc
Confidence            4666666655544


No 82 
>COG4547 CobT Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism]
Probab=26.52  E-value=94  Score=32.10  Aligned_cols=10  Identities=60%  Similarity=0.999  Sum_probs=4.3

Q ss_pred             CCCCCCCCCc
Q 044541          130 ESDDEDEETP  139 (237)
Q Consensus       130 d~~~eEEeTP  139 (237)
                      |+.+++.+||
T Consensus       289 de~de~~et~  298 (620)
T COG4547         289 DESDEDTETP  298 (620)
T ss_pred             cccccCccCc
Confidence            3333344454


No 83 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=26.15  E-value=36  Score=22.37  Aligned_cols=18  Identities=22%  Similarity=0.532  Sum_probs=14.8

Q ss_pred             CCCCCCcccCCcCCCCcc
Q 044541          203 PHKSGGSFPCKSCNRSFT  220 (237)
Q Consensus       203 TPkSgGpy~CKsCgKtFs  220 (237)
                      -|..++...|..|+..|.
T Consensus        19 ip~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen   19 IPPKGRKVRCSKCGHVFF   36 (36)
T ss_pred             CCCCCcEEECCCCCCEeC
Confidence            466778999999998873


No 84 
>PF12907 zf-met2:  Zinc-binding
Probab=25.48  E-value=14  Score=25.57  Aligned_cols=26  Identities=35%  Similarity=0.691  Sum_probs=20.4

Q ss_pred             ccCCcCCCCccC---cccchhhhhhhcCC
Q 044541          210 FPCKSCNRSFTT---EGGLQSHTKAKHGA  235 (237)
Q Consensus       210 y~CKsCgKtFsS---esaLqsH~RahhGe  235 (237)
                      |+|+.|--+|-.   ..+|..|.-.+|.-
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            789999766654   46799999988864


No 85 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=25.28  E-value=19  Score=26.04  Aligned_cols=15  Identities=27%  Similarity=0.842  Sum_probs=12.6

Q ss_pred             CCcccCCcCCCCccC
Q 044541          207 GGSFPCKSCNRSFTT  221 (237)
Q Consensus       207 gGpy~CKsCgKtFsS  221 (237)
                      .|..+|..|+|.|--
T Consensus        51 eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   51 EGELICPECGREYPI   65 (68)
T ss_dssp             TTEEEETTTTEEEEE
T ss_pred             CCEEEcCCCCCEEeC
Confidence            489999999998854


No 86 
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only]
Probab=23.40  E-value=32  Score=30.99  Aligned_cols=29  Identities=17%  Similarity=0.429  Sum_probs=22.6

Q ss_pred             CCCC-CCcccCCcCCCCccCcccchhhhhh
Q 044541          203 PHKS-GGSFPCKSCNRSFTTEGGLQSHTKA  231 (237)
Q Consensus       203 TPkS-gGpy~CKsCgKtFsSesaLqsH~Ra  231 (237)
                      +|.+ .|.|-|..|+-.|.-.-++.-|+.-
T Consensus        68 tp~sq~~GyyCdVCdcvvKDSinflDHiNg   97 (193)
T KOG4727|consen   68 TPRSQKGGYYCDVCDCVVKDSINFLDHING   97 (193)
T ss_pred             CcccccCceeeeecceeehhhHHHHHHhcc
Confidence            4443 4788899999999999888888653


No 87 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=22.89  E-value=63  Score=34.41  Aligned_cols=8  Identities=25%  Similarity=0.281  Sum_probs=3.9

Q ss_pred             CCCCCCCC
Q 044541          199 TKQQPHKS  206 (237)
Q Consensus       199 ~K~qTPkS  206 (237)
                      ...|+|..
T Consensus       639 ~~dqtp~q  646 (811)
T KOG4364|consen  639 AKDQTPTQ  646 (811)
T ss_pred             hhccCCCc
Confidence            34455553


No 88 
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription]
Probab=22.72  E-value=93  Score=34.21  Aligned_cols=12  Identities=17%  Similarity=0.158  Sum_probs=5.9

Q ss_pred             CcccccccCCCC
Q 044541          138 TPKKAESSKKRP  149 (237)
Q Consensus       138 TPkK~e~GKKR~  149 (237)
                      .--+-+.|..|.
T Consensus       102 ~~~~d~~~~~R~  113 (1024)
T KOG1999|consen  102 EDLPDERGDRRL  113 (1024)
T ss_pred             cccccccccccc
Confidence            334445566553


No 89 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.52  E-value=41  Score=23.73  Aligned_cols=13  Identities=46%  Similarity=0.749  Sum_probs=10.6

Q ss_pred             cccCCcCCCCccC
Q 044541          209 SFPCKSCNRSFTT  221 (237)
Q Consensus       209 py~CKsCgKtFsS  221 (237)
                      +=+|..|+|.|+-
T Consensus         8 ~K~C~~C~rpf~W   20 (42)
T PF10013_consen    8 SKICPVCGRPFTW   20 (42)
T ss_pred             CCcCcccCCcchH
Confidence            3479999999974


No 90 
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=21.82  E-value=32  Score=34.33  Aligned_cols=19  Identities=26%  Similarity=0.767  Sum_probs=16.2

Q ss_pred             CcccCCcCCCCccCcccch
Q 044541          208 GSFPCKSCNRSFTTEGGLQ  226 (237)
Q Consensus       208 Gpy~CKsCgKtFsSesaLq  226 (237)
                      ..|.|+.|+|.|++--+|+
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             ccccCCccccchhhhHHHH
Confidence            4899999999998877665


No 91 
>KOG2236 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.66  E-value=1.3e+02  Score=30.60  Aligned_cols=19  Identities=16%  Similarity=0.106  Sum_probs=11.0

Q ss_pred             CCcccCCcCCCCccCcccc
Q 044541          207 GGSFPCKSCNRSFTTEGGL  225 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaL  225 (237)
                      .||..|.+-=..|++....
T Consensus       254 FGpV~~P~YvvRFnS~~e~  272 (483)
T KOG2236|consen  254 FGPVKNPYYVVRFNSEEEI  272 (483)
T ss_pred             hcccCCceEEEecCchhhh
Confidence            4677775443457766543


No 92 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.09  E-value=38  Score=25.66  Aligned_cols=14  Identities=21%  Similarity=0.719  Sum_probs=12.2

Q ss_pred             CCcccCCcCCCCcc
Q 044541          207 GGSFPCKSCNRSFT  220 (237)
Q Consensus       207 gGpy~CKsCgKtFs  220 (237)
                      .|...|.+|++.|.
T Consensus        46 ~gev~CPYC~t~y~   59 (62)
T COG4391          46 EGEVVCPYCSTRYR   59 (62)
T ss_pred             CCcEecCccccEEE
Confidence            47899999999885


No 93 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=20.99  E-value=39  Score=22.68  Aligned_cols=16  Identities=19%  Similarity=0.605  Sum_probs=11.8

Q ss_pred             cccCCcCCCCccCccc
Q 044541          209 SFPCKSCNRSFTTEGG  224 (237)
Q Consensus       209 py~CKsCgKtFsSesa  224 (237)
                      .|.|..||..|.....
T Consensus         3 ~y~C~~CG~~~~~~~~   18 (46)
T PRK00398          3 EYKCARCGREVELDEY   18 (46)
T ss_pred             EEECCCCCCEEEECCC
Confidence            6899999987755433


No 94 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=20.93  E-value=37  Score=34.02  Aligned_cols=31  Identities=29%  Similarity=0.497  Sum_probs=26.8

Q ss_pred             CCCCcccCCcCCCCccCcccchhhhhhhcCC
Q 044541          205 KSGGSFPCKSCNRSFTTEGGLQSHTKAKHGA  235 (237)
Q Consensus       205 kSgGpy~CKsCgKtFsSesaLqsH~RahhGe  235 (237)
                      .+=...+|..|.+.|.....|..|+...|-+
T Consensus        53 ~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   53 KSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             CceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3456889999999999999999999987754


No 95 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=20.51  E-value=42  Score=33.20  Aligned_cols=30  Identities=20%  Similarity=0.424  Sum_probs=26.2

Q ss_pred             CCcccCCcCCCCccCcccchhhhhhhcCCC
Q 044541          207 GGSFPCKSCNRSFTTEGGLQSHTKAKHGAP  236 (237)
Q Consensus       207 gGpy~CKsCgKtFsSesaLqsH~RahhGek  236 (237)
                      .-.+.|=+|-|.|.-.+.|..|+|.+...|
T Consensus       193 L~r~~CLyCekifrdkntLkeHMrkK~Hrr  222 (423)
T KOG2482|consen  193 LERLRCLYCEKIFRDKNTLKEHMRKKRHRR  222 (423)
T ss_pred             HhhheeeeeccccCCcHHHHHHHHhccCcc
Confidence            567899999999999999999999876543


No 96 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=20.30  E-value=44  Score=23.08  Aligned_cols=14  Identities=21%  Similarity=0.608  Sum_probs=11.9

Q ss_pred             cccCCcCCCCccCc
Q 044541          209 SFPCKSCNRSFTTE  222 (237)
Q Consensus       209 py~CKsCgKtFsSe  222 (237)
                      -|+|..||..|...
T Consensus         2 ~Y~C~~Cg~~~~~~   15 (44)
T smart00659        2 IYICGECGRENEIK   15 (44)
T ss_pred             EEECCCCCCEeecC
Confidence            49999999988765


No 97 
>PLN02748 tRNA dimethylallyltransferase
Probab=20.27  E-value=44  Score=33.21  Aligned_cols=26  Identities=12%  Similarity=0.469  Sum_probs=22.7

Q ss_pred             CcccCCcCCC-CccCcccchhhhhhhc
Q 044541          208 GSFPCKSCNR-SFTTEGGLQSHTKAKH  233 (237)
Q Consensus       208 Gpy~CKsCgK-tFsSesaLqsH~Rahh  233 (237)
                      ..|.|..|++ +|..+.+-+.|.+.+.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr~  443 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGRG  443 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcchH
Confidence            6899999997 8999999999987653


No 98 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=20.16  E-value=72  Score=21.49  Aligned_cols=27  Identities=19%  Similarity=0.396  Sum_probs=18.0

Q ss_pred             CCcccCCcCCCCccCcc--cchhhhhhhc
Q 044541          207 GGSFPCKSCNRSFTTEG--GLQSHTKAKH  233 (237)
Q Consensus       207 gGpy~CKsCgKtFsSes--aLqsH~Rahh  233 (237)
                      .|.-.|+.||-.|+...  --..|.|-|.
T Consensus        11 ~~~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   11 FGATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            46789999998665443  3455666553


Done!