BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044545
         (191 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2DQW|A Chain A, Crystal Structure Of Dihydropteroate Synthase (Folp) From
           Thermus Thermophilus Hb8
 pdb|2DQW|B Chain B, Crystal Structure Of Dihydropteroate Synthase (Folp) From
           Thermus Thermophilus Hb8
 pdb|2DZA|A Chain A, Crystal Structure Of Dihydropteroate Synthase From Thermus
           Thermophilus Hb8 In Complex With 4-Aminobenzoate
 pdb|2DZA|B Chain B, Crystal Structure Of Dihydropteroate Synthase From Thermus
           Thermophilus Hb8 In Complex With 4-Aminobenzoate
 pdb|2DZB|A Chain A, Crystal Structure Of Dihydropteroate Synthase From Thermus
           Thermophilus Hb8 In Complex With 6hmppp
 pdb|2DZB|B Chain B, Crystal Structure Of Dihydropteroate Synthase From Thermus
           Thermophilus Hb8 In Complex With 6hmppp
          Length = 294

 Score = 30.4 bits (67), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 19/79 (24%)

Query: 46  AKPVDLEKINLLFFPTIQLNVTLGVVVTVDNR-----------------NYGGFKYQNGT 88
           A PV +E+      P ++  ++LGV V+VD R                 +  G + +   
Sbjct: 80  AAPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMV 139

Query: 89  AYVSYHGV--VVAEAPVED 105
           A  + HGV  VV   PV D
Sbjct: 140 ALAARHGVAAVVMHMPVPD 158


>pdb|1GDI|A Chain A, Crystal Structure Of Ferric Complexes Of The Yellow Lupin
           Leghemoglobin With Isoquinoline At 1.8 Angstroms
           Resolution (Russian)
 pdb|1GDJ|A Chain A, Crystal Structure Of Ferric Complexes Of The Yellow Lupin
           Leghemoglobin With Isoquinoline At 1.8 Angstroms
           Resolution (Russian)
 pdb|1GDK|A Chain A, Crystal Structure Of Ferric Complexes Of The Yellow Lupin
           Leghemoglobin With Isoquinoline At 1.8 Angstroms
           Resolution (Russian)
 pdb|1GDL|A Chain A, Crystal Structure Of Ferric Complexes Of The Yellow Lupin
           Leghemoglobin With Isoquinoline At 1.8 Angstroms
           Resolution (Russian)
 pdb|1LH1|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|1LH2|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|1LH3|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|1LH5|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|1LH6|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|1LH7|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|2GDM|A Chain A, Leghemoglobin (oxy)
 pdb|2LH1|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|2LH2|A Chain A, X-ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (russian)
 pdb|2LH3|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|2LH5|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|2LH6|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
 pdb|2LH7|A Chain A, X-Ray Structural Investigation Of Leghemoglobin. Vi.
           Structure Of Acetate-Ferrileghemoglobin At A Resolution
           Of 2.0 Angstroms (Russian)
          Length = 153

 Score = 26.9 bits (58), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 56  LLFFPTIQLNVTLGVVVT-VDNRNYGGFKYQNGTAYVSYHGVVVAEAPVEDGR--IPARG 112
           L++   IQL VT GVVVT    +N G      G A    H  VV EA ++  +  + A+ 
Sbjct: 70  LVYEAAIQLEVT-GVVVTDATLKNLGSVHVSKGVA--DAHFPVVKEAILKTIKEVVGAKW 126

Query: 113 KQNISSSLTIFADKL 127
            + ++S+ TI  D+L
Sbjct: 127 SEELNSAWTIAYDEL 141


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,749,921
Number of Sequences: 62578
Number of extensions: 175929
Number of successful extensions: 500
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 500
Number of HSP's gapped (non-prelim): 5
length of query: 191
length of database: 14,973,337
effective HSP length: 93
effective length of query: 98
effective length of database: 9,153,583
effective search space: 897051134
effective search space used: 897051134
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)