Query         044565
Match_columns 99
No_of_seqs    104 out of 173
Neff          5.0 
Searched_HMMs 46136
Date          Fri Mar 29 04:32:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044565.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044565hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08293 MRP-S33:  Mitochondria 100.0 2.4E-36 5.2E-41  201.5   7.6   79   10-88      1-87  (87)
  2 KOG4844 Mitochondrial ribosoma 100.0 2.5E-31 5.5E-36  180.4   6.9   93    7-99      2-102 (102)
  3 KOG4104 Ganglioside-induced di 100.0 7.6E-29 1.6E-33  170.2   5.9   92    6-98     10-113 (113)
  4 PF12752 SUZ:  SUZ domain;  Int  61.7     8.2 0.00018   23.5   2.2   16   10-25     42-57  (59)
  5 PF04844 Ovate:  Transcriptiona  36.4      43 0.00093   20.9   2.6   19   64-82      2-20  (59)
  6 PF07874 DUF1660:  Prophage pro  29.5      17 0.00036   23.3  -0.1   13   17-29      2-14  (64)
  7 PF14907 NTP_transf_5:  Unchara  29.0      34 0.00073   24.9   1.4   27   43-69     77-106 (249)
  8 PF06904 Extensin-like_C:  Exte  27.4      59  0.0013   24.2   2.5   26    8-33    132-157 (178)
  9 TIGR01568 A_thal_3678 uncharac  24.3      89  0.0019   19.9   2.5   20   63-82      7-26  (66)
 10 TIGR02682 cas_csx11 CRISPR-ass  17.3      75  0.0016   29.5   1.5   26    3-28    481-506 (918)

No 1  
>PF08293 MRP-S33:  Mitochondrial ribosomal subunit S27;  InterPro: IPR013219 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents a mitochondrial ribosomal subunit annotated as S27 in yeast and S33 in humans [, ]. It is a small 106 residue protein. The evolutionary history of the mitoribosomal proteome that is encoded by a diverse subset of eukaryotic genomes, reveals an ancestral ribosome of alpha-proteobacterial descent that more than doubled its protein content in most eukaryotic lineages. Several new MRPs have originated via duplication of existing MRPs as well as by recruitment from outside of the mitoribosomal proteome [].
Probab=100.00  E-value=2.4e-36  Score=201.47  Aligned_cols=79  Identities=47%  Similarity=0.654  Sum_probs=73.6

Q ss_pred             HHHHHHHHHHHhhhCcCCCCCCCCchhhHhhccccchhhhccCCCCCc--------ccCCCCcChHHHHHHHHHHHHHhc
Q 044565           10 IVTTGLTEARAKIFGHVLNLTGQRSPHKILRKKLIDDKVAGWYPYDIK--------KDDPLVMARQEQERLSKLEILKRR   81 (99)
Q Consensus        10 ~r~~~l~~ls~rIFg~~~nPt~~Rsg~kvlr~~lkg~~~~~YYP~~~~--------r~~g~~~De~e~~R~~~~~~~k~R   81 (99)
                      .|+++|++|||+|||+++|||++|||+|||+++|+|++|++|||+++.        ..+++|+||||++|+++++++++|
T Consensus         1 ~r~~~l~~ls~rIFg~~~nP~~~Rsg~Kilr~~lkg~~~~~YYP~~~~~~~~l~~l~~~~~~~De~e~~R~e~~~~rk~R   80 (87)
T PF08293_consen    1 NRLLRLARLSARIFGTVYNPTGSRSGNKILRKRLKGPKLASYYPPHIVTFKLLKRLRPDGLFRDEHEDFREEMVELRKRR   80 (87)
T ss_pred             CHHHHHHHHHHHHhCCCCCCccchHHHHHHhhcCCCchHhHhCCCcchHHHHHHHHccccCcCChhHHHHHHHHHHHHhC
Confidence            378999999999999999999999999999999999999999998763        344569999999999999999999


Q ss_pred             CCCCCCC
Q 044565           82 GKGPPKK   88 (99)
Q Consensus        82 GKg~PKK   88 (99)
                      |||+|||
T Consensus        81 GKg~PKK   87 (87)
T PF08293_consen   81 GKGPPKK   87 (87)
T ss_pred             CCCCCCC
Confidence            9999997


No 2  
>KOG4844 consensus Mitochondrial ribosomal protein S27 [Translation, ribosomal structure and biogenesis]
Probab=99.97  E-value=2.5e-31  Score=180.41  Aligned_cols=93  Identities=59%  Similarity=0.807  Sum_probs=85.3

Q ss_pred             ch-HHHHHHHHHHHHhhhCcCCCCCCCCchhhHhhccccchhhhccCCCCC-cccCC------CCcChHHHHHHHHHHHH
Q 044565            7 FA-TIVTTGLTEARAKIFGHVLNLTGQRSPHKILRKKLIDDKVAGWYPYDI-KKDDP------LVMARQEQERLSKLEIL   78 (99)
Q Consensus         7 ~s-~~r~~~l~~ls~rIFg~~~nPt~~Rsg~kvlr~~lkg~~~~~YYP~~~-~r~~g------~~~De~e~~R~~~~~~~   78 (99)
                      .| +|+++.++.||++||||.||||++|||+|||+++|+|+.|++|||+.+ ++.++      .|.|-+|+.|+++++++
T Consensus         2 as~kAvl~~v~elsakIFg~~~np~g~Rtg~Kil~~~LkG~kvasyYp~~~~~r~l~tll~d~ef~d~~e~~R~s~~e~~   81 (102)
T KOG4844|consen    2 ASGKAVLRGVTELSAKIFGHMLNPTGQRTGHKILRKKLKGDKVASYYPPYDIKRELPTLLADEEFDDIAEWGRISKLEML   81 (102)
T ss_pred             cchHHHHHHHHHHHHHHHhcccCCCCCcchhHHHHHHhccchHhhhcchHHhhhhhhhhhcccccccHHHHHHHHHHHHH
Confidence            44 899999999999999999999999999999999999999999999854 46555      28889999999999999


Q ss_pred             HhcCCCCCCCCCchhHhhhcC
Q 044565           79 KRRGKGPPKKGQGRRAAKRSK   99 (99)
Q Consensus        79 k~RGKg~PKKg~gkra~kkk~   99 (99)
                      ++||||+|||+++++|.+.++
T Consensus        82 kRrgKGapKk~kk~~aa~~~~  102 (102)
T KOG4844|consen   82 KRRGKGAPKKGKKKRAAKRNK  102 (102)
T ss_pred             HHccCCCCcccchhhhhhccC
Confidence            999999999999999998764


No 3  
>KOG4104 consensus Ganglioside-induced differentiation associated protein 3 [Signal transduction mechanisms]
Probab=99.95  E-value=7.6e-29  Score=170.24  Aligned_cols=92  Identities=25%  Similarity=0.413  Sum_probs=83.9

Q ss_pred             cchHHHHHHHHHHHHhhhCcCCCCCCCCchhhH--hhccc--cchhhhccCCCCCc--------ccCCCCcChHHHHHHH
Q 044565            6 FFATIVTTGLTEARAKIFGHVLNLTGQRSPHKI--LRKKL--IDDKVAGWYPYDIK--------KDDPLVMARQEQERLS   73 (99)
Q Consensus         6 ~~s~~r~~~l~~ls~rIFg~~~nPt~~Rsg~kv--lr~~l--kg~~~~~YYP~~~~--------r~~g~~~De~e~~R~~   73 (99)
                      .||. +..+|++||++|||+|.+|||.+|+++|  ||+.|  +-+++.+|||++..        |++|+|+|||++|+.+
T Consensus        10 ~~t~-ya~RM~rLSnRvfGEV~rpTn~KSmKVVr~fSeeP~~kk~~~~~wYPnh~~~h~Lmk~LRf~GLfrDeHqdF~de   88 (113)
T KOG4104|consen   10 QPTP-YAKRMDRLSNRVFGEVVRPTNTKSMKVVRVFSEEPYEKKEQLSKWYPNHPMFHYLMKMLRFHGLFRDEHQDFRDE   88 (113)
T ss_pred             CccH-HHHHHHHHHHHHHhhccccCCCcceehhhhccccchhhHHHHHHhccCchHHHHHHHHHHHhhhhhhhHHHHHHH
Confidence            3444 7889999999999999999999999976  99999  56889999999642        9999999999999999


Q ss_pred             HHHHHHhcCCCCCCCCCchhHhhhc
Q 044565           74 KLEILKRRGKGPPKKGQGRRAAKRS   98 (99)
Q Consensus        74 ~~~~~k~RGKg~PKKg~gkra~kkk   98 (99)
                      +.+++++|||.+||||+||||++++
T Consensus        89 qkrLkklRGK~~PkkGeGKRA~kr~  113 (113)
T KOG4104|consen   89 QKRLKKLRGKVVPKKGEGKRAQKRG  113 (113)
T ss_pred             HHHHHHhcCCCCCCCCcchhhhhcC
Confidence            9999999999999999999999864


No 4  
>PF12752 SUZ:  SUZ domain;  InterPro: IPR024771 The SUZ domain is a conserved RNA-binding domain found in eukaryotes and enriched in positively charged amino acids. It was first characterised in the Caenorhabditis elegans protein SZY-20 where it has been shown to bind RNA and allow their localization to the centrosome [].
Probab=61.71  E-value=8.2  Score=23.54  Aligned_cols=16  Identities=44%  Similarity=0.601  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHhhhCc
Q 044565           10 IVTTGLTEARAKIFGH   25 (99)
Q Consensus        10 ~r~~~l~~ls~rIFg~   25 (99)
                      +|-..-+++++||||.
T Consensus        42 ERE~eY~~AR~RIFg~   57 (59)
T PF12752_consen   42 EREAEYAEARARIFGS   57 (59)
T ss_pred             HHHHHHHHHHHHHhCC
Confidence            5667778999999996


No 5  
>PF04844 Ovate:  Transcriptional repressor, ovate;  InterPro: IPR006458  This group of sequences contain an uncharacterised domain of about 70 residues found exclusively in plants, generally toward the C terminus of proteins of 200 to 350 amino acids in length. At least 14 such proteins are found in Arabidopsis thaliana (Mouse-ear cress). Other regions of these proteins tend to consist largely of low-complexity sequence. Function is not known. 
Probab=36.43  E-value=43  Score=20.88  Aligned_cols=19  Identities=26%  Similarity=0.321  Sum_probs=16.2

Q ss_pred             cChHHHHHHHHHHHHHhcC
Q 044565           64 MARQEQERLSKLEILKRRG   82 (99)
Q Consensus        64 ~De~e~~R~~~~~~~k~RG   82 (99)
                      .||.+|||..|+++-..+|
T Consensus         2 ~DP~~DFr~SM~EMI~~~~   20 (59)
T PF04844_consen    2 SDPYEDFRESMVEMIEENG   20 (59)
T ss_pred             CCHHHHHHHHHHHHHHHcC
Confidence            4899999999999877665


No 6  
>PF07874 DUF1660:  Prophage protein (DUF1660);  InterPro: IPR012455 This entry is represented by Bacteriophage bIL285, Orf33. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=29.54  E-value=17  Score=23.28  Aligned_cols=13  Identities=31%  Similarity=0.629  Sum_probs=11.0

Q ss_pred             HHHHhhhCcCCCC
Q 044565           17 EARAKIFGHVLNL   29 (99)
Q Consensus        17 ~ls~rIFg~~~nP   29 (99)
                      .|-|+||||.+-+
T Consensus         2 KL~CKLFGHKw~~   14 (64)
T PF07874_consen    2 KLMCKLFGHKWTF   14 (64)
T ss_pred             cchhhhcCCCCCC
Confidence            5889999998874


No 7  
>PF14907 NTP_transf_5:  Uncharacterised nucleotidyltransferase
Probab=28.98  E-value=34  Score=24.94  Aligned_cols=27  Identities=15%  Similarity=0.102  Sum_probs=19.3

Q ss_pred             ccchhhhccCCCCCcccCCC---CcChHHH
Q 044565           43 LIDDKVAGWYPYDIKKDDPL---VMARQEQ   69 (99)
Q Consensus        43 lkg~~~~~YYP~~~~r~~g~---~~De~e~   69 (99)
                      +||..++.+||..-.|..++   ++.+++.
T Consensus        77 lKG~~l~~~Y~~~~~R~~~DiDlLV~~~d~  106 (249)
T PF14907_consen   77 LKGAALAQLYPDPGLRPMGDIDLLVPPEDL  106 (249)
T ss_pred             EchHHHHHhCCCCCCCCCCCeEEEEeCCcH
Confidence            48999999999865577764   5554443


No 8  
>PF06904 Extensin-like_C:  Extensin-like protein C-terminus;  InterPro: IPR009683 This entry represents the C terminus (approx. 120 residues) of a number of bacterial extensin-like proteins. Extensins are cell wall glycoproteins normally associated with plants, where they strengthen the cell wall in response to mechanical stress []. Many proteins in this entry are hypothetical.
Probab=27.43  E-value=59  Score=24.24  Aligned_cols=26  Identities=15%  Similarity=0.160  Sum_probs=21.5

Q ss_pred             hHHHHHHHHHHHHhhhCcCCCCCCCC
Q 044565            8 ATIVTTGLTEARAKIFGHVLNLTGQR   33 (99)
Q Consensus         8 s~~r~~~l~~ls~rIFg~~~nPt~~R   33 (99)
                      ..+-|..|....|..|++|..|..-.
T Consensus       132 ~~~fl~~v~~~AC~~F~tVLgP~~na  157 (178)
T PF06904_consen  132 EAAFLRAVRAGACGRFGTVLGPDYNA  157 (178)
T ss_pred             HHHHHHHHHHHHHhcCCcccCCCCch
Confidence            45668888999999999999987644


No 9  
>TIGR01568 A_thal_3678 uncharacterized plant-specific domain TIGR01568. This model describes an uncharacterized domain of about 70 residues found exclusively in plants, generally toward the C-terminus of proteins of 200 to 350 amino acids in length. At least 14 such proteins are found in Arabidopsis thaliana. Other regions of these proteins tend to consist largely of low-complexity sequence.
Probab=24.28  E-value=89  Score=19.93  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=17.1

Q ss_pred             CcChHHHHHHHHHHHHHhcC
Q 044565           63 VMARQEQERLSKLEILKRRG   82 (99)
Q Consensus        63 ~~De~e~~R~~~~~~~k~RG   82 (99)
                      -.||.+|||..|+++-..+|
T Consensus         7 S~DPy~DFr~SM~EMI~~~~   26 (66)
T TIGR01568         7 SDDPYEDFRRSMEEMIEERE   26 (66)
T ss_pred             CCChHHHHHHHHHHHHHHcC
Confidence            35999999999999988775


No 10 
>TIGR02682 cas_csx11 CRISPR-associated protein, Csx11 family. Members of this uncommon, sporadically distributed protein family are large (900 amino acids) and strictly associated, so far, with CRISPR-associated (Cas) gene clusters. Nearby Cas genes always include members of the RAMP superfamily and the six-gene CRISPR-associated RAMP module. Species in which it is found, so far, include three archaea (Methanosarcina mazei, M. barkeri and Methanobacterium thermoautotrophicum) and two bacteria (Thermodesulfovibrio yellowstonii DSM 11347 and Sulfurihydrogenibium azorense).
Probab=17.29  E-value=75  Score=29.54  Aligned_cols=26  Identities=15%  Similarity=0.153  Sum_probs=22.6

Q ss_pred             ccccchHHHHHHHHHHHHhhhCcCCC
Q 044565            3 LRTFFATIVTTGLTEARAKIFGHVLN   28 (99)
Q Consensus         3 ~~~~~s~~r~~~l~~ls~rIFg~~~n   28 (99)
                      +++-||+|||.++-+.-..-|.++.+
T Consensus       481 ~rKnPSpARLrRIWeTT~eFf~~v~~  506 (918)
T TIGR02682       481 FRKNPSPARLRRIWETTENFFEEILI  506 (918)
T ss_pred             hcCCCChHHHHHHHHHHHHHHHHHHH
Confidence            57899999999999999998887654


Done!