BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044596
         (644 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2J68|A Chain A, Bacterial Dynamin-Like Protein Bdlp, Gdp Bound
 pdb|2J69|A Chain A, Bacterial Dynamin-like Protein Bdlp
 pdb|2J69|B Chain B, Bacterial Dynamin-like Protein Bdlp
 pdb|2J69|C Chain C, Bacterial Dynamin-like Protein Bdlp
 pdb|2J69|D Chain D, Bacterial Dynamin-like Protein Bdlp
 pdb|2W6D|A Chain A, Bacterial Dynamin-Like Protein Lipid Tube Bound
 pdb|2W6D|B Chain B, Bacterial Dynamin-Like Protein Lipid Tube Bound
          Length = 695

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 250 ESFSSYGKN-GNGLPNEFMSYAKESNVIQSNFTSYG--EAGNAA-NDTFKSYGSD 300
           ESF SY  N GN   N+F+ Y  E N+   +F S G  EA NAA    F+ Y +D
Sbjct: 402 ESFRSYVLNLGNTFENDFLRYQPELNLF--DFLSSGKREAFNAALQKAFEQYITD 454


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.129    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,123,720
Number of Sequences: 62578
Number of extensions: 814640
Number of successful extensions: 1276
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 13
Number of HSP's that attempted gapping in prelim test: 1217
Number of HSP's gapped (non-prelim): 42
length of query: 644
length of database: 14,973,337
effective HSP length: 105
effective length of query: 539
effective length of database: 8,402,647
effective search space: 4529026733
effective search space used: 4529026733
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)