Query         044606
Match_columns 413
No_of_seqs    322 out of 3649
Neff          8.5 
Searched_HMMs 46136
Date          Fri Mar 29 04:58:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044606.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044606hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074 Transcriptional repres  99.9 1.2E-23 2.7E-28  212.9  10.6   92  273-366   602-700 (958)
  2 KOG2462 C2H2-type Zn-finger pr  99.9 3.6E-24 7.9E-29  193.4   4.2   90  263-356   176-265 (279)
  3 KOG2462 C2H2-type Zn-finger pr  99.8 1.8E-19 3.9E-24  163.1   3.6  109  249-361   131-242 (279)
  4 KOG1074 Transcriptional repres  99.7 2.7E-18 5.8E-23  174.5   6.1   61    4-75    328-388 (958)
  5 KOG3623 Homeobox transcription  99.5 4.5E-15 9.7E-20  148.9   0.3   83  271-355   889-971 (1007)
  6 KOG3576 Ovo and related transc  99.5 6.9E-15 1.5E-19  126.9   0.8   87  271-359   112-198 (267)
  7 KOG3623 Homeobox transcription  99.2   2E-12 4.3E-17  130.1   2.0  105  250-356   212-331 (1007)
  8 KOG3576 Ovo and related transc  99.2 1.7E-12 3.6E-17  112.3  -0.8  112  248-361   117-239 (267)
  9 KOG3608 Zn finger proteins [Ge  99.2 5.9E-12 1.3E-16  117.3   0.9  104  257-361   272-379 (467)
 10 KOG3608 Zn finger proteins [Ge  99.1 1.8E-11 3.8E-16  114.2   2.7  111  249-364   238-351 (467)
 11 PHA00733 hypothetical protein   98.9 4.5E-10 9.8E-15   93.6   2.3   95  261-359    25-124 (128)
 12 PHA02768 hypothetical protein;  98.6   2E-08 4.4E-13   69.5   2.2   37  276-314     5-41  (55)
 13 PHA00616 hypothetical protein   98.5 3.1E-08 6.6E-13   65.2   1.4   31   40-70      1-31  (44)
 14 PHA02768 hypothetical protein;  98.5 5.5E-08 1.2E-12   67.3   1.3   45  304-352     5-49  (55)
 15 PF00096 zf-C2H2:  Zinc finger,  98.4 1.3E-07 2.8E-12   54.2   1.3   23   41-63      1-23  (23)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.4 5.6E-08 1.2E-12   57.4  -0.4   23  292-314     2-24  (26)
 17 PLN03086 PRLI-interacting fact  98.3 4.6E-07 9.9E-12   92.5   4.5   62  276-344   453-514 (567)
 18 PLN03086 PRLI-interacting fact  98.2 8.3E-07 1.8E-11   90.6   3.8   99  251-356   456-562 (567)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.2 5.8E-07 1.2E-11   53.0   1.2   25  322-346     2-26  (26)
 20 KOG3993 Transcription factor (  98.1 1.5E-06 3.3E-11   83.5   1.8   39   27-65    282-320 (500)
 21 PHA00616 hypothetical protein   98.0 1.4E-06 3.1E-11   57.4   0.8   34  276-309     1-34  (44)
 22 PHA00732 hypothetical protein   98.0 3.8E-06 8.2E-11   63.7   2.9   36  276-314     1-37  (79)
 23 PF13894 zf-C2H2_4:  C2H2-type   98.0 3.3E-06 7.2E-11   48.5   1.6   24   41-64      1-24  (24)
 24 KOG3993 Transcription factor (  98.0 1.1E-06 2.3E-11   84.6  -0.9  116  248-364   267-386 (500)
 25 PHA00733 hypothetical protein   97.9 1.1E-05 2.3E-10   67.4   3.2   59  264-327    62-120 (128)
 26 PF13912 zf-C2H2_6:  C2H2-type   97.8 9.4E-06   2E-10   48.3   1.0   26   40-65      1-26  (27)
 27 COG5189 SFP1 Putative transcri  97.7 2.2E-05 4.8E-10   73.0   3.2   71  273-355   346-419 (423)
 28 PF09237 GAGA:  GAGA factor;  I  97.7 2.3E-05 4.9E-10   52.8   2.1   36   33-68     17-52  (54)
 29 smart00355 ZnF_C2H2 zinc finge  97.6   3E-05 6.6E-10   45.1   2.0   25   41-65      1-25  (26)
 30 PF00096 zf-C2H2:  Zinc finger,  97.6 8.9E-06 1.9E-10   46.4  -0.7   23  335-357     1-23  (23)
 31 PF12874 zf-met:  Zinc-finger o  97.4 6.5E-05 1.4E-09   43.7   0.9   24   41-64      1-24  (25)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.3 6.5E-05 1.4E-09   44.6   0.2   26  334-359     1-26  (27)
 33 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 0.00011 2.3E-09   43.7   0.7   24   40-63      1-24  (27)
 34 PF05605 zf-Di19:  Drought indu  97.2 0.00017 3.8E-09   50.6   1.7   51  276-358     2-53  (54)
 35 PF13894 zf-C2H2_4:  C2H2-type   97.2 7.3E-05 1.6E-09   42.7  -0.3   24  335-358     1-24  (24)
 36 PHA00732 hypothetical protein   96.8  0.0006 1.3E-08   51.7   1.8   26   40-65      1-27  (79)
 37 PF12756 zf-C2H2_2:  C2H2 type   96.7  0.0004 8.7E-09   54.9   0.2   74  278-358     1-74  (100)
 38 PF13913 zf-C2HC_2:  zinc-finge  96.7 0.00089 1.9E-08   38.9   1.5   21   41-62      3-23  (25)
 39 smart00355 ZnF_C2H2 zinc finge  96.4 0.00083 1.8E-08   38.8   0.2   24  335-358     1-24  (26)
 40 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0024 5.3E-08   36.6   1.4   24   41-65      1-24  (24)
 41 PF09237 GAGA:  GAGA factor;  I  95.8  0.0053 1.1E-07   41.6   1.6   34  271-304    19-52  (54)
 42 PF12874 zf-met:  Zinc-finger o  95.5  0.0032   7E-08   36.4  -0.2   23  335-357     1-23  (25)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5  0.0074 1.6E-07   35.6   1.3   23  335-357     2-24  (27)
 44 PRK04860 hypothetical protein;  95.4  0.0077 1.7E-07   52.2   1.6   35  276-314   119-153 (160)
 45 PF12756 zf-C2H2_2:  C2H2 type   95.1   0.011 2.5E-07   46.4   1.7   25   40-64     50-74  (100)
 46 PRK04860 hypothetical protein;  95.1  0.0075 1.6E-07   52.2   0.6   40  303-348   118-157 (160)
 47 smart00451 ZnF_U1 U1-like zinc  95.1   0.013 2.9E-07   36.7   1.6   25   39-63      2-26  (35)
 48 PF13909 zf-H2C2_5:  C2H2-type   94.1  0.0099 2.1E-07   34.0  -0.6   24  335-359     1-24  (24)
 49 KOG2893 Zn finger protein [Gen  92.2   0.053 1.1E-06   48.9   0.7   47  278-358    12-59  (341)
 50 PF13913 zf-C2HC_2:  zinc-finge  91.8   0.053 1.1E-06   31.4   0.1   21  335-356     3-23  (25)
 51 COG5048 FOG: Zn-finger [Genera  91.1    0.28 6.1E-06   48.9   4.7   71  275-347   288-366 (467)
 52 COG5048 FOG: Zn-finger [Genera  90.7     0.2 4.3E-06   50.0   3.1   61  251-311   292-358 (467)
 53 PF05605 zf-Di19:  Drought indu  90.0    0.29 6.3E-06   34.1   2.6   25   40-65      2-27  (54)
 54 PF02892 zf-BED:  BED zinc fing  89.9    0.14 3.1E-06   34.0   0.9   28   36-63     12-44  (45)
 55 KOG1146 Homeobox protein [Gene  88.7    0.15 3.3E-06   56.6   0.6   78  273-356   462-540 (1406)
 56 smart00614 ZnF_BED BED zinc fi  88.0    0.26 5.6E-06   33.7   1.2   26   39-64     17-48  (50)
 57 smart00451 ZnF_U1 U1-like zinc  87.8    0.32   7E-06   30.2   1.4   24  275-298     2-25  (35)
 58 KOG2231 Predicted E3 ubiquitin  87.5    0.58 1.3E-05   49.2   3.8   98  253-358   187-301 (669)
 59 KOG2893 Zn finger protein [Gen  86.1    0.22 4.7E-06   45.1  -0.1   46   20-65     11-60  (341)
 60 smart00734 ZnF_Rad18 Rad18-lik  85.3    0.58 1.3E-05   27.3   1.4   20   42-62      3-22  (26)
 61 PF09538 FYDLN_acid:  Protein o  83.2    0.79 1.7E-05   36.9   1.9   30  305-347    10-39  (108)
 62 PF05443 ROS_MUCR:  ROS/MUCR tr  80.6    0.67 1.5E-05   38.7   0.7   25   41-68     73-97  (132)
 63 COG5189 SFP1 Putative transcri  77.0    0.88 1.9E-05   43.1   0.3   25  273-297   395-419 (423)
 64 cd00350 rubredoxin_like Rubred  76.7     1.6 3.6E-05   26.9   1.4   10  277-286     2-11  (33)
 65 KOG2231 Predicted E3 ubiquitin  76.6     1.5 3.1E-05   46.4   1.8   16  343-358   221-236 (669)
 66 COG4957 Predicted transcriptio  75.8     1.3 2.8E-05   36.6   1.0   25   42-69     78-102 (148)
 67 KOG4167 Predicted DNA-binding   75.6    0.62 1.3E-05   48.8  -1.1   28   38-65    790-817 (907)
 68 COG1198 PriA Primosomal protei  75.3     1.7 3.6E-05   46.8   1.9   49  277-343   436-484 (730)
 69 PRK00464 nrdR transcriptional   75.2     1.4   3E-05   37.9   1.1   20  334-353    28-47  (154)
 70 TIGR02300 FYDLN_acid conserved  74.4     2.4 5.3E-05   34.8   2.2   34  305-351    10-43  (129)
 71 PF04959 ARS2:  Arsenite-resist  73.9     1.6 3.4E-05   39.7   1.1   38   28-65     65-102 (214)
 72 PF09986 DUF2225:  Uncharacteri  73.7     1.5 3.2E-05   40.0   1.0   24  274-297     3-26  (214)
 73 KOG1146 Homeobox protein [Gene  73.3     0.9 1.9E-05   50.9  -0.7   82  276-362  1260-1356(1406)
 74 TIGR00622 ssl1 transcription f  71.3     6.2 0.00013   31.9   3.8   81  274-358    13-105 (112)
 75 COG4049 Uncharacterized protei  70.4    0.91   2E-05   31.4  -0.9   31  328-358    11-41  (65)
 76 COG3677 Transposase and inacti  68.7     2.4 5.2E-05   35.4   1.0   26   28-53     41-66  (129)
 77 COG1592 Rubrerythrin [Energy p  68.4       3 6.5E-05   36.3   1.6   10  332-341   147-156 (166)
 78 cd00729 rubredoxin_SM Rubredox  68.4     3.5 7.6E-05   25.7   1.5   10  333-342    17-26  (34)
 79 PF12013 DUF3505:  Protein of u  68.0     3.2 6.9E-05   33.4   1.6   25   41-65     81-109 (109)
 80 TIGR00595 priA primosomal prot  65.3     3.4 7.5E-05   42.9   1.6   48  278-343   215-262 (505)
 81 KOG2593 Transcription initiati  65.1     3.4 7.4E-05   41.0   1.5   50    5-58     76-146 (436)
 82 KOG2482 Predicted C2H2-type Zn  64.8     3.2   7E-05   39.8   1.2   74  277-358   280-358 (423)
 83 PRK00398 rpoP DNA-directed RNA  61.8     5.4 0.00012   26.6   1.6   11  334-344    21-31  (46)
 84 PRK00464 nrdR transcriptional   61.6     3.5 7.6E-05   35.5   0.7   42  277-318     1-42  (154)
 85 PRK14873 primosome assembly pr  60.7     4.2 9.1E-05   43.6   1.3   47  278-343   385-431 (665)
 86 PRK14890 putative Zn-ribbon RN  60.6     4.4 9.6E-05   28.6   1.0   11  332-342    46-56  (59)
 87 PF14353 CpXC:  CpXC protein     59.8       4 8.6E-05   33.8   0.8   25  334-358    38-62  (128)
 88 PF10571 UPF0547:  Uncharacteri  59.8     6.7 0.00015   22.9   1.5   12  334-345    14-25  (26)
 89 COG1997 RPL43A Ribosomal prote  58.5     6.3 0.00014   30.1   1.5   14  334-347    53-66  (89)
 90 TIGR00373 conserved hypothetic  58.3     5.5 0.00012   34.5   1.4   18  275-292   108-125 (158)
 91 KOG2071 mRNA cleavage and poly  56.9     5.8 0.00012   41.1   1.5   31   35-65    413-443 (579)
 92 PRK06266 transcription initiat  56.2     6.3 0.00014   34.8   1.5   16  276-291   117-132 (178)
 93 KOG4124 Putative transcription  55.5     6.1 0.00013   38.1   1.3   70  274-355   347-419 (442)
 94 COG5236 Uncharacterized conser  54.6     5.6 0.00012   38.2   0.9   87  262-356   167-273 (493)
 95 PRK09678 DNA-binding transcrip  54.0     5.5 0.00012   29.5   0.6   19  332-350    25-45  (72)
 96 KOG2186 Cell growth-regulating  53.6     4.7  0.0001   37.2   0.2   37  277-315     4-40  (276)
 97 PF09723 Zn-ribbon_8:  Zinc rib  53.6     7.2 0.00016   25.5   1.1    9  334-342    26-34  (42)
 98 TIGR02605 CxxC_CxxC_SSSS putat  53.3     6.1 0.00013   27.0   0.7   11  277-287     6-16  (52)
 99 smart00834 CxxC_CXXC_SSSS Puta  52.4     6.6 0.00014   25.1   0.7    9  334-342    26-34  (41)
100 COG4049 Uncharacterized protei  52.4     5.6 0.00012   27.6   0.4   29  272-300    13-41  (65)
101 PF09538 FYDLN_acid:  Protein o  52.2     6.2 0.00013   31.8   0.7   15   38-52      7-21  (108)
102 PF09986 DUF2225:  Uncharacteri  52.2     3.2   7E-05   37.8  -1.1   27   39-65      4-31  (214)
103 smart00531 TFIIE Transcription  52.0      13 0.00029   31.6   2.7   19  273-291    96-114 (147)
104 PF05443 ROS_MUCR:  ROS/MUCR tr  50.9     4.2   9E-05   34.0  -0.5   26  332-360    70-95  (132)
105 PRK05580 primosome assembly pr  49.2     8.8 0.00019   41.4   1.5   49  277-343   382-430 (679)
106 COG1592 Rubrerythrin [Energy p  49.2      11 0.00023   32.9   1.7   25  275-312   133-157 (166)
107 KOG0978 E3 ubiquitin ligase in  48.1     9.1  0.0002   40.8   1.3   22  333-354   677-698 (698)
108 PF10013 DUF2256:  Uncharacteri  47.7     9.6 0.00021   24.9   0.9   17   41-57      9-25  (42)
109 TIGR00373 conserved hypothetic  47.5      17 0.00037   31.4   2.7   44  291-345    96-139 (158)
110 KOG3214 Uncharacterized Zn rib  47.2     8.6 0.00019   30.1   0.7   41   15-55     22-62  (109)
111 COG2888 Predicted Zn-ribbon RN  47.1     7.3 0.00016   27.5   0.3   11  332-342    48-58  (61)
112 TIGR02098 MJ0042_CXXC MJ0042 f  46.5      13 0.00029   23.4   1.5   12  334-345    25-36  (38)
113 PF05290 Baculo_IE-1:  Baculovi  46.3      12 0.00026   31.1   1.5   61  272-349    76-136 (140)
114 COG4530 Uncharacterized protei  46.2      12 0.00026   29.8   1.4   14  332-345    24-37  (129)
115 KOG2186 Cell growth-regulating  46.0     9.7 0.00021   35.2   1.0   20  333-353    28-47  (276)
116 smart00531 TFIIE Transcription  45.8      12 0.00027   31.8   1.6   41  299-345    94-134 (147)
117 PHA00626 hypothetical protein   45.3     9.7 0.00021   26.5   0.7   18   37-54     20-37  (59)
118 PF13719 zinc_ribbon_5:  zinc-r  44.6      11 0.00024   23.8   0.9   14  332-345    23-36  (37)
119 PF04216 FdhE:  Protein involve  44.2     5.7 0.00012   38.0  -0.8   36  277-315   173-208 (290)
120 TIGR02300 FYDLN_acid conserved  44.0      10 0.00022   31.3   0.7   15   38-52      7-21  (129)
121 PRK03564 formate dehydrogenase  43.7      18  0.0004   34.8   2.6   39  274-315   185-223 (309)
122 COG1773 Rubredoxin [Energy pro  43.6     8.9 0.00019   26.7   0.3   13   38-50      1-13  (55)
123 PRK06266 transcription initiat  42.5      21 0.00045   31.5   2.6   45  291-346   104-148 (178)
124 PF04780 DUF629:  Protein of un  42.0      14 0.00031   37.5   1.6   25   42-66     59-84  (466)
125 PF04423 Rad50_zn_hook:  Rad50   41.8     8.6 0.00019   26.6   0.0   14   42-55     22-35  (54)
126 PF01363 FYVE:  FYVE zinc finge  41.8      15 0.00032   26.6   1.3   13  333-345    24-36  (69)
127 PF06524 NOA36:  NOA36 protein;  41.6      22 0.00048   33.0   2.6   88  272-360   138-235 (314)
128 PF14447 Prok-RING_4:  Prokaryo  40.7      12 0.00026   26.1   0.6   17   37-53     35-52  (55)
129 smart00659 RPOLCX RNA polymera  40.7      19 0.00042   23.8   1.6   11  277-287     3-13  (44)
130 PF01780 Ribosomal_L37ae:  Ribo  40.0      13 0.00028   28.8   0.7   12   38-49     33-44  (90)
131 PF09845 DUF2072:  Zn-ribbon co  39.2      14 0.00031   30.6   0.9   15   40-54      1-15  (131)
132 PRK01343 zinc-binding protein;  38.9      16 0.00034   25.8   0.9   14   39-52      8-21  (57)
133 PF13717 zinc_ribbon_4:  zinc-r  37.9      18  0.0004   22.7   1.1   12  333-344    24-35  (36)
134 KOG0320 Predicted E3 ubiquitin  37.7      16 0.00035   32.0   1.0   55  272-348   127-181 (187)
135 PF03604 DNA_RNApol_7kD:  DNA d  37.4      27 0.00058   21.5   1.7    9  334-342    17-25  (32)
136 PF08790 zf-LYAR:  LYAR-type C2  37.1      12 0.00025   22.3   0.1   19   41-60      1-19  (28)
137 PF12013 DUF3505:  Protein of u  37.1      11 0.00025   30.1   0.0   25  335-359    81-109 (109)
138 PF10276 zf-CHCC:  Zinc-finger   36.4      11 0.00025   24.4  -0.1   11   40-50     29-39  (40)
139 KOG0717 Molecular chaperone (D  36.2      17 0.00037   36.6   1.1   22   41-62    293-314 (508)
140 PF15135 UPF0515:  Uncharacteri  35.9      29 0.00063   32.0   2.4   13  274-286   110-122 (278)
141 PF12230 PRP21_like_P:  Pre-mRN  35.9      12 0.00026   34.4   0.0   33   37-70    165-197 (229)
142 smart00154 ZnF_AN1 AN1-like Zi  35.7      17 0.00036   23.4   0.6   14   40-53     12-25  (39)
143 COG3357 Predicted transcriptio  35.5      23  0.0005   27.3   1.4   13  275-287    57-69  (97)
144 KOG3408 U1-like Zn-finger-cont  35.5      17 0.00036   29.7   0.7   29   37-65     54-84  (129)
145 PF06220 zf-U1:  U1 zinc finger  35.5      21 0.00046   22.8   1.1   24   38-61      1-26  (38)
146 PF07754 DUF1610:  Domain of un  34.3      18 0.00038   20.7   0.5   11   38-48     14-24  (24)
147 COG1996 RPC10 DNA-directed RNA  34.3      20 0.00042   24.4   0.8   11  276-286     6-16  (49)
148 TIGR00280 L37a ribosomal prote  34.3      18  0.0004   28.0   0.8   12   38-49     33-44  (91)
149 cd00065 FYVE FYVE domain; Zinc  33.9      27  0.0006   24.0   1.6   14  333-346    17-30  (57)
150 PTZ00255 60S ribosomal protein  33.5      19 0.00041   27.9   0.7   11   38-48     34-44  (90)
151 PF14787 zf-CCHC_5:  GAG-polypr  33.5      22 0.00048   22.4   0.9   16   41-56      3-18  (36)
152 COG4391 Uncharacterized protei  33.5      15 0.00032   26.1   0.1   11   42-52     50-60  (62)
153 KOG2785 C2H2-type Zn-finger pr  33.4      14 0.00031   36.2   0.0   79  276-356     3-90  (390)
154 COG3364 Zn-ribbon containing p  33.2      21 0.00045   28.2   0.9   17   40-56      2-18  (112)
155 COG4338 Uncharacterized protei  32.7      15 0.00033   24.6   0.1   17   41-57     13-29  (54)
156 PF09845 DUF2072:  Zn-ribbon co  32.0      22 0.00048   29.5   0.9   11  304-314     1-11  (131)
157 PRK03976 rpl37ae 50S ribosomal  31.8      21 0.00045   27.7   0.7   12   38-49     34-45  (90)
158 PRK12496 hypothetical protein;  31.0      27 0.00058   30.4   1.4   11  304-314   127-137 (164)
159 smart00064 FYVE Protein presen  30.8      31 0.00068   24.8   1.5   10  278-287    12-21  (68)
160 COG3677 Transposase and inacti  30.5      29 0.00064   28.9   1.5   13  303-315    52-64  (129)
161 KOG4377 Zn-finger protein [Gen  30.5      31 0.00068   34.2   1.8   85  277-364   314-433 (480)
162 PRK04023 DNA polymerase II lar  30.0      36 0.00078   37.9   2.3   11  275-285   625-635 (1121)
163 COG4957 Predicted transcriptio  29.4      24 0.00051   29.4   0.7   25  277-304    77-101 (148)
164 PRK03824 hypA hydrogenase nick  29.4      28 0.00061   29.2   1.2   16  274-289    68-83  (135)
165 PF07295 DUF1451:  Protein of u  29.1      39 0.00085   28.8   2.0    9  334-342   130-138 (146)
166 KOG1842 FYVE finger-containing  28.8      23  0.0005   35.5   0.6   32   34-65      9-41  (505)
167 KOG2071 mRNA cleavage and poly  28.1      24 0.00053   36.7   0.7   29  331-359   415-443 (579)
168 PHA02446 hypothetical protein   27.6      35 0.00075   27.6   1.3   45    4-49     27-71  (166)
169 PF04959 ARS2:  Arsenite-resist  27.1      13 0.00027   33.9  -1.4   28  332-359    75-102 (214)
170 KOG0402 60S ribosomal protein   27.0      21 0.00045   27.0  -0.0   12   38-49     34-45  (92)
171 COG5236 Uncharacterized conser  26.6      25 0.00054   34.0   0.4   75  277-359   221-306 (493)
172 KOG4173 Alpha-SNAP protein [In  26.3      12 0.00025   33.5  -1.7   21  277-297   107-127 (253)
173 TIGR01562 FdhE formate dehydro  26.3      51  0.0011   31.8   2.4   37  276-314   184-220 (305)
174 PTZ00448 hypothetical protein;  26.2      49  0.0011   32.5   2.3   24   39-62    313-336 (373)
175 PF01927 Mut7-C:  Mut7-C RNAse   26.1      37 0.00081   28.8   1.4   21  332-352   122-142 (147)
176 PF12760 Zn_Tnp_IS1595:  Transp  26.1      66  0.0014   21.3   2.3   10  333-342    36-45  (46)
177 PF05741 zf-nanos:  Nanos RNA b  25.9      29 0.00063   24.3   0.5   13   37-49     30-42  (55)
178 PF03884 DUF329:  Domain of unk  25.8      20 0.00042   25.3  -0.3   12   41-52      3-14  (57)
179 PF09332 Mcm10:  Mcm10 replicat  25.8      27 0.00059   34.2   0.5   56  275-343   251-312 (344)
180 PF01428 zf-AN1:  AN1-like Zinc  25.7      22 0.00047   23.3  -0.1   14   39-52     12-25  (43)
181 cd00924 Cyt_c_Oxidase_Vb Cytoc  25.1      29 0.00062   27.4   0.5   20  326-346    72-91  (97)
182 COG2331 Uncharacterized protei  25.1      29 0.00063   25.8   0.4   10  277-286    13-22  (82)
183 KOG0978 E3 ubiquitin ligase in  24.2      28 0.00062   37.2   0.3   24   37-60    675-698 (698)
184 PF05191 ADK_lid:  Adenylate ki  23.9      49  0.0011   20.9   1.3   11  335-345    22-32  (36)
185 KOG2785 C2H2-type Zn-finger pr  23.4      24 0.00052   34.6  -0.3   71  274-355   164-241 (390)
186 COG3091 SprT Zn-dependent meta  23.3      38 0.00083   28.9   0.9   17  325-342   132-148 (156)
187 PF01844 HNH:  HNH endonuclease  22.9      21 0.00046   23.3  -0.6   17   43-59      1-17  (47)
188 PF12907 zf-met2:  Zinc-binding  22.9      19 0.00041   23.4  -0.8   25   41-65      2-30  (40)
189 KOG3408 U1-like Zn-finger-cont  22.4      39 0.00084   27.6   0.7   27  272-298    53-79  (129)
190 KOG2593 Transcription initiati  22.4      53  0.0012   32.9   1.8   36  273-311   125-160 (436)
191 smart00661 RPOL9 RNA polymeras  21.9      70  0.0015   21.4   1.9   16  334-349    20-35  (52)
192 PRK12380 hydrogenase nickel in  21.9      47   0.001   26.9   1.1    8  276-283    70-77  (113)
193 smart00440 ZnF_C2C2 C2C2 Zinc   21.8      32  0.0007   22.2   0.1   12  334-345    28-39  (40)
194 PF00301 Rubredoxin:  Rubredoxi  21.8      31 0.00067   23.3   0.0    7  277-283    35-41  (47)
195 PF14369 zf-RING_3:  zinc-finge  21.6      51  0.0011   20.6   1.0   30   20-51      3-32  (35)
196 PRK04023 DNA polymerase II lar  21.3      71  0.0015   35.7   2.6   37  276-345   638-674 (1121)
197 KOG2482 Predicted C2H2-type Zn  21.2      48   0.001   32.1   1.2   82  276-358   195-303 (423)
198 PF15269 zf-C2H2_7:  Zinc-finge  21.0      61  0.0013   21.5   1.3   25   38-62     18-42  (54)
199 PF09889 DUF2116:  Uncharacteri  21.0      46 0.00099   23.7   0.8    7   43-49      6-12  (59)
200 COG1571 Predicted DNA-binding   20.5      64  0.0014   32.5   1.9   32  306-350   352-383 (421)
201 COG4640 Predicted membrane pro  20.4      56  0.0012   32.3   1.5   33   19-58      1-33  (465)
202 PRK00432 30S ribosomal protein  20.2      75  0.0016   21.7   1.7   12  333-344    36-47  (50)
203 cd02335 ZZ_ADA2 Zinc finger, Z  20.2      64  0.0014   21.7   1.3   20  339-358    26-45  (49)
204 PF07975 C1_4:  TFIIH C1-like d  20.1      50  0.0011   22.7   0.8   27  274-300    19-45  (51)

No 1  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.89  E-value=1.2e-23  Score=212.86  Aligned_cols=92  Identities=18%  Similarity=0.307  Sum_probs=81.5

Q ss_pred             CCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCC----CccccC---CcCcccC
Q 044606          273 SRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVK----KVHECP---VCFRVFS  345 (413)
Q Consensus       273 ~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~----kp~~C~---~C~k~F~  345 (413)
                      ...|..|-+|.|+....+.|+.|.|+|+||+||+|++|+.+|+  .+.+|+.|+.+|...    -+|.|+   +|.+.|.
T Consensus       602 ~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFt--TkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  602 RTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFT--TKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             cCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhc--cccchhhcccccccCccccccccCCchhhhccccc
Confidence            4467999999999999999999999999999999999999996  667888999888654    358999   9999999


Q ss_pred             CchhhcccccccccCCCCCCC
Q 044606          346 SGQALGGHKRTHVTGLVASTS  366 (413)
Q Consensus       346 ~~~~L~~H~r~H~~~~~~~~~  366 (413)
                      ..-.|..|+|+|.++..+...
T Consensus       680 n~V~lpQhIriH~~~~~s~g~  700 (958)
T KOG1074|consen  680 NAVTLPQHIRIHLGGQISNGG  700 (958)
T ss_pred             ccccccceEEeecCCCCCCCc
Confidence            999999999999977666543


No 2  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.89  E-value=3.6e-24  Score=193.44  Aligned_cols=90  Identities=21%  Similarity=0.283  Sum_probs=83.8

Q ss_pred             HHHHhhhhcCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCc
Q 044606          263 EFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFR  342 (413)
Q Consensus       263 ~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k  342 (413)
                      .++-|++.|+  -+++|.+|||.|.+.+.|+.|+|+|||||||.|..|+++|  ....+|+.|+.+|.+.|+|+|..|+|
T Consensus       176 ALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAF--ADRSNLRAHmQTHS~~K~~qC~~C~K  251 (279)
T KOG2462|consen  176 ALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAF--ADRSNLRAHMQTHSDVKKHQCPRCGK  251 (279)
T ss_pred             HHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchh--cchHHHHHHHHhhcCCccccCcchhh
Confidence            4566888886  7899999999999999999999999999999999999999  57789999999999999999999999


Q ss_pred             ccCCchhhcccccc
Q 044606          343 VFSSGQALGGHKRT  356 (413)
Q Consensus       343 ~F~~~~~L~~H~r~  356 (413)
                      +|+..+.|.+|...
T Consensus       252 sFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  252 SFALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHHHhhhh
Confidence            99999999999764


No 3  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.76  E-value=1.8e-19  Score=163.08  Aligned_cols=109  Identities=19%  Similarity=0.221  Sum_probs=97.6

Q ss_pred             hhhhcccCcCcchHHHHHhhhhcC---CCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhh
Q 044606          249 EEAEKSMDETDESEEFKSFNNKNR---SRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLA  325 (413)
Q Consensus       249 ~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h  325 (413)
                      ..|.++...+....+|-.|++.|.   ..+-+.|.+|+|.|.+-..|+.|+|+|+  -+++|.+||+.|  .+..-|+.|
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaF--SRPWLLQGH  206 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAF--SRPWLLQGH  206 (279)
T ss_pred             eeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccc--cchHHhhcc
Confidence            345556677788888889988886   4788999999999999999999999998  689999999999  477789999


Q ss_pred             cCCCCCCCccccCCcCcccCCchhhcccccccccCC
Q 044606          326 SPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGL  361 (413)
Q Consensus       326 ~~~h~g~kp~~C~~C~k~F~~~~~L~~H~r~H~~~~  361 (413)
                      +|+|||||||.|+.|+|+|+.+++|+.||+||.+--
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K  242 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK  242 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCc
Confidence            999999999999999999999999999999998643


No 4  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.73  E-value=2.7e-18  Score=174.50  Aligned_cols=61  Identities=31%  Similarity=0.336  Sum_probs=55.5

Q ss_pred             cCCCCCCCCccchhhheeeeeeEEeeccccccccccccccCcccccCCChhhhhhHHHhhcCCCCCCCchhh
Q 044606            4 LSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQE   75 (413)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~K~F~~~~~L~~HmR~Htg~~p~~~~~~~   75 (413)
                      +..++.||++.+.|.           ....+.....+|+|.||+|+|...++|+.|+|+||||+||.|+.|-
T Consensus       328 a~p~~~k~~~~~~~~-----------v~~~~~~~~~khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG  388 (958)
T KOG1074|consen  328 ASPGLLKEKNGSYFS-----------VEGPSEKPFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCG  388 (958)
T ss_pred             cCcccCCcccccccc-----------cccCCccccccchhhhhHhhcCchhhhhhhhhccCCCCCeeecccc
Confidence            567888999999888           9999999999999999999999999999999999999999975443


No 5  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.48  E-value=4.5e-15  Score=148.85  Aligned_cols=83  Identities=20%  Similarity=0.383  Sum_probs=78.3

Q ss_pred             cCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhh
Q 044606          271 NRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQAL  350 (413)
Q Consensus       271 ~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L  350 (413)
                      .+..+.|.|++|.|+|...+.|.+|.--|+|.+||+|.+|.++|+  .+-.|..|+|.|.|+|||.|..|+|+|+...+.
T Consensus       889 kte~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFK--HKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSY  966 (1007)
T KOG3623|consen  889 KTEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFK--HKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSY  966 (1007)
T ss_pred             cCccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhh--hhhhhhhhhhhccCCCcchhhhhhhhcccccch
Confidence            446688999999999999999999999999999999999999994  677899999999999999999999999999999


Q ss_pred             ccccc
Q 044606          351 GGHKR  355 (413)
Q Consensus       351 ~~H~r  355 (413)
                      ..||.
T Consensus       967 SQHMN  971 (1007)
T KOG3623|consen  967 SQHMN  971 (1007)
T ss_pred             Hhhhc
Confidence            99985


No 6  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.48  E-value=6.9e-15  Score=126.92  Aligned_cols=87  Identities=16%  Similarity=0.241  Sum_probs=77.6

Q ss_pred             cCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhh
Q 044606          271 NRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQAL  350 (413)
Q Consensus       271 ~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L  350 (413)
                      ..+...|.|.+|+|.|.....|.+|++-|...|.|-|..||+.|  .....|.+|+++|+|.+||+|..|+|+|+++-+|
T Consensus       112 ssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgf--ndtfdlkrh~rthtgvrpykc~~c~kaftqrcsl  189 (267)
T KOG3576|consen  112 SSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGF--NDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSL  189 (267)
T ss_pred             CCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcc--cchhhhhhhhccccCccccchhhhhHHHHhhccH
Confidence            34556799999999999999999999999999999999999999  4667799999999999999999999999999999


Q ss_pred             ccccccccc
Q 044606          351 GGHKRTHVT  359 (413)
Q Consensus       351 ~~H~r~H~~  359 (413)
                      ..|++.-+|
T Consensus       190 eshl~kvhg  198 (267)
T KOG3576|consen  190 ESHLKKVHG  198 (267)
T ss_pred             HHHHHHHcC
Confidence            999775544


No 7  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.24  E-value=2e-12  Score=130.11  Aligned_cols=105  Identities=16%  Similarity=0.217  Sum_probs=88.4

Q ss_pred             hhhcccCcCcchHHHHHhhhhc--CCCCccccCCccccccChhhhhhhhhhcCC-------------CcccCCCCCCccc
Q 044606          250 EAEKSMDETDESEEFKSFNNKN--RSRGKYKCETCKKVFKSYQALGGHRASHKK-------------IKFYTPVQETELD  314 (413)
Q Consensus       250 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~-------------~kp~~C~~C~~~f  314 (413)
                      .|..+...+.....++.|+...  ..+..|.|.+|..+|.+...|.+|+.+|..             .+-|+|..|+++|
T Consensus       212 tcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAF  291 (1007)
T KOG3623|consen  212 TCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAF  291 (1007)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhh
Confidence            3445556666777788887553  345569999999999999999999998864             3569999999999


Q ss_pred             ccccchhhhhhcCCCCCCCccccCCcCcccCCchhhcccccc
Q 044606          315 QENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRT  356 (413)
Q Consensus       315 ~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~H~r~  356 (413)
                      +  .+-.|..|+|+|.|+|||.|+-|+|+|+...++..||-.
T Consensus       292 K--fKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  292 K--FKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             h--hHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            6  566899999999999999999999999999999999854


No 8  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.20  E-value=1.7e-12  Score=112.34  Aligned_cols=112  Identities=12%  Similarity=0.045  Sum_probs=94.4

Q ss_pred             hhhhhcccCcCcchHHHHHhhhhcCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcC
Q 044606          248 DEEAEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASP  327 (413)
Q Consensus       248 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~  327 (413)
                      ...|..+...+.-..-+..|++-|..-+.|.|..|||.|.....|++|+|+|+|.+||+|..|+++|++...  |..|.+
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcs--leshl~  194 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCS--LESHLK  194 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhcc--HHHHHH
Confidence            344666777888888899999999999999999999999999999999999999999999999999986554  444432


Q ss_pred             -CC----------CCCCccccCCcCcccCCchhhcccccccccCC
Q 044606          328 -PL----------SVKKVHECPVCFRVFSSGQALGGHKRTHVTGL  361 (413)
Q Consensus       328 -~h----------~g~kp~~C~~C~k~F~~~~~L~~H~r~H~~~~  361 (413)
                       +|          ..+|.|.|..||.+-.....+..|++.|+...
T Consensus       195 kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~S  239 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFS  239 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCC
Confidence             22          23678999999999999999999999998654


No 9  
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.16  E-value=5.9e-12  Score=117.29  Aligned_cols=104  Identities=14%  Similarity=0.196  Sum_probs=81.9

Q ss_pred             cCcchHHHHHhhh-hcCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCC-CCCC--
Q 044606          257 ETDESEEFKSFNN-KNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPP-LSVK--  332 (413)
Q Consensus       257 ~~~~~~~~~~~~~-~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~-h~g~--  332 (413)
                      +....+.+..|++ .|...|||+|+.|.+.|.+.+.|.+|..+|+ +-.|.|..-.+.|.....-.+.+|++- |.|.  
T Consensus       272 tc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np  350 (467)
T KOG3608|consen  272 TCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNP  350 (467)
T ss_pred             CCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCC
Confidence            3455667777765 4778999999999999999999999999999 678999984444444566667788764 4354  


Q ss_pred             CccccCCcCcccCCchhhcccccccccCC
Q 044606          333 KVHECPVCFRVFSSGQALGGHKRTHVTGL  361 (413)
Q Consensus       333 kp~~C~~C~k~F~~~~~L~~H~r~H~~~~  361 (413)
                      -+|.|..|.|.|++..+|.+|++..++-.
T Consensus       351 ~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  351 ILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             CceeeecchhhhccchhHHHHHHHhhccc
Confidence            46999999999999999999977655433


No 10 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.14  E-value=1.8e-11  Score=114.16  Aligned_cols=111  Identities=17%  Similarity=0.140  Sum_probs=93.9

Q ss_pred             hhhhcccCcCcchHHHHHhhhhcCCCCccccCCccccccChhhhhhhhhh-cCCCcccCCCCCCcccccccchhhhhhcC
Q 044606          249 EEAEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRAS-HKKIKFYTPVQETELDQENAGASINLASP  327 (413)
Q Consensus       249 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f~~~~~~~l~~h~~  327 (413)
                      .+|..+...+.....++.|+..|.  .-|+|+.|..+....+.|..|++. |+..|||+|+.|.+.|  .....|.+|..
T Consensus       238 fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c--~~esdL~kH~~  313 (467)
T KOG3608|consen  238 FQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRC--VRESDLAKHVQ  313 (467)
T ss_pred             hHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhh--ccHHHHHHHHH
Confidence            344555556666777888888875  569999999999999999999986 9999999999999988  57778999999


Q ss_pred             CCCCCCccccCC--cCcccCCchhhcccccccccCCCCC
Q 044606          328 PLSVKKVHECPV--CFRVFSSGQALGGHKRTHVTGLVAS  364 (413)
Q Consensus       328 ~h~g~kp~~C~~--C~k~F~~~~~L~~H~r~H~~~~~~~  364 (413)
                      .|+ +-.|.|..  |..+|.+...|.+|++.|+.+..+.
T Consensus       314 ~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~  351 (467)
T KOG3608|consen  314 VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPI  351 (467)
T ss_pred             hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCC
Confidence            898 77899988  9999999999999999888555443


No 11 
>PHA00733 hypothetical protein
Probab=98.92  E-value=4.5e-10  Score=93.65  Aligned_cols=95  Identities=16%  Similarity=0.142  Sum_probs=74.4

Q ss_pred             hHHHHHhhhhcCCCCccccCCccccccChhhhhhh--h---hhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCcc
Q 044606          261 SEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGH--R---ASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVH  335 (413)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H--~---~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~  335 (413)
                      .+++..+-......+++.|.+|.+.|.....|..|  +   ..+.+.+||.|..|++.|.  ....|..|++.|  +.+|
T Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fs--s~s~L~~H~r~h--~~~~  100 (128)
T PHA00733         25 LEELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFS--SSVSLKQHIRYT--EHSK  100 (128)
T ss_pred             HHHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCC--CHHHHHHHHhcC--CcCc
Confidence            34455544444567889999999999888777665  2   1334588999999999994  666777888876  4689


Q ss_pred             ccCCcCcccCCchhhccccccccc
Q 044606          336 ECPVCFRVFSSGQALGGHKRTHVT  359 (413)
Q Consensus       336 ~C~~C~k~F~~~~~L~~H~r~H~~  359 (413)
                      .|.+|++.|.....|..|++..++
T Consensus       101 ~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        101 VCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCCccCCHHHHHHHHHHhcC
Confidence            999999999999999999987765


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=98.61  E-value=2e-08  Score=69.47  Aligned_cols=37  Identities=14%  Similarity=0.357  Sum_probs=28.9

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCCCCccc
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELD  314 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f  314 (413)
                      .|.|+.||+.|...++|..|+++|+  ++|+|..|++.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f   41 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRIS   41 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCccccee
Confidence            3899999999999999999999997  455555544444


No 13 
>PHA00616 hypothetical protein
Probab=98.53  E-value=3.1e-08  Score=65.21  Aligned_cols=31  Identities=16%  Similarity=0.179  Sum_probs=29.6

Q ss_pred             ccccCcccccCCChhhhhhHHHhhcCCCCCC
Q 044606           40 KHKCRLCFKNFSNGRALGGHMRSHMLNLPIP   70 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L~~HmR~Htg~~p~~   70 (413)
                      +|+|+.||+.|.+.+.|..|||.|+|++|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~   31 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLT   31 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccc
Confidence            6899999999999999999999999999984


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.46  E-value=5.5e-08  Score=67.33  Aligned_cols=45  Identities=11%  Similarity=-0.115  Sum_probs=38.9

Q ss_pred             ccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhcc
Q 044606          304 FYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGG  352 (413)
Q Consensus       304 p~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~  352 (413)
                      -|.|+.|++.|.  ...+|..|+++|+  ++|+|..|+|.|++.+.|..
T Consensus         5 ~y~C~~CGK~Fs--~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~~   49 (55)
T PHA02768          5 GYECPICGEIYI--KRKSMITHLRKHN--TNLKLSNCKRISLRTGEYIE   49 (55)
T ss_pred             ccCcchhCCeec--cHHHHHHHHHhcC--CcccCCcccceecccceeEE
Confidence            389999999994  6778899999998  79999999999998888753


No 15 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=1.3e-07  Score=54.19  Aligned_cols=23  Identities=48%  Similarity=0.811  Sum_probs=22.2

Q ss_pred             cccCcccccCCChhhhhhHHHhh
Q 044606           41 HKCRLCFKNFSNGRALGGHMRSH   63 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~H   63 (413)
                      |+|++|+|.|.+...|..||++|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999987


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.37  E-value=5.6e-08  Score=57.39  Aligned_cols=23  Identities=22%  Similarity=0.013  Sum_probs=11.5

Q ss_pred             hhhhhhhcCCCcccCCCCCCccc
Q 044606          292 LGGHRASHKKIKFYTPVQETELD  314 (413)
Q Consensus       292 L~~H~~~H~~~kp~~C~~C~~~f  314 (413)
                      |.+|+++|+|++||.|+.|++.|
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEE
T ss_pred             HHHHhhhcCCCCCCCCCCCcCee
Confidence            55555555554444444444433


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.32  E-value=4.6e-07  Score=92.46  Aligned_cols=62  Identities=11%  Similarity=0.191  Sum_probs=28.2

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCccc
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVF  344 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F  344 (413)
                      .+.|..|++.|. ...|..|+++|+  ++|.|+ |+..+   ....|..|..+|...+++.|..|++.|
T Consensus       453 H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~---~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        453 HVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL---EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             CccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc---chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            344555555443 344455544442  444554 44322   223444444444445555555555544


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.22  E-value=8.3e-07  Score=90.62  Aligned_cols=99  Identities=15%  Similarity=0.161  Sum_probs=77.6

Q ss_pred             hhcccCcCcchHHHHHhhhhcCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccc--------cchhh
Q 044606          251 AEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQEN--------AGASI  322 (413)
Q Consensus       251 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~--------~~~~l  322 (413)
                      |..+...+. ...++.|...+.  +++.|. ||+.| ....|..|+++|.+.+++.|.+|+..+...        ....|
T Consensus       456 C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~L  530 (567)
T PLN03086        456 CEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGM  530 (567)
T ss_pred             CCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhH
Confidence            444545553 567889998874  899999 99765 678999999999999999999999988411        13357


Q ss_pred             hhhcCCCCCCCccccCCcCcccCCchhhcccccc
Q 044606          323 NLASPPLSVKKVHECPVCFRVFSSGQALGGHKRT  356 (413)
Q Consensus       323 ~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~H~r~  356 (413)
                      ..|.... |.+++.|..||+.|..+ .|..|+..
T Consensus       531 t~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        531 SEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             HHHHHhc-CCcceEccccCCeeeeh-hHHHHHHH
Confidence            8888875 89999999999998876 56666543


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.19  E-value=5.8e-07  Score=53.04  Aligned_cols=25  Identities=24%  Similarity=0.426  Sum_probs=19.1

Q ss_pred             hhhhcCCCCCCCccccCCcCcccCC
Q 044606          322 INLASPPLSVKKVHECPVCFRVFSS  346 (413)
Q Consensus       322 l~~h~~~h~g~kp~~C~~C~k~F~~  346 (413)
                      |.+|+++|+|+|||.|++|++.|.+
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            5677777888888888888887763


No 20 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.06  E-value=1.5e-06  Score=83.52  Aligned_cols=39  Identities=28%  Similarity=0.330  Sum_probs=32.9

Q ss_pred             EeeccccccccccccccCcccccCCChhhhhhHHHhhcC
Q 044606           27 VFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        27 ~~~~~~~~~~~~~~~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      ++-.|+=+.+.---|+|+-|+|+|.+...|.-|.|.|--
T Consensus       282 ~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKP  320 (500)
T KOG3993|consen  282 ALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKP  320 (500)
T ss_pred             HHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCC
Confidence            344566666677779999999999999999999999976


No 21 
>PHA00616 hypothetical protein
Probab=98.04  E-value=1.4e-06  Score=57.37  Aligned_cols=34  Identities=24%  Similarity=0.328  Sum_probs=31.9

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCC
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQ  309 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~  309 (413)
                      ||+|..||+.|..++.|..|++.|+|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999998864


No 22 
>PHA00732 hypothetical protein
Probab=98.02  E-value=3.8e-06  Score=63.69  Aligned_cols=36  Identities=19%  Similarity=0.168  Sum_probs=27.1

Q ss_pred             ccccCCccccccChhhhhhhhhh-cCCCcccCCCCCCccc
Q 044606          276 KYKCETCKKVFKSYQALGGHRAS-HKKIKFYTPVQETELD  314 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f  314 (413)
                      ||.|..|++.|.+...|..|++. |.+   +.|..|++.|
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF   37 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSY   37 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEe
Confidence            58899999999999999999874 653   3555555555


No 23 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.98  E-value=3.3e-06  Score=48.51  Aligned_cols=24  Identities=38%  Similarity=0.761  Sum_probs=20.7

Q ss_pred             cccCcccccCCChhhhhhHHHhhc
Q 044606           41 HKCRLCFKNFSNGRALGGHMRSHM   64 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~Ht   64 (413)
                      |.|++|++.|.+...|..||++|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999984


No 24 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=97.98  E-value=1.1e-06  Score=84.60  Aligned_cols=116  Identities=20%  Similarity=0.260  Sum_probs=73.9

Q ss_pred             hhhhhcccCcCcchHHHHHhhhhcCCCCccccCCccccccChhhhhhhhhhcCCCcccCC-CC-CCcccccccchhhhhh
Q 044606          248 DEEAEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTP-VQ-ETELDQENAGASINLA  325 (413)
Q Consensus       248 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C-~~-C~~~f~~~~~~~l~~h  325 (413)
                      +.-|.-+...+++...|-.|.....-.--|+|..|+|+|+...||..|.|.|.-..--.- .. -.+.-. ......+.-
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~-~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAV-ETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhh-hhhhhhhhc
Confidence            344556667777777888887666556679999999999999999999999975321100 00 000000 000000011


Q ss_pred             cCC--CCCCCccccCCcCcccCCchhhcccccccccCCCCC
Q 044606          326 SPP--LSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLVAS  364 (413)
Q Consensus       326 ~~~--h~g~kp~~C~~C~k~F~~~~~L~~H~r~H~~~~~~~  364 (413)
                      .+.  ...+-.|.|.+|+|.|.+...|++|+-+|+......
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k  386 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAK  386 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccch
Confidence            111  112347999999999999999999999998654443


No 25 
>PHA00733 hypothetical protein
Probab=97.86  E-value=1.1e-05  Score=67.42  Aligned_cols=59  Identities=14%  Similarity=-0.004  Sum_probs=47.2

Q ss_pred             HHHhhhhcCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcC
Q 044606          264 FKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASP  327 (413)
Q Consensus       264 ~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~  327 (413)
                      +..+... .+.++|.|..|++.|.+...|..|++.|  ..+|.|..|++.|.  ....|..|+.
T Consensus        62 l~~~~~~-~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~--~~~sL~~H~~  120 (128)
T PHA00733         62 LYKLLTS-KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFR--NTDSTLDHVC  120 (128)
T ss_pred             HHhhccc-CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccC--CHHHHHHHHH
Confidence            4444433 4588999999999999999999999987  45799999999995  5556666664


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.77  E-value=9.4e-06  Score=48.28  Aligned_cols=26  Identities=42%  Similarity=0.558  Sum_probs=24.3

Q ss_pred             ccccCcccccCCChhhhhhHHHhhcC
Q 044606           40 KHKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      +|+|.+|++.|.+...|..|||.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58999999999999999999999964


No 27 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.72  E-value=2.2e-05  Score=72.97  Aligned_cols=71  Identities=23%  Similarity=0.367  Sum_probs=52.0

Q ss_pred             CCCccccCC--ccccccChhhhhhhhhh-cCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchh
Q 044606          273 SRGKYKCET--CKKVFKSYQALGGHRAS-HKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQA  349 (413)
Q Consensus       273 ~~~~~~C~~--C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~  349 (413)
                      ++|||+|++  |.|+|.....|+.|+.- |...+...-+.-.+            +.......|||.|++|+|+|.....
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~------------~~~F~~~~KPYrCevC~KRYKNlNG  413 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEK------------MNIFSAKDKPYRCEVCDKRYKNLNG  413 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccc------------cccccccCCceeccccchhhccCcc
Confidence            469999998  99999999999999764 54444332221111            1111334799999999999999999


Q ss_pred             hccccc
Q 044606          350 LGGHKR  355 (413)
Q Consensus       350 L~~H~r  355 (413)
                      |+.|..
T Consensus       414 LKYHr~  419 (423)
T COG5189         414 LKYHRK  419 (423)
T ss_pred             ceeccc
Confidence            999965


No 28 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.70  E-value=2.3e-05  Score=52.77  Aligned_cols=36  Identities=17%  Similarity=0.310  Sum_probs=26.4

Q ss_pred             cccccccccccCcccccCCChhhhhhHHHhhcCCCC
Q 044606           33 KSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLP   68 (413)
Q Consensus        33 ~~~~~~~~~~C~iC~K~F~~~~~L~~HmR~Htg~~p   68 (413)
                      ....+.++.+||+|+..+.....|.+||.++++.+|
T Consensus        17 ~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   17 SKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             HhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            345578999999999999999999999999988776


No 29 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.65  E-value=3e-05  Score=45.12  Aligned_cols=25  Identities=40%  Similarity=0.622  Sum_probs=23.3

Q ss_pred             cccCcccccCCChhhhhhHHHhhcC
Q 044606           41 HKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      |+|..|++.|.....|..||+.|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhcc
Confidence            6899999999999999999999864


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.61  E-value=8.9e-06  Score=46.40  Aligned_cols=23  Identities=43%  Similarity=0.817  Sum_probs=21.5

Q ss_pred             cccCCcCcccCCchhhccccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRTH  357 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~H  357 (413)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999875


No 31 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.37  E-value=6.5e-05  Score=43.70  Aligned_cols=24  Identities=38%  Similarity=0.721  Sum_probs=22.3

Q ss_pred             cccCcccccCCChhhhhhHHHhhc
Q 044606           41 HKCRLCFKNFSNGRALGGHMRSHM   64 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~Ht   64 (413)
                      |.|.+|.+.|.+...|+.||+.|.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~~   24 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSKK   24 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTHH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcCC
Confidence            679999999999999999999873


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.29  E-value=6.5e-05  Score=44.59  Aligned_cols=26  Identities=46%  Similarity=0.696  Sum_probs=24.1

Q ss_pred             ccccCCcCcccCCchhhccccccccc
Q 044606          334 VHECPVCFRVFSSGQALGGHKRTHVT  359 (413)
Q Consensus       334 p~~C~~C~k~F~~~~~L~~H~r~H~~  359 (413)
                      ||.|..|++.|.+...|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999999864


No 33 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.23  E-value=0.00011  Score=43.72  Aligned_cols=24  Identities=38%  Similarity=0.628  Sum_probs=21.8

Q ss_pred             ccccCcccccCCChhhhhhHHHhh
Q 044606           40 KHKCRLCFKNFSNGRALGGHMRSH   63 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L~~HmR~H   63 (413)
                      +|-|.+|+|.|.+...|.+||+++
T Consensus         1 q~~C~~C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    1 QFYCDACDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             -CBBTTTTBBBSSHHHHHCCTTSH
T ss_pred             CCCcccCCCCcCCHHHHHHHHccC
Confidence            588999999999999999999974


No 34 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.21  E-value=0.00017  Score=50.57  Aligned_cols=51  Identities=25%  Similarity=0.417  Sum_probs=33.9

Q ss_pred             ccccCCccccccChhhhhhhhhh-cCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhcccc
Q 044606          276 KYKCETCKKVFKSYQALGGHRAS-HKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHK  354 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~H~  354 (413)
                      .|.|++|++. .....|..|... |..+                             .+.+.|++|...+..  +|..|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~-----------------------------~~~v~CPiC~~~~~~--~l~~Hl   49 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSE-----------------------------SKNVVCPICSSRVTD--NLIRHL   49 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCC-----------------------------CCCccCCCchhhhhh--HHHHHH
Confidence            3788888884 456778888654 5432                             235677777776553  777787


Q ss_pred             cccc
Q 044606          355 RTHV  358 (413)
Q Consensus       355 r~H~  358 (413)
                      .+++
T Consensus        50 ~~~H   53 (54)
T PF05605_consen   50 NSQH   53 (54)
T ss_pred             HHhc
Confidence            7665


No 35 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.19  E-value=7.3e-05  Score=42.72  Aligned_cols=24  Identities=42%  Similarity=0.801  Sum_probs=20.3

Q ss_pred             cccCCcCcccCCchhhcccccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRTHV  358 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~H~  358 (413)
                      |.|++|++.|.+...|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999874


No 36 
>PHA00732 hypothetical protein
Probab=96.83  E-value=0.0006  Score=51.71  Aligned_cols=26  Identities=35%  Similarity=0.409  Sum_probs=23.6

Q ss_pred             ccccCcccccCCChhhhhhHHHh-hcC
Q 044606           40 KHKCRLCFKNFSNGRALGGHMRS-HML   65 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L~~HmR~-Htg   65 (413)
                      +|.|.+|++.|.....|++|||. |++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC
Confidence            58999999999999999999995 764


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.73  E-value=0.0004  Score=54.92  Aligned_cols=74  Identities=23%  Similarity=0.312  Sum_probs=22.5

Q ss_pred             ccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhccccccc
Q 044606          278 KCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTH  357 (413)
Q Consensus       278 ~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~H~r~H  357 (413)
                      +|.+|+..|.....|..|+....+...-.....      .....+..+.+.. -...+.|.+|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l------~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYL------VDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccccccccc------ccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            599999999999999999976444221111000      0111111122111 123699999999999999999999975


Q ss_pred             c
Q 044606          358 V  358 (413)
Q Consensus       358 ~  358 (413)
                      .
T Consensus        74 ~   74 (100)
T PF12756_consen   74 H   74 (100)
T ss_dssp             T
T ss_pred             c
Confidence            4


No 38 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.72  E-value=0.00089  Score=38.89  Aligned_cols=21  Identities=29%  Similarity=0.570  Sum_probs=18.9

Q ss_pred             cccCcccccCCChhhhhhHHHh
Q 044606           41 HKCRLCFKNFSNGRALGGHMRS   62 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~   62 (413)
                      ..|++||++| +..+|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 99999999874


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.44  E-value=0.00083  Score=38.79  Aligned_cols=24  Identities=50%  Similarity=0.815  Sum_probs=22.0

Q ss_pred             cccCCcCcccCCchhhcccccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRTHV  358 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~H~  358 (413)
                      |.|..|++.|.....|..|+++|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            689999999999999999999775


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.25  E-value=0.0024  Score=36.56  Aligned_cols=24  Identities=29%  Similarity=0.434  Sum_probs=19.7

Q ss_pred             cccCcccccCCChhhhhhHHHhhcC
Q 044606           41 HKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      |+|++|.-... ...|.+||+.|.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            78999999888 9999999999764


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.80  E-value=0.0053  Score=41.55  Aligned_cols=34  Identities=21%  Similarity=0.271  Sum_probs=24.5

Q ss_pred             cCCCCccccCCccccccChhhhhhhhhhcCCCcc
Q 044606          271 NRSRGKYKCETCKKVFKSYQALGGHRASHKKIKF  304 (413)
Q Consensus       271 ~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp  304 (413)
                      +....|..|++|+..+.+..+|.+|+.++.+.||
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4567899999999999999999999988877664


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.50  E-value=0.0032  Score=36.36  Aligned_cols=23  Identities=35%  Similarity=0.671  Sum_probs=21.2

Q ss_pred             cccCCcCcccCCchhhccccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRTH  357 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~H  357 (413)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999999875


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.48  E-value=0.0074  Score=35.65  Aligned_cols=23  Identities=30%  Similarity=0.567  Sum_probs=21.3

Q ss_pred             cccCCcCcccCCchhhccccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRTH  357 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~H  357 (413)
                      |.|.+|++.|.+...|..|++++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTSH
T ss_pred             CCcccCCCCcCCHHHHHHHHccC
Confidence            78999999999999999999864


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=95.38  E-value=0.0077  Score=52.17  Aligned_cols=35  Identities=17%  Similarity=0.318  Sum_probs=17.8

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCCCCccc
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELD  314 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f  314 (413)
                      +|.|. |++   ....+.+|.++|+++++|.|..|+..+
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            35554 554   444455555555555555544444443


No 45 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=95.12  E-value=0.011  Score=46.45  Aligned_cols=25  Identities=40%  Similarity=0.715  Sum_probs=22.5

Q ss_pred             ccccCcccccCCChhhhhhHHHhhc
Q 044606           40 KHKCRLCFKNFSNGRALGGHMRSHM   64 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L~~HmR~Ht   64 (413)
                      .+.|.+|++.|.+...|+.||+.|.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6999999999999999999999864


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=95.06  E-value=0.0075  Score=52.23  Aligned_cols=40  Identities=13%  Similarity=0.048  Sum_probs=33.5

Q ss_pred             cccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCch
Q 044606          303 KFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQ  348 (413)
Q Consensus       303 kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~  348 (413)
                      -+|.|. |+.     ....+.+|.++|+|+++|.|..|++.|....
T Consensus       118 ~~Y~C~-C~~-----~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE-----HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC-----eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            369997 876     4456889999999999999999999987654


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.05  E-value=0.013  Score=36.73  Aligned_cols=25  Identities=20%  Similarity=0.586  Sum_probs=22.5

Q ss_pred             cccccCcccccCCChhhhhhHHHhh
Q 044606           39 EKHKCRLCFKNFSNGRALGGHMRSH   63 (413)
Q Consensus        39 ~~~~C~iC~K~F~~~~~L~~HmR~H   63 (413)
                      .+|.|.+|++.|.....|..|++..
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHChH
Confidence            4689999999999999999999863


No 48 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=94.13  E-value=0.0099  Score=33.97  Aligned_cols=24  Identities=29%  Similarity=0.462  Sum_probs=18.7

Q ss_pred             cccCCcCcccCCchhhccccccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRTHVT  359 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~H~~  359 (413)
                      |+|+.|..... ...|.+|+++|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999998887 8899999998763


No 49 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=92.23  E-value=0.053  Score=48.92  Aligned_cols=47  Identities=28%  Similarity=0.518  Sum_probs=34.2

Q ss_pred             ccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhccc-ccc
Q 044606          278 KCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGH-KRT  356 (413)
Q Consensus       278 ~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~H-~r~  356 (413)
                      -|.+|++-|.....|..|++                                  .|.|+|.+|.|..-+.-.|..| |++
T Consensus        12 wcwycnrefddekiliqhqk----------------------------------akhfkchichkkl~sgpglsihcmqv   57 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK----------------------------------AKHFKCHICHKKLFSGPGLSIHCMQV   57 (341)
T ss_pred             eeeecccccchhhhhhhhhh----------------------------------hccceeeeehhhhccCCCceeehhhh
Confidence            47788888877777766642                                  4567888888887778788887 556


Q ss_pred             cc
Q 044606          357 HV  358 (413)
Q Consensus       357 H~  358 (413)
                      |.
T Consensus        58 hk   59 (341)
T KOG2893|consen   58 HK   59 (341)
T ss_pred             hh
Confidence            64


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=91.75  E-value=0.053  Score=31.42  Aligned_cols=21  Identities=33%  Similarity=0.746  Sum_probs=16.7

Q ss_pred             cccCCcCcccCCchhhcccccc
Q 044606          335 HECPVCFRVFSSGQALGGHKRT  356 (413)
Q Consensus       335 ~~C~~C~k~F~~~~~L~~H~r~  356 (413)
                      ..|+.||+.| ....|.+|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 66788888754


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.09  E-value=0.28  Score=48.91  Aligned_cols=71  Identities=14%  Similarity=0.038  Sum_probs=48.6

Q ss_pred             CccccCCccccccChhhhhhhhh--hcCCC--cccCCC--CCCcccccccchhhhhhcCCCCCCCccccCC--cCcccCC
Q 044606          275 GKYKCETCKKVFKSYQALGGHRA--SHKKI--KFYTPV--QETELDQENAGASINLASPPLSVKKVHECPV--CFRVFSS  346 (413)
Q Consensus       275 ~~~~C~~C~k~F~~~~~L~~H~~--~H~~~--kp~~C~--~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~--C~k~F~~  346 (413)
                      .++.|..|...|.....|..|.+  .|+++  +++.|.  .|++.|  .....+..|..+|++.+++.|..  |.+.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  365 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLF--SRNDALKRHILLHTSISPAKEKLLNSSSKFSP  365 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccc--cccccccCCcccccCCCccccccccCcccccc
Confidence            46888888888888888888888  78887  777777  566666  35555666666777666666654  4444433


Q ss_pred             c
Q 044606          347 G  347 (413)
Q Consensus       347 ~  347 (413)
                      .
T Consensus       366 ~  366 (467)
T COG5048         366 L  366 (467)
T ss_pred             c
Confidence            3


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.68  E-value=0.2  Score=50.04  Aligned_cols=61  Identities=16%  Similarity=0.211  Sum_probs=50.3

Q ss_pred             hhcccCcCcchHHHHHhhh--hcCCC--CccccC--CccccccChhhhhhhhhhcCCCcccCCCCCC
Q 044606          251 AEKSMDETDESEEFKSFNN--KNRSR--GKYKCE--TCKKVFKSYQALGGHRASHKKIKFYTPVQET  311 (413)
Q Consensus       251 ~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~C~--~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~  311 (413)
                      +..+...+.....+..|.+  .|.++  +++.|.  .|++.|.....+..|...|++.+++.|....
T Consensus       292 ~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  358 (467)
T COG5048         292 SKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLN  358 (467)
T ss_pred             CccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccccc
Confidence            3444555666677788888  79999  999999  7999999999999999999999988775533


No 53 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=90.00  E-value=0.29  Score=34.09  Aligned_cols=25  Identities=32%  Similarity=0.507  Sum_probs=19.1

Q ss_pred             ccccCcccccCCChhhhhhHHHh-hcC
Q 044606           40 KHKCRLCFKNFSNGRALGGHMRS-HML   65 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L~~HmR~-Htg   65 (413)
                      .|.||+|++.|. ...|..|+.. |..
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~   27 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRS   27 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcC
Confidence            588999999655 5689999776 444


No 54 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=89.90  E-value=0.14  Score=34.02  Aligned_cols=28  Identities=29%  Similarity=0.452  Sum_probs=18.8

Q ss_pred             ccccccccCcccccCCCh----hhhhhHH-Hhh
Q 044606           36 FVMEKHKCRLCFKNFSNG----RALGGHM-RSH   63 (413)
Q Consensus        36 ~~~~~~~C~iC~K~F~~~----~~L~~Hm-R~H   63 (413)
                      .....-+|.+|++.|...    +.|..|+ +.|
T Consensus        12 ~~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   12 GDKKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             GCSS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CCcCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            556778899999999885    8899999 444


No 55 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=88.72  E-value=0.15  Score=56.64  Aligned_cols=78  Identities=19%  Similarity=0.178  Sum_probs=48.1

Q ss_pred             CCCccccCCccccccChhhhhhhhhh-cCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhc
Q 044606          273 SRGKYKCETCKKVFKSYQALGGHRAS-HKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALG  351 (413)
Q Consensus       273 ~~~~~~C~~C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~  351 (413)
                      -.+.|+|+.|+-.|.....|..|+|+ |..-+.   .+|....   ....+-+....-.+-++|.|..|...|+.+.+|.
T Consensus       462 ~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~~gq---~~~~~arg~~~~~~~~p~~C~~C~~stttng~Ls  535 (1406)
T KOG1146|consen  462 FFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCKAGQ---NHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLS  535 (1406)
T ss_pred             ccccccCCccchhhhhHHHhhhcccccccccch---hHhHhcc---ccccccccccccCCCCcccceeeeeeeecchHHH
Confidence            34678888888888888888888876 333222   1111110   0000001111123457999999999999999999


Q ss_pred             ccccc
Q 044606          352 GHKRT  356 (413)
Q Consensus       352 ~H~r~  356 (413)
                      .|+..
T Consensus       536 ihlqS  540 (1406)
T KOG1146|consen  536 IHLQS  540 (1406)
T ss_pred             HHHHH
Confidence            99873


No 56 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=88.03  E-value=0.26  Score=33.73  Aligned_cols=26  Identities=35%  Similarity=0.704  Sum_probs=21.7

Q ss_pred             cccccCcccccCCCh-----hhhhhHHH-hhc
Q 044606           39 EKHKCRLCFKNFSNG-----RALGGHMR-SHM   64 (413)
Q Consensus        39 ~~~~C~iC~K~F~~~-----~~L~~HmR-~Ht   64 (413)
                      ..=.|.+|++.++..     +.|.+||+ +|.
T Consensus        17 ~~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       17 QRAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             eEEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            456799999999877     69999999 674


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=87.79  E-value=0.32  Score=30.23  Aligned_cols=24  Identities=21%  Similarity=0.555  Sum_probs=20.8

Q ss_pred             CccccCCccccccChhhhhhhhhh
Q 044606          275 GKYKCETCKKVFKSYQALGGHRAS  298 (413)
Q Consensus       275 ~~~~C~~C~k~F~~~~~L~~H~~~  298 (413)
                      .+|.|.+|++.|.....+..|++.
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            358899999999999999999764


No 58 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=87.47  E-value=0.58  Score=49.22  Aligned_cols=98  Identities=12%  Similarity=0.071  Sum_probs=49.2

Q ss_pred             cccCcCcchHHHHHhhhhcCCCCccccCCcc------ccccChhhhhhhhhhcCCCcccCCC--CCCc-ccc-c-ccchh
Q 044606          253 KSMDETDESEEFKSFNNKNRSRGKYKCETCK------KVFKSYQALGGHRASHKKIKFYTPV--QETE-LDQ-E-NAGAS  321 (413)
Q Consensus       253 ~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~------k~F~~~~~L~~H~~~H~~~kp~~C~--~C~~-~f~-~-~~~~~  321 (413)
                      -+...+.+..++..|.+.+.    |.|..|.      --|.....|..|-+.+.    |.|.  .|.. .|. + .....
T Consensus       187 ~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~~ei~  258 (669)
T KOG2231|consen  187 FCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFELEIE  258 (669)
T ss_pred             hhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhHHHHH
Confidence            33445556666666654433    7777774      44566667777766543    5665  4542 221 1 11223


Q ss_pred             hhhhcCCCCCCCccccC--CcCc----ccCCchhhcccccccc
Q 044606          322 INLASPPLSVKKVHECP--VCFR----VFSSGQALGGHKRTHV  358 (413)
Q Consensus       322 l~~h~~~h~g~kp~~C~--~C~k----~F~~~~~L~~H~r~H~  358 (413)
                      |+.|.+.+.-++-|.|.  .=|+    .|.....+..|.++-.
T Consensus       259 lk~~~~~~~~e~~~~~~~~r~Gr~s~~~r~~~~~~~~~~~~~~  301 (669)
T KOG2231|consen  259 LKAHNRFIQHEKCYICRPSRPGRPSSRYRGPYRRLESHFRVSD  301 (669)
T ss_pred             HHhhccccchheeccCCcccCCCCcccccCCcccccccccccc
Confidence            44444444446666664  2222    3333334455555443


No 59 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=86.13  E-value=0.22  Score=45.06  Aligned_cols=46  Identities=28%  Similarity=0.474  Sum_probs=38.5

Q ss_pred             eeeeeeEEeeccccccc---cccccccCcccccCCChhhhhhH-HHhhcC
Q 044606           20 LFIIYVYVFFKKRKSLF---VMEKHKCRLCFKNFSNGRALGGH-MRSHML   65 (413)
Q Consensus        20 ~~~~~~~~~~~~~~~~~---~~~~~~C~iC~K~F~~~~~L~~H-mR~Htg   65 (413)
                      -.|.|+++-|..-+..+   ..+-|+|.||.|+.-..--|.+| |.+|..
T Consensus        11 pwcwycnrefddekiliqhqkakhfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhccceeeeehhhhccCCCceeehhhhhhh
Confidence            67999999998888777   34558999999999999999999 677754


No 60 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=85.25  E-value=0.58  Score=27.33  Aligned_cols=20  Identities=25%  Similarity=0.796  Sum_probs=16.7

Q ss_pred             ccCcccccCCChhhhhhHHHh
Q 044606           42 KCRLCFKNFSNGRALGGHMRS   62 (413)
Q Consensus        42 ~C~iC~K~F~~~~~L~~HmR~   62 (413)
                      .||||++.+ ....+..|+..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD~   22 (26)
T smart00734        3 QCPVCFREV-PENLINSHLDS   22 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHHH
Confidence            699999999 66788888763


No 61 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.20  E-value=0.79  Score=36.93  Aligned_cols=30  Identities=20%  Similarity=0.106  Sum_probs=22.2

Q ss_pred             cCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCc
Q 044606          305 YTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSG  347 (413)
Q Consensus       305 ~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~  347 (413)
                      ..|..||+.|...+             ..|-.|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDLn-------------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN-------------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC-------------CCCccCCCCCCccCcc
Confidence            46788887775332             4588899999988777


No 62 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=80.58  E-value=0.67  Score=38.71  Aligned_cols=25  Identities=36%  Similarity=0.542  Sum_probs=16.4

Q ss_pred             cccCcccccCCChhhhhhHHHhhcCCCC
Q 044606           41 HKCRLCFKNFSNGRALGGHMRSHMLNLP   68 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~Htg~~p   68 (413)
                      -.|-+|||.|..   |++|+++|.|..|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eEEccCCcccch---HHHHHHHccCCCH
Confidence            449999999975   6999999999554


No 63 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=76.98  E-value=0.88  Score=43.08  Aligned_cols=25  Identities=36%  Similarity=0.753  Sum_probs=22.0

Q ss_pred             CCCccccCCccccccChhhhhhhhh
Q 044606          273 SRGKYKCETCKKVFKSYQALGGHRA  297 (413)
Q Consensus       273 ~~~~~~C~~C~k~F~~~~~L~~H~~  297 (413)
                      ..|||+|.+|+|.|.....|+.|+.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCceeccccchhhccCccceeccc
Confidence            4599999999999999999999854


No 64 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=76.72  E-value=1.6  Score=26.94  Aligned_cols=10  Identities=30%  Similarity=1.119  Sum_probs=5.7

Q ss_pred             cccCCccccc
Q 044606          277 YKCETCKKVF  286 (413)
Q Consensus       277 ~~C~~C~k~F  286 (413)
                      |.|.+||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            5566666544


No 65 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=76.59  E-value=1.5  Score=46.36  Aligned_cols=16  Identities=19%  Similarity=0.179  Sum_probs=8.8

Q ss_pred             ccCCchhhcccccccc
Q 044606          343 VFSSGQALGGHKRTHV  358 (413)
Q Consensus       343 ~F~~~~~L~~H~r~H~  358 (413)
                      -|.....|..|.|.+|
T Consensus       221 yy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  221 YYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hcccchHHHHHhhhcC
Confidence            3455555666665554


No 66 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=75.79  E-value=1.3  Score=36.58  Aligned_cols=25  Identities=28%  Similarity=0.283  Sum_probs=21.5

Q ss_pred             ccCcccccCCChhhhhhHHHhhcCCCCC
Q 044606           42 KCRLCFKNFSNGRALGGHMRSHMLNLPI   69 (413)
Q Consensus        42 ~C~iC~K~F~~~~~L~~HmR~Htg~~p~   69 (413)
                      .|--|||+|.   +|++|+++|.|..|-
T Consensus        78 icLEDGkkfK---SLKRHL~t~~gmTPd  102 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHYGLTPD  102 (148)
T ss_pred             EEeccCcchH---HHHHHHhcccCCCHH
Confidence            3999999996   799999999996653


No 67 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=75.56  E-value=0.62  Score=48.83  Aligned_cols=28  Identities=29%  Similarity=0.438  Sum_probs=25.4

Q ss_pred             ccccccCcccccCCChhhhhhHHHhhcC
Q 044606           38 MEKHKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        38 ~~~~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      ---|-|..|+|+|-.-.+|..||++|.-
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3447899999999999999999999987


No 68 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=75.28  E-value=1.7  Score=46.83  Aligned_cols=49  Identities=14%  Similarity=0.152  Sum_probs=32.9

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcc
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRV  343 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~  343 (413)
                      ..|..||..+.... ...-+..|...+-..|.+|+...                 ..|+.|+.||-.
T Consensus       436 l~C~~Cg~v~~Cp~-Cd~~lt~H~~~~~L~CH~Cg~~~-----------------~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPN-CDSPLTLHKATGQLRCHYCGYQE-----------------PIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCC-CCcceEEecCCCeeEeCCCCCCC-----------------CCCCCCCCCCCC
Confidence            35888888775432 22334445555677888887643                 679999999864


No 69 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=75.22  E-value=1.4  Score=37.91  Aligned_cols=20  Identities=20%  Similarity=0.318  Sum_probs=12.7

Q ss_pred             ccccCCcCcccCCchhhccc
Q 044606          334 VHECPVCFRVFSSGQALGGH  353 (413)
Q Consensus       334 p~~C~~C~k~F~~~~~L~~H  353 (413)
                      -++|+.||++|...-.+..-
T Consensus        28 ~~~c~~c~~~f~~~e~~~~~   47 (154)
T PRK00464         28 RRECLACGKRFTTFERVELV   47 (154)
T ss_pred             eeeccccCCcceEeEeccCc
Confidence            37777777777766554433


No 70 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=74.36  E-value=2.4  Score=34.81  Aligned_cols=34  Identities=12%  Similarity=-0.015  Sum_probs=22.4

Q ss_pred             cCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhc
Q 044606          305 YTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALG  351 (413)
Q Consensus       305 ~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~  351 (413)
                      ..|+.|++.|...+             ..|-.|+.||..|.-...++
T Consensus        10 r~Cp~cg~kFYDLn-------------k~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300        10 RICPNTGSKFYDLN-------------RRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             ccCCCcCccccccC-------------CCCccCCCcCCccCcchhhc
Confidence            45777777774322             45788888888876664444


No 71 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.85  E-value=1.6  Score=39.72  Aligned_cols=38  Identities=24%  Similarity=0.322  Sum_probs=28.2

Q ss_pred             eeccccccccccccccCcccccCCChhhhhhHHHhhcC
Q 044606           28 FFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        28 ~~~~~~~~~~~~~~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      |+.+......-.+|.|++|+|.|.-......||..=+.
T Consensus        65 ~v~~~~~e~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   65 FVQKNTKEEDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             GEEEEE-SSSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HHHHHHHHHcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            44555556677789999999999999999999998544


No 72 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=73.74  E-value=1.5  Score=40.05  Aligned_cols=24  Identities=29%  Similarity=0.522  Sum_probs=18.0

Q ss_pred             CCccccCCccccccChhhhhhhhh
Q 044606          274 RGKYKCETCKKVFKSYQALGGHRA  297 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~~~L~~H~~  297 (413)
                      ++...|++|++.|.+..-.....+
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIR   26 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCce
Confidence            456899999999988766655554


No 73 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=73.33  E-value=0.9  Score=50.91  Aligned_cols=82  Identities=15%  Similarity=0.099  Sum_probs=47.6

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchh---------------hhhhcCCCCCCCccccCCc
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGAS---------------INLASPPLSVKKVHECPVC  340 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~---------------l~~h~~~h~g~kp~~C~~C  340 (413)
                      -+.|..|.+.|.....+. |+-   -..+|.|..|...|.......               ..-+...+..-++| |..|
T Consensus      1260 e~~c~~~~~~~~~~~~~~-~l~---~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c 1334 (1406)
T KOG1146|consen 1260 EGECGAVDELLTPSFGIS-TLD---VTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLAC 1334 (1406)
T ss_pred             cchhhhccccccCcccee-ecc---cchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHH
Confidence            355666666655554444 321   123455555555553222111               12222334445677 9999


Q ss_pred             CcccCCchhhcccccccccCCC
Q 044606          341 FRVFSSGQALGGHKRTHVTGLV  362 (413)
Q Consensus       341 ~k~F~~~~~L~~H~r~H~~~~~  362 (413)
                      ...|+....|..|||+-.+...
T Consensus      1335 ~~~~~~~~alqihm~~~~~~~k 1356 (1406)
T KOG1146|consen 1335 EVLLSGREALQIHMRSSAHRRK 1356 (1406)
T ss_pred             HhhcchhHHHHHHHHHhhhccc
Confidence            9999999999999997555443


No 74 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=71.33  E-value=6.2  Score=31.90  Aligned_cols=81  Identities=15%  Similarity=0.108  Sum_probs=52.0

Q ss_pred             CCccccCCccccccChhhhhhhhhhcCCCccc------------CCCCCCcccccccchhhhhhcCCCCCCCccccCCcC
Q 044606          274 RGKYKCETCKKVFKSYQALGGHRASHKKIKFY------------TPVQETELDQENAGASINLASPPLSVKKVHECPVCF  341 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~------------~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~  341 (413)
                      +-|..|.+||-+......|.+...---..++|            .|-.|...|........    ..-.....|.|+.|.
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~----~~~~~~~~y~C~~C~   88 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF----DELKDSHRYVCAVCK   88 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc----cccccccceeCCCCC
Confidence            45789999999888888887642211111222            37778777743211100    001224479999999


Q ss_pred             cccCCchhhcccccccc
Q 044606          342 RVFSSGQALGGHKRTHV  358 (413)
Q Consensus       342 k~F~~~~~L~~H~r~H~  358 (413)
                      ..|--.-.+-.|...|.
T Consensus        89 ~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        89 NVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CccccccchhhhhhccC
Confidence            99999888888888886


No 75 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=70.42  E-value=0.91  Score=31.39  Aligned_cols=31  Identities=19%  Similarity=0.255  Sum_probs=24.8

Q ss_pred             CCCCCCccccCCcCcccCCchhhcccccccc
Q 044606          328 PLSVKKVHECPVCFRVFSSGQALGGHKRTHV  358 (413)
Q Consensus       328 ~h~g~kp~~C~~C~k~F~~~~~L~~H~r~H~  358 (413)
                      ...|+--+.|+-||+.|.......+|...-+
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            3456778999999999999999999976433


No 76 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=68.65  E-value=2.4  Score=35.39  Aligned_cols=26  Identities=19%  Similarity=0.223  Sum_probs=21.1

Q ss_pred             eeccccccccccccccCcccccCCCh
Q 044606           28 FFKKRKSLFVMEKHKCRLCFKNFSNG   53 (413)
Q Consensus        28 ~~~~~~~~~~~~~~~C~iC~K~F~~~   53 (413)
                      .++......+.++|+|+-|++.|...
T Consensus        41 ~~k~g~~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          41 VVKIGGIRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             eeeECCccccccccccCCcCcceeee
Confidence            55666666679999999999999754


No 77 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=68.43  E-value=3  Score=36.25  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=6.1

Q ss_pred             CCccccCCcC
Q 044606          332 KKVHECPVCF  341 (413)
Q Consensus       332 ~kp~~C~~C~  341 (413)
                      +-|-.||+||
T Consensus       147 e~P~~CPiCg  156 (166)
T COG1592         147 EAPEVCPICG  156 (166)
T ss_pred             CCCCcCCCCC
Confidence            5566666665


No 78 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=68.39  E-value=3.5  Score=25.70  Aligned_cols=10  Identities=30%  Similarity=0.909  Sum_probs=6.4

Q ss_pred             CccccCCcCc
Q 044606          333 KVHECPVCFR  342 (413)
Q Consensus       333 kp~~C~~C~k  342 (413)
                      .|..|++||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            4567777764


No 79 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=68.05  E-value=3.2  Score=33.40  Aligned_cols=25  Identities=16%  Similarity=0.222  Sum_probs=23.5

Q ss_pred             ccc----CcccccCCChhhhhhHHHhhcC
Q 044606           41 HKC----RLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        41 ~~C----~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      |.|    +.|+..+.+..+++.|+|.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            779    9999999999999999999876


No 80 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=65.30  E-value=3.4  Score=42.86  Aligned_cols=48  Identities=17%  Similarity=0.145  Sum_probs=33.5

Q ss_pred             ccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcc
Q 044606          278 KCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRV  343 (413)
Q Consensus       278 ~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~  343 (413)
                      .|..||...... +....+..|.......|..|+...                 .-|..|+.||-.
T Consensus       215 ~C~~Cg~~~~C~-~C~~~l~~h~~~~~l~Ch~Cg~~~-----------------~~~~~Cp~C~s~  262 (505)
T TIGR00595       215 LCRSCGYILCCP-NCDVSLTYHKKEGKLRCHYCGYQE-----------------PIPKTCPQCGSE  262 (505)
T ss_pred             EhhhCcCccCCC-CCCCceEEecCCCeEEcCCCcCcC-----------------CCCCCCCCCCCC
Confidence            677777665432 234455666677788999998655                 558899999863


No 81 
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=65.05  E-value=3.4  Score=41.03  Aligned_cols=50  Identities=16%  Similarity=0.202  Sum_probs=32.9

Q ss_pred             CCCCCCCCccchhhheeeeeeEEeeccccccc---------------------cccccccCcccccCCChhhhhh
Q 044606            5 SHRKEKPPELTTFKLLFIIYVYVFFKKRKSLF---------------------VMEKHKCRLCFKNFSNGRALGG   58 (413)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------------~~~~~~C~iC~K~F~~~~~L~~   58 (413)
                      .+|+.++||-.+..+    ++|+|+.=+....                     .++-|.||+|+|+|+.--+|+.
T Consensus        76 ~~r~E~~~nGr~~~~----~~YyyInY~~~idvVKyKlh~m~krled~~~d~t~~~~Y~Cp~C~kkyt~Lea~~L  146 (436)
T KOG2593|consen   76 RTRTETAENGRAVDK----HTYYYINYAQVIDVVKYKLHQMRKRLEDRLRDDTNVAGYVCPNCQKKYTSLEALQL  146 (436)
T ss_pred             hhhhhcCCCCcceee----eEEEEeehHHHHHHHHHHHHHHHHHHHHHhhhccccccccCCccccchhhhHHHHh
Confidence            578889996555542    4444443322211                     4566899999999998888753


No 82 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=64.78  E-value=3.2  Score=39.81  Aligned_cols=74  Identities=16%  Similarity=0.142  Sum_probs=43.7

Q ss_pred             cccCCccccccChhhhhhhhhh-cCCCcccCCCCCCcccccccchhhhhhcCC----CCCCCccccCCcCcccCCchhhc
Q 044606          277 YKCETCKKVFKSYQALGGHRAS-HKKIKFYTPVQETELDQENAGASINLASPP----LSVKKVHECPVCFRVFSSGQALG  351 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~----h~g~kp~~C~~C~k~F~~~~~L~  351 (413)
                      -.|-.|....-+...|..||.+ |.=. .-+      ... ..+++.....+.    ....+.-.|-.|.-.|.....|.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~D-l~K------i~s-d~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~  351 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFD-LLK------IQS-DYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLL  351 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhh-HHh------hcc-ccccchhhhhhHHHHHHHHhhccccccccccccCcchhh
Confidence            5899999988889999999985 4310 000      000 001111111110    01123446778889999999999


Q ss_pred             ccccccc
Q 044606          352 GHKRTHV  358 (413)
Q Consensus       352 ~H~r~H~  358 (413)
                      .||.-+.
T Consensus       352 ~hm~e~k  358 (423)
T KOG2482|consen  352 IHMVEDK  358 (423)
T ss_pred             hhccccc
Confidence            9987544


No 83 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=61.78  E-value=5.4  Score=26.59  Aligned_cols=11  Identities=27%  Similarity=0.504  Sum_probs=7.0

Q ss_pred             ccccCCcCccc
Q 044606          334 VHECPVCFRVF  344 (413)
Q Consensus       334 p~~C~~C~k~F  344 (413)
                      .+.|+.||-.+
T Consensus        21 ~~~Cp~CG~~~   31 (46)
T PRK00398         21 GVRCPYCGYRI   31 (46)
T ss_pred             ceECCCCCCeE
Confidence            56777777544


No 84 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=61.58  E-value=3.5  Score=35.49  Aligned_cols=42  Identities=5%  Similarity=-0.099  Sum_probs=21.4

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcccCCCCCCccccccc
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENA  318 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~  318 (413)
                      ++|++||..++..-.-..-..-..-.+.++|+.||+.|....
T Consensus         1 m~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f~~~e   42 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRFTTFE   42 (154)
T ss_pred             CcCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcceEeE
Confidence            479999965522111110000111123488999999886443


No 85 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=60.65  E-value=4.2  Score=43.62  Aligned_cols=47  Identities=13%  Similarity=0.082  Sum_probs=32.0

Q ss_pred             ccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcc
Q 044606          278 KCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRV  343 (413)
Q Consensus       278 ~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~  343 (413)
                      .|..||..+... +....+..|...+...|..||..                  ..|+.|+.||-.
T Consensus       385 ~C~~Cg~~~~C~-~C~~~L~~h~~~~~l~Ch~CG~~------------------~~p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRTPARCR-HCTGPLGLPSAGGTPRCRWCGRA------------------APDWRCPRCGSD  431 (665)
T ss_pred             EhhhCcCeeECC-CCCCceeEecCCCeeECCCCcCC------------------CcCccCCCCcCC
Confidence            688888776543 23344455666677889999853                  248899999864


No 86 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=60.64  E-value=4.4  Score=28.60  Aligned_cols=11  Identities=27%  Similarity=0.525  Sum_probs=8.7

Q ss_pred             CCccccCCcCc
Q 044606          332 KKVHECPVCFR  342 (413)
Q Consensus       332 ~kp~~C~~C~k  342 (413)
                      ..+|.|+.||.
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            45899999984


No 87 
>PF14353 CpXC:  CpXC protein
Probab=59.82  E-value=4  Score=33.84  Aligned_cols=25  Identities=24%  Similarity=0.329  Sum_probs=20.3

Q ss_pred             ccccCCcCcccCCchhhcccccccc
Q 044606          334 VHECPVCFRVFSSGQALGGHKRTHV  358 (413)
Q Consensus       334 p~~C~~C~k~F~~~~~L~~H~r~H~  358 (413)
                      .|.|+.||+.|.-...+..|-..|.
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~D~~~~   62 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYHDPEKK   62 (128)
T ss_pred             EEECCCCCCceecCCCEEEEcCCCC
Confidence            5899999999998888888865543


No 88 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=59.82  E-value=6.7  Score=22.86  Aligned_cols=12  Identities=33%  Similarity=0.631  Sum_probs=8.9

Q ss_pred             ccccCCcCcccC
Q 044606          334 VHECPVCFRVFS  345 (413)
Q Consensus       334 p~~C~~C~k~F~  345 (413)
                      .-.|+.||..|.
T Consensus        14 ~~~Cp~CG~~F~   25 (26)
T PF10571_consen   14 AKFCPHCGYDFE   25 (26)
T ss_pred             cCcCCCCCCCCc
Confidence            346888888885


No 89 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=58.46  E-value=6.3  Score=30.13  Aligned_cols=14  Identities=29%  Similarity=0.750  Sum_probs=8.6

Q ss_pred             ccccCCcCcccCCc
Q 044606          334 VHECPVCFRVFSSG  347 (413)
Q Consensus       334 p~~C~~C~k~F~~~  347 (413)
                      .+.|..||..|.-.
T Consensus        53 IW~C~kCg~~fAGg   66 (89)
T COG1997          53 IWKCRKCGAKFAGG   66 (89)
T ss_pred             eEEcCCCCCeeccc
Confidence            56666677666543


No 90 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=58.27  E-value=5.5  Score=34.49  Aligned_cols=18  Identities=17%  Similarity=0.189  Sum_probs=8.9

Q ss_pred             CccccCCccccccChhhh
Q 044606          275 GKYKCETCKKVFKSYQAL  292 (413)
Q Consensus       275 ~~~~C~~C~k~F~~~~~L  292 (413)
                      .-|.|+.|+..|+.-..+
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CeEECCCCCcEeeHHHHH
Confidence            345555555555544444


No 91 
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=56.91  E-value=5.8  Score=41.10  Aligned_cols=31  Identities=23%  Similarity=0.411  Sum_probs=27.0

Q ss_pred             cccccccccCcccccCCChhhhhhHHHhhcC
Q 044606           35 LFVMEKHKCRLCFKNFSNGRALGGHMRSHML   65 (413)
Q Consensus        35 ~~~~~~~~C~iC~K~F~~~~~L~~HmR~Htg   65 (413)
                      ...-.+++|..||++|.+......||-.|..
T Consensus       413 Ly~~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  413 LYKDSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             hccCCcchhcccccccccchhhhhHhhhhhh
Confidence            3456678999999999999999999999887


No 92 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=56.15  E-value=6.3  Score=34.82  Aligned_cols=16  Identities=25%  Similarity=0.492  Sum_probs=7.4

Q ss_pred             ccccCCccccccChhh
Q 044606          276 KYKCETCKKVFKSYQA  291 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~  291 (413)
                      -|.|+.|++.|+.-..
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            3445555544444433


No 93 
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=55.53  E-value=6.1  Score=38.09  Aligned_cols=70  Identities=23%  Similarity=0.349  Sum_probs=43.9

Q ss_pred             CCccccCC--ccccccChhhhhhhhhh-cCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhh
Q 044606          274 RGKYKCET--CKKVFKSYQALGGHRAS-HKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQAL  350 (413)
Q Consensus       274 ~~~~~C~~--C~k~F~~~~~L~~H~~~-H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L  350 (413)
                      .++|+|.+  |.+.+.....|+.|... |...  ..-          ....-.-|.-.....|+|.|++|.+++.....|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~--i~~----------~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l  414 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSP--ITT----------PTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGL  414 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCC--CCC----------CCCCCCCcceeeeccCcccChhhhhhhccCCCC
Confidence            57899987  99999888888887543 2210  000          000011122223347899999999999888777


Q ss_pred             ccccc
Q 044606          351 GGHKR  355 (413)
Q Consensus       351 ~~H~r  355 (413)
                      +-|..
T Consensus       415 ~~~~~  419 (442)
T KOG4124|consen  415 KYHRT  419 (442)
T ss_pred             Cceee
Confidence            76643


No 94 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=54.65  E-value=5.6  Score=38.23  Aligned_cols=87  Identities=18%  Similarity=0.232  Sum_probs=48.1

Q ss_pred             HHHHHhhhhcCCCCccccCCcc---cccc------ChhhhhhhhhhcCCCccc----CCCCCCcccccccchhhhhhcCC
Q 044606          262 EEFKSFNNKNRSRGKYKCETCK---KVFK------SYQALGGHRASHKKIKFY----TPVQETELDQENAGASINLASPP  328 (413)
Q Consensus       262 ~~~~~~~~~~~~~~~~~C~~C~---k~F~------~~~~L~~H~~~H~~~kp~----~C~~C~~~f~~~~~~~l~~h~~~  328 (413)
                      ..++.|.....  ..+.|.+|-   +.|.      ++..|..|...-..+.-|    .|..|.+.|.  ....|..|++ 
T Consensus       167 k~lk~H~K~~H--~~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FY--dDDEL~~HcR-  241 (493)
T COG5236         167 KELKKHYKAQH--GFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFY--DDDELRRHCR-  241 (493)
T ss_pred             HHHHHHHHhhc--CcEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccceec--ChHHHHHHHH-
Confidence            34455544322  246676663   3443      344555565433222223    4778877763  4555777776 


Q ss_pred             CCCCCccccCCcCc-------ccCCchhhcccccc
Q 044606          329 LSVKKVHECPVCFR-------VFSSGQALGGHKRT  356 (413)
Q Consensus       329 h~g~kp~~C~~C~k-------~F~~~~~L~~H~r~  356 (413)
                         ++.-.|.+|++       -|.....|-.|.+.
T Consensus       242 ---~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~  273 (493)
T COG5236         242 ---LRHEACHICDMVGPIRYQYFKSYEDLEAHFRN  273 (493)
T ss_pred             ---hhhhhhhhhhccCccchhhhhCHHHHHHHhhc
Confidence               44456666654       36677777777663


No 95 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=54.04  E-value=5.5  Score=29.54  Aligned_cols=19  Identities=21%  Similarity=0.614  Sum_probs=14.7

Q ss_pred             CCccccC--CcCcccCCchhh
Q 044606          332 KKVHECP--VCFRVFSSGQAL  350 (413)
Q Consensus       332 ~kp~~C~--~C~k~F~~~~~L  350 (413)
                      ++.+.|.  .||.+|.....+
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEEE
Confidence            6678898  899999876554


No 96 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=53.61  E-value=4.7  Score=37.16  Aligned_cols=37  Identities=11%  Similarity=0.375  Sum_probs=27.9

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccc
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQ  315 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~  315 (413)
                      |.|.+||-+.. +..+.+|+-..++ .-|.|..|++.|.
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~   40 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFE   40 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeecccccc
Confidence            78999997654 4557778877777 6688888888884


No 97 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=53.56  E-value=7.2  Score=25.50  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=4.9

Q ss_pred             ccccCCcCc
Q 044606          334 VHECPVCFR  342 (413)
Q Consensus       334 p~~C~~C~k  342 (413)
                      +-.|+.||.
T Consensus        26 ~~~CP~Cg~   34 (42)
T PF09723_consen   26 PVPCPECGS   34 (42)
T ss_pred             CCcCCCCCC
Confidence            445666654


No 98 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=53.33  E-value=6.1  Score=26.95  Aligned_cols=11  Identities=36%  Similarity=1.201  Sum_probs=6.1

Q ss_pred             cccCCcccccc
Q 044606          277 YKCETCKKVFK  287 (413)
Q Consensus       277 ~~C~~C~k~F~  287 (413)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            55555555554


No 99 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=52.44  E-value=6.6  Score=25.14  Aligned_cols=9  Identities=33%  Similarity=0.866  Sum_probs=4.8

Q ss_pred             ccccCCcCc
Q 044606          334 VHECPVCFR  342 (413)
Q Consensus       334 p~~C~~C~k  342 (413)
                      .-.|+.||.
T Consensus        26 ~~~CP~Cg~   34 (41)
T smart00834       26 LATCPECGG   34 (41)
T ss_pred             CCCCCCCCC
Confidence            345666654


No 100
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=52.36  E-value=5.6  Score=27.61  Aligned_cols=29  Identities=17%  Similarity=0.338  Sum_probs=23.4

Q ss_pred             CCCCccccCCccccccChhhhhhhhhhcC
Q 044606          272 RSRGKYKCETCKKVFKSYQALGGHRASHK  300 (413)
Q Consensus       272 ~~~~~~~C~~C~k~F~~~~~L~~H~~~H~  300 (413)
                      -++--++|+-|+..|.......+|...-.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            35667899999999999999999976433


No 101
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=52.22  E-value=6.2  Score=31.81  Aligned_cols=15  Identities=27%  Similarity=0.507  Sum_probs=12.5

Q ss_pred             ccccccCcccccCCC
Q 044606           38 MEKHKCRLCFKNFSN   52 (413)
Q Consensus        38 ~~~~~C~iC~K~F~~   52 (413)
                      ..|+.|+-||++|--
T Consensus         7 GtKR~Cp~CG~kFYD   21 (108)
T PF09538_consen    7 GTKRTCPSCGAKFYD   21 (108)
T ss_pred             CCcccCCCCcchhcc
Confidence            568899999999953


No 102
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=52.19  E-value=3.2  Score=37.84  Aligned_cols=27  Identities=26%  Similarity=0.506  Sum_probs=22.5

Q ss_pred             cccccCcccccCCChhhhhhHHHh-hcC
Q 044606           39 EKHKCRLCFKNFSNGRALGGHMRS-HML   65 (413)
Q Consensus        39 ~~~~C~iC~K~F~~~~~L~~HmR~-Htg   65 (413)
                      +..+||+|++.|.....+....|. +..
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d   31 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRD   31 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeec
Confidence            467899999999999999888876 443


No 103
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=52.00  E-value=13  Score=31.63  Aligned_cols=19  Identities=26%  Similarity=0.702  Sum_probs=11.7

Q ss_pred             CCCccccCCccccccChhh
Q 044606          273 SRGKYKCETCKKVFKSYQA  291 (413)
Q Consensus       273 ~~~~~~C~~C~k~F~~~~~  291 (413)
                      ...-|.|+.|+..|.....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea  114 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEA  114 (147)
T ss_pred             CCcEEECcCCCCEeeHHHH
Confidence            3445777777777765433


No 104
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=50.88  E-value=4.2  Score=34.01  Aligned_cols=26  Identities=31%  Similarity=0.368  Sum_probs=16.3

Q ss_pred             CCccccCCcCcccCCchhhcccccccccC
Q 044606          332 KKVHECPVCFRVFSSGQALGGHKRTHVTG  360 (413)
Q Consensus       332 ~kp~~C~~C~k~F~~~~~L~~H~r~H~~~  360 (413)
                      ..--.|-+|||.|..   |++|++.|+|-
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCC
Confidence            344679999998876   49999999764


No 105
>PRK05580 primosome assembly protein PriA; Validated
Probab=49.24  E-value=8.8  Score=41.45  Aligned_cols=49  Identities=14%  Similarity=0.172  Sum_probs=30.6

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcc
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRV  343 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~  343 (413)
                      ..|..||..+.... ....+..|...+...|..|+...                 ..|..|+.||..
T Consensus       382 ~~C~~Cg~~~~C~~-C~~~l~~h~~~~~l~Ch~Cg~~~-----------------~~~~~Cp~Cg~~  430 (679)
T PRK05580        382 LLCRDCGWVAECPH-CDASLTLHRFQRRLRCHHCGYQE-----------------PIPKACPECGST  430 (679)
T ss_pred             eEhhhCcCccCCCC-CCCceeEECCCCeEECCCCcCCC-----------------CCCCCCCCCcCC
Confidence            45777776653221 22233445556677888888654                 557899999764


No 106
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=49.15  E-value=11  Score=32.93  Aligned_cols=25  Identities=12%  Similarity=0.062  Sum_probs=21.0

Q ss_pred             CccccCCccccccChhhhhhhhhhcCCCcccCCCCCCc
Q 044606          275 GKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETE  312 (413)
Q Consensus       275 ~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~  312 (413)
                      +.|.|.+||.+             |.|+-|-+|++|+-
T Consensus       133 ~~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            37999999964             66788999999984


No 107
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=48.13  E-value=9.1  Score=40.79  Aligned_cols=22  Identities=23%  Similarity=0.527  Sum_probs=17.5

Q ss_pred             CccccCCcCcccCCchhhcccc
Q 044606          333 KVHECPVCFRVFSSGQALGGHK  354 (413)
Q Consensus       333 kp~~C~~C~k~F~~~~~L~~H~  354 (413)
                      |.-+||.|+..|+...-+..|+
T Consensus       677 RqRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             hcCCCCCCCCCCCcccccccCC
Confidence            4558999999999887776664


No 108
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=47.73  E-value=9.6  Score=24.92  Aligned_cols=17  Identities=18%  Similarity=0.491  Sum_probs=13.7

Q ss_pred             cccCcccccCCChhhhh
Q 044606           41 HKCRLCFKNFSNGRALG   57 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~   57 (413)
                      -.|++||+-|++....+
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            46999999999876543


No 109
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=47.47  E-value=17  Score=31.44  Aligned_cols=44  Identities=14%  Similarity=0.101  Sum_probs=32.0

Q ss_pred             hhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccC
Q 044606          291 ALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFS  345 (413)
Q Consensus       291 ~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~  345 (413)
                      .|..-+...++..-|.|+.|+..|++.....           .-|.|+.||....
T Consensus        96 ~lk~~l~~e~~~~~Y~Cp~c~~r~tf~eA~~-----------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373        96 KLREKLEFETNNMFFICPNMCVRFTFNEAME-----------LNFTCPRCGAMLD  139 (158)
T ss_pred             HHHHHHhhccCCCeEECCCCCcEeeHHHHHH-----------cCCcCCCCCCEee
Confidence            4455555667778899999999887555442           3699999997643


No 110
>KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown]
Probab=47.16  E-value=8.6  Score=30.11  Aligned_cols=41  Identities=22%  Similarity=0.286  Sum_probs=22.5

Q ss_pred             chhhheeeeeeEEeeccccccccccccccCcccccCCChhh
Q 044606           15 TTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRA   55 (413)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~K~F~~~~~   55 (413)
                      +-|.-|||..--+.--+......+-.-.|.||+..|.+...
T Consensus        22 t~FnClfcnHek~v~~~~Dk~~~iG~~sC~iC~esFqt~it   62 (109)
T KOG3214|consen   22 TQFNCLFCNHEKSVSCTLDKKHNIGKASCRICEESFQTTIT   62 (109)
T ss_pred             eeeccCccccccceeeeehhhcCcceeeeeehhhhhccchH
Confidence            44554555544333222222223444569999999987654


No 111
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=47.09  E-value=7.3  Score=27.50  Aligned_cols=11  Identities=27%  Similarity=0.504  Sum_probs=8.8

Q ss_pred             CCccccCCcCc
Q 044606          332 KKVHECPVCFR  342 (413)
Q Consensus       332 ~kp~~C~~C~k  342 (413)
                      ..+|.|+.||-
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            46899999984


No 112
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=46.49  E-value=13  Score=23.40  Aligned_cols=12  Identities=25%  Similarity=0.470  Sum_probs=7.8

Q ss_pred             ccccCCcCcccC
Q 044606          334 VHECPVCFRVFS  345 (413)
Q Consensus       334 p~~C~~C~k~F~  345 (413)
                      ...|+.|+..|.
T Consensus        25 ~v~C~~C~~~~~   36 (38)
T TIGR02098        25 KVRCGKCGHVWY   36 (38)
T ss_pred             EEECCCCCCEEE
Confidence            456777776663


No 113
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=46.31  E-value=12  Score=31.05  Aligned_cols=61  Identities=20%  Similarity=0.193  Sum_probs=36.1

Q ss_pred             CCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchh
Q 044606          272 RSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQA  349 (413)
Q Consensus       272 ~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~  349 (413)
                      ...+.|+|++|..+......|+          |-.|  ||..--..--.+|+.|..+|.     .|++|.-+|.+...
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLK----------PneC--CgY~iCn~Cya~LWK~~~~yp-----vCPvCkTSFKss~~  136 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLK----------PNEC--CGYSICNACYANLWKFCNLYP-----VCPVCKTSFKSSSS  136 (140)
T ss_pred             cCCCceeccCcccccchhhcCC----------cccc--cchHHHHHHHHHHHHHcccCC-----CCCccccccccccc
Confidence            3557899999998766554443          3333  221111111234666665443     79999999987643


No 114
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.20  E-value=12  Score=29.82  Aligned_cols=14  Identities=7%  Similarity=0.131  Sum_probs=11.1

Q ss_pred             CCccccCCcCcccC
Q 044606          332 KKVHECPVCFRVFS  345 (413)
Q Consensus       332 ~kp~~C~~C~k~F~  345 (413)
                      ..|-.|++||++|.
T Consensus        24 rdPiVsPytG~s~P   37 (129)
T COG4530          24 RDPIVSPYTGKSYP   37 (129)
T ss_pred             CCccccCcccccch
Confidence            46888888988884


No 115
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=46.02  E-value=9.7  Score=35.16  Aligned_cols=20  Identities=20%  Similarity=0.426  Sum_probs=9.1

Q ss_pred             CccccCCcCcccCCchhhccc
Q 044606          333 KVHECPVCFRVFSSGQALGGH  353 (413)
Q Consensus       333 kp~~C~~C~k~F~~~~~L~~H  353 (413)
                      .-|.|--|++.|.+ .....|
T Consensus        28 ~~fSCIDC~k~F~~-~sYknH   47 (276)
T KOG2186|consen   28 AYFSCIDCGKTFER-VSYKNH   47 (276)
T ss_pred             CeeEEeeccccccc-chhhhh
Confidence            34455555555544 333444


No 116
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=45.78  E-value=12  Score=31.82  Aligned_cols=41  Identities=10%  Similarity=0.117  Sum_probs=26.0

Q ss_pred             cCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccC
Q 044606          299 HKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFS  345 (413)
Q Consensus       299 H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~  345 (413)
                      -.+..-|.|+.|+..|.+.....+. .    . ..-|.|+.||....
T Consensus        94 e~~~~~Y~Cp~C~~~y~~~ea~~~~-d----~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       94 ETNNAYYKCPNCQSKYTFLEANQLL-D----M-DGTFTCPRCGEELE  134 (147)
T ss_pred             ccCCcEEECcCCCCEeeHHHHHHhc-C----C-CCcEECCCCCCEEE
Confidence            3445679999999988643322211 1    1 23499999998653


No 117
>PHA00626 hypothetical protein
Probab=45.32  E-value=9.7  Score=26.52  Aligned_cols=18  Identities=22%  Similarity=0.124  Sum_probs=15.4

Q ss_pred             cccccccCcccccCCChh
Q 044606           37 VMEKHKCRLCFKNFSNGR   54 (413)
Q Consensus        37 ~~~~~~C~iC~K~F~~~~   54 (413)
                      ..+.|+|+.||-.|+...
T Consensus        20 ~snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         20 WSDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             cCcceEcCCCCCeechhh
Confidence            468999999999998754


No 118
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=44.63  E-value=11  Score=23.84  Aligned_cols=14  Identities=36%  Similarity=0.781  Sum_probs=9.6

Q ss_pred             CCccccCCcCcccC
Q 044606          332 KKVHECPVCFRVFS  345 (413)
Q Consensus       332 ~kp~~C~~C~k~F~  345 (413)
                      .+..+|+.|+-.|.
T Consensus        23 ~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   23 GRKVRCPKCGHVFR   36 (37)
T ss_pred             CcEEECCCCCcEee
Confidence            44677888877764


No 119
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=44.20  E-value=5.7  Score=38.04  Aligned_cols=36  Identities=11%  Similarity=0.089  Sum_probs=14.7

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccc
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQ  315 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~  315 (413)
                      -.|++||.. ...+.|..-..  .|.|-..|..|+..+.
T Consensus       173 g~CPvCGs~-P~~s~l~~~~~--~G~R~L~Cs~C~t~W~  208 (290)
T PF04216_consen  173 GYCPVCGSP-PVLSVLRGGER--EGKRYLHCSLCGTEWR  208 (290)
T ss_dssp             SS-TTT----EEEEEEE--------EEEEEETTT--EEE
T ss_pred             CcCCCCCCc-CceEEEecCCC--CccEEEEcCCCCCeee
Confidence            589999953 22222222211  3667777888876663


No 120
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=43.99  E-value=10  Score=31.26  Aligned_cols=15  Identities=20%  Similarity=0.184  Sum_probs=12.4

Q ss_pred             ccccccCcccccCCC
Q 044606           38 MEKHKCRLCFKNFSN   52 (413)
Q Consensus        38 ~~~~~C~iC~K~F~~   52 (413)
                      ..|+.|+-||++|--
T Consensus         7 GtKr~Cp~cg~kFYD   21 (129)
T TIGR02300         7 GTKRICPNTGSKFYD   21 (129)
T ss_pred             CccccCCCcCccccc
Confidence            468899999999954


No 121
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=43.73  E-value=18  Score=34.82  Aligned_cols=39  Identities=5%  Similarity=0.054  Sum_probs=24.3

Q ss_pred             CCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccc
Q 044606          274 RGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQ  315 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~  315 (413)
                      .....|++||..=. .+ + .+.....|.+-..|..|+..+.
T Consensus       185 ~~~~~CPvCGs~P~-~s-~-v~~~~~~G~RyL~CslC~teW~  223 (309)
T PRK03564        185 EQRQFCPVCGSMPV-SS-V-VQIGTTQGLRYLHCNLCESEWH  223 (309)
T ss_pred             cCCCCCCCCCCcch-hh-e-eeccCCCCceEEEcCCCCCccc
Confidence            34578999996422 12 1 2334456777788888876653


No 122
>COG1773 Rubredoxin [Energy production and conversion]
Probab=43.56  E-value=8.9  Score=26.74  Aligned_cols=13  Identities=23%  Similarity=0.777  Sum_probs=8.8

Q ss_pred             ccccccCcccccC
Q 044606           38 MEKHKCRLCFKNF   50 (413)
Q Consensus        38 ~~~~~C~iC~K~F   50 (413)
                      |.+|+|.+||-.|
T Consensus         1 m~~~~C~~CG~vY   13 (55)
T COG1773           1 MKRWRCSVCGYVY   13 (55)
T ss_pred             CCceEecCCceEe
Confidence            4567777777665


No 123
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=42.55  E-value=21  Score=31.54  Aligned_cols=45  Identities=11%  Similarity=0.110  Sum_probs=31.4

Q ss_pred             hhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCC
Q 044606          291 ALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSS  346 (413)
Q Consensus       291 ~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~  346 (413)
                      .|+.-+..-....-|.|+.|+..|++....           +.-|.|+.||-....
T Consensus       104 klk~~l~~e~~~~~Y~Cp~C~~rytf~eA~-----------~~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        104 KLKEQLEEEENNMFFFCPNCHIRFTFDEAM-----------EYGFRCPQCGEMLEE  148 (178)
T ss_pred             HHHHHhhhccCCCEEECCCCCcEEeHHHHh-----------hcCCcCCCCCCCCee
Confidence            444444455566789999999988755433           347999999976543


No 124
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=41.96  E-value=14  Score=37.51  Aligned_cols=25  Identities=32%  Similarity=0.542  Sum_probs=22.5

Q ss_pred             ccCcccccCCChhhhhhHHHh-hcCC
Q 044606           42 KCRLCFKNFSNGRALGGHMRS-HMLN   66 (413)
Q Consensus        42 ~C~iC~K~F~~~~~L~~HmR~-Htg~   66 (413)
                      .|++|.++|.....+..||.. |.+.
T Consensus        59 iCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   59 ICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eCCcccceeCCHHHHHHHHHHhhhhh
Confidence            399999999999999999995 8873


No 125
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=41.84  E-value=8.6  Score=26.59  Aligned_cols=14  Identities=21%  Similarity=0.536  Sum_probs=8.0

Q ss_pred             ccCcccccCCChhh
Q 044606           42 KCRLCFKNFSNGRA   55 (413)
Q Consensus        42 ~C~iC~K~F~~~~~   55 (413)
                      .||+|++.|.....
T Consensus        22 ~CPlC~r~l~~e~~   35 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR   35 (54)
T ss_dssp             E-TTT--EE-HHHH
T ss_pred             cCCCCCCCCCHHHH
Confidence            89999999986554


No 126
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=41.78  E-value=15  Score=26.61  Aligned_cols=13  Identities=38%  Similarity=0.772  Sum_probs=4.5

Q ss_pred             CccccCCcCcccC
Q 044606          333 KVHECPVCFRVFS  345 (413)
Q Consensus       333 kp~~C~~C~k~F~  345 (413)
                      +.|.|..||+.|=
T Consensus        24 rrhhCr~CG~~vC   36 (69)
T PF01363_consen   24 RRHHCRNCGRVVC   36 (69)
T ss_dssp             -EEE-TTT--EEE
T ss_pred             eeEccCCCCCEEC
Confidence            3445555555543


No 127
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=41.62  E-value=22  Score=33.01  Aligned_cols=88  Identities=19%  Similarity=0.217  Sum_probs=52.3

Q ss_pred             CCCCccccCCccccccChhhhhhhhhhc--CCCcccCCCCCCccccc--------ccchhhhhhcCCCCCCCccccCCcC
Q 044606          272 RSRGKYKCETCKKVFKSYQALGGHRASH--KKIKFYTPVQETELDQE--------NAGASINLASPPLSVKKVHECPVCF  341 (413)
Q Consensus       272 ~~~~~~~C~~C~k~F~~~~~L~~H~~~H--~~~kp~~C~~C~~~f~~--------~~~~~l~~h~~~h~g~kp~~C~~C~  341 (413)
                      .+-+.|+|.+|.. |.-...-..|+.+-  .....|+|..|.+.-..        .-.....+..-.....+++.|+.||
T Consensus       138 hGGrif~CsfC~~-flCEDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg  216 (314)
T PF06524_consen  138 HGGRIFKCSFCDN-FLCEDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCG  216 (314)
T ss_pred             CCCeEEEeecCCC-eeeccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCC
Confidence            3567899999986 44444445676543  22345777666543210        0111111111112335799999999


Q ss_pred             cccCCchhhcccccccccC
Q 044606          342 RVFSSGQALGGHKRTHVTG  360 (413)
Q Consensus       342 k~F~~~~~L~~H~r~H~~~  360 (413)
                      .-......|..-.|+|.=+
T Consensus       217 ~et~eTkdLSmStR~hkyG  235 (314)
T PF06524_consen  217 YETQETKDLSMSTRSHKYG  235 (314)
T ss_pred             Ccccccccceeeeecchhc
Confidence            9988888888888887633


No 128
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=40.73  E-value=12  Score=26.06  Aligned_cols=17  Identities=24%  Similarity=0.430  Sum_probs=12.3

Q ss_pred             cccccc-cCcccccCCCh
Q 044606           37 VMEKHK-CRLCFKNFSNG   53 (413)
Q Consensus        37 ~~~~~~-C~iC~K~F~~~   53 (413)
                      +..+|. ||+|++.|-..
T Consensus        35 ~~~rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   35 PGERYNGCPFCGTPFEFD   52 (55)
T ss_pred             ChhhccCCCCCCCcccCC
Confidence            344454 99999999654


No 129
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=40.69  E-value=19  Score=23.84  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=5.6

Q ss_pred             cccCCcccccc
Q 044606          277 YKCETCKKVFK  287 (413)
Q Consensus       277 ~~C~~C~k~F~  287 (413)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            45555555443


No 130
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=39.95  E-value=13  Score=28.82  Aligned_cols=12  Identities=33%  Similarity=0.622  Sum_probs=8.1

Q ss_pred             ccccccCccccc
Q 044606           38 MEKHKCRLCFKN   49 (413)
Q Consensus        38 ~~~~~C~iC~K~   49 (413)
                      -++|.|++|||.
T Consensus        33 ~~ky~Cp~Cgk~   44 (90)
T PF01780_consen   33 HAKYTCPFCGKT   44 (90)
T ss_dssp             HS-BEESSSSSS
T ss_pred             hCCCcCCCCCCc
Confidence            456778888874


No 131
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=39.23  E-value=14  Score=30.63  Aligned_cols=15  Identities=33%  Similarity=0.859  Sum_probs=13.7

Q ss_pred             ccccCcccccCCChh
Q 044606           40 KHKCRLCFKNFSNGR   54 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~   54 (413)
                      +|+|.-||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            699999999999876


No 132
>PRK01343 zinc-binding protein; Provisional
Probab=38.85  E-value=16  Score=25.77  Aligned_cols=14  Identities=21%  Similarity=0.358  Sum_probs=11.2

Q ss_pred             cccccCcccccCCC
Q 044606           39 EKHKCRLCFKNFSN   52 (413)
Q Consensus        39 ~~~~C~iC~K~F~~   52 (413)
                      ....|++|+|.|.+
T Consensus         8 p~~~CP~C~k~~~~   21 (57)
T PRK01343          8 PTRPCPECGKPSTR   21 (57)
T ss_pred             CCCcCCCCCCcCcC
Confidence            34679999999864


No 133
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=37.88  E-value=18  Score=22.74  Aligned_cols=12  Identities=33%  Similarity=0.747  Sum_probs=8.6

Q ss_pred             CccccCCcCccc
Q 044606          333 KVHECPVCFRVF  344 (413)
Q Consensus       333 kp~~C~~C~k~F  344 (413)
                      +..+|+.|+..|
T Consensus        24 ~~v~C~~C~~~f   35 (36)
T PF13717_consen   24 RKVRCSKCGHVF   35 (36)
T ss_pred             cEEECCCCCCEe
Confidence            456788887776


No 134
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=37.65  E-value=16  Score=31.99  Aligned_cols=55  Identities=20%  Similarity=0.396  Sum_probs=31.0

Q ss_pred             CCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCch
Q 044606          272 RSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQ  348 (413)
Q Consensus       272 ~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~  348 (413)
                      ..+..|+|++|--.|..+.-              .-..||..|-......+   .     .+..+|++|+|....+.
T Consensus       127 ~~~~~~~CPiCl~~~sek~~--------------vsTkCGHvFC~~Cik~a---l-----k~~~~CP~C~kkIt~k~  181 (187)
T KOG0320|consen  127 RKEGTYKCPICLDSVSEKVP--------------VSTKCGHVFCSQCIKDA---L-----KNTNKCPTCRKKITHKQ  181 (187)
T ss_pred             ccccccCCCceecchhhccc--------------cccccchhHHHHHHHHH---H-----HhCCCCCCcccccchhh
Confidence            34556999999877654432              22346655531111111   1     34679999998554443


No 135
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=37.45  E-value=27  Score=21.46  Aligned_cols=9  Identities=33%  Similarity=0.759  Sum_probs=4.4

Q ss_pred             ccccCCcCc
Q 044606          334 VHECPVCFR  342 (413)
Q Consensus       334 p~~C~~C~k  342 (413)
                      +-.|+.||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            345666653


No 136
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=37.13  E-value=12  Score=22.29  Aligned_cols=19  Identities=32%  Similarity=0.711  Sum_probs=12.9

Q ss_pred             cccCcccccCCChhhhhhHH
Q 044606           41 HKCRLCFKNFSNGRALGGHM   60 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~Hm   60 (413)
                      |.|--|++.| ....-+.|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            5799999999 555555554


No 137
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=37.08  E-value=11  Score=30.14  Aligned_cols=25  Identities=24%  Similarity=0.388  Sum_probs=23.1

Q ss_pred             ccc----CCcCcccCCchhhccccccccc
Q 044606          335 HEC----PVCFRVFSSGQALGGHKRTHVT  359 (413)
Q Consensus       335 ~~C----~~C~k~F~~~~~L~~H~r~H~~  359 (413)
                      |.|    ..|+..+.+...+.+|++.+++
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998775


No 138
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=36.35  E-value=11  Score=24.41  Aligned_cols=11  Identities=18%  Similarity=0.549  Sum_probs=9.6

Q ss_pred             ccccCcccccC
Q 044606           40 KHKCRLCFKNF   50 (413)
Q Consensus        40 ~~~C~iC~K~F   50 (413)
                      .-.|++|+.+|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            56899999988


No 139
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=36.17  E-value=17  Score=36.61  Aligned_cols=22  Identities=32%  Similarity=0.596  Sum_probs=20.7

Q ss_pred             cccCcccccCCChhhhhhHHHh
Q 044606           41 HKCRLCFKNFSNGRALGGHMRS   62 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~~HmR~   62 (413)
                      +-|.+|.|+|.+.-.|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999999999877


No 140
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=35.94  E-value=29  Score=32.02  Aligned_cols=13  Identities=15%  Similarity=0.920  Sum_probs=9.4

Q ss_pred             CCccccCCccccc
Q 044606          274 RGKYKCETCKKVF  286 (413)
Q Consensus       274 ~~~~~C~~C~k~F  286 (413)
                      .+.|.|..|...+
T Consensus       110 drqFaC~~Cd~~W  122 (278)
T PF15135_consen  110 DRQFACSSCDHMW  122 (278)
T ss_pred             ceeeeccccchHH
Confidence            4778888887554


No 141
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=35.93  E-value=12  Score=34.42  Aligned_cols=33  Identities=15%  Similarity=0.196  Sum_probs=0.0

Q ss_pred             cccccccCcccccCCChhhhhhHHHhhcCCCCCC
Q 044606           37 VMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIP   70 (413)
Q Consensus        37 ~~~~~~C~iC~K~F~~~~~L~~HmR~Htg~~p~~   70 (413)
                      ...-..|||||+..+ ..-|..|||+.....-|+
T Consensus       165 ~~~~~~cPitGe~IP-~~e~~eHmRi~LlDP~wk  197 (229)
T PF12230_consen  165 KEKMIICPITGEMIP-ADEMDEHMRIELLDPRWK  197 (229)
T ss_dssp             ----------------------------------
T ss_pred             ccccccccccccccc-cccccccccccccccccc
Confidence            455578999999887 467999999999966563


No 142
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=35.68  E-value=17  Score=23.41  Aligned_cols=14  Identities=36%  Similarity=0.645  Sum_probs=12.1

Q ss_pred             ccccCcccccCCCh
Q 044606           40 KHKCRLCFKNFSNG   53 (413)
Q Consensus        40 ~~~C~iC~K~F~~~   53 (413)
                      +++|..|++.|=..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            89999999999654


No 143
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=35.53  E-value=23  Score=27.32  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=7.4

Q ss_pred             CccccCCcccccc
Q 044606          275 GKYKCETCKKVFK  287 (413)
Q Consensus       275 ~~~~C~~C~k~F~  287 (413)
                      +|-.|..||..|.
T Consensus        57 ~Pa~CkkCGfef~   69 (97)
T COG3357          57 RPARCKKCGFEFR   69 (97)
T ss_pred             cChhhcccCcccc
Confidence            4555666665554


No 144
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=35.52  E-value=17  Score=29.69  Aligned_cols=29  Identities=24%  Similarity=0.432  Sum_probs=26.0

Q ss_pred             cccccccCcccccCCChhhhhhHHHh--hcC
Q 044606           37 VMEKHKCRLCFKNFSNGRALGGHMRS--HML   65 (413)
Q Consensus        37 ~~~~~~C~iC~K~F~~~~~L~~HmR~--Htg   65 (413)
                      ++-+|-|-.|.|-|.+..+|+.|.|+  |-.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK~HKr   84 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTKVHKR   84 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhccHHHH
Confidence            67889999999999999999999997  544


No 145
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=35.50  E-value=21  Score=22.80  Aligned_cols=24  Identities=25%  Similarity=0.524  Sum_probs=9.8

Q ss_pred             ccccccCcccccCCChhh-h-hhHHH
Q 044606           38 MEKHKCRLCFKNFSNGRA-L-GGHMR   61 (413)
Q Consensus        38 ~~~~~C~iC~K~F~~~~~-L-~~HmR   61 (413)
                      |.+|=|.+|.+-|++.+. - +.|.+
T Consensus         1 m~ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    1 MPRYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             --S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             CcCeecccccceecCCChHHHHHhhc
Confidence            678999999999966653 3 45544


No 146
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=34.34  E-value=18  Score=20.73  Aligned_cols=11  Identities=18%  Similarity=0.205  Sum_probs=9.0

Q ss_pred             ccccccCcccc
Q 044606           38 MEKHKCRLCFK   48 (413)
Q Consensus        38 ~~~~~C~iC~K   48 (413)
                      .-.|.||-||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            45799999985


No 147
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=34.27  E-value=20  Score=24.44  Aligned_cols=11  Identities=36%  Similarity=1.053  Sum_probs=7.2

Q ss_pred             ccccCCccccc
Q 044606          276 KYKCETCKKVF  286 (413)
Q Consensus       276 ~~~C~~C~k~F  286 (413)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            46676777666


No 148
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=34.26  E-value=18  Score=28.01  Aligned_cols=12  Identities=33%  Similarity=0.578  Sum_probs=8.9

Q ss_pred             ccccccCccccc
Q 044606           38 MEKHKCRLCFKN   49 (413)
Q Consensus        38 ~~~~~C~iC~K~   49 (413)
                      -++|.|++|+|.
T Consensus        33 ~a~y~CpfCgk~   44 (91)
T TIGR00280        33 KAKYVCPFCGKK   44 (91)
T ss_pred             hcCccCCCCCCC
Confidence            456889999763


No 149
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.87  E-value=27  Score=23.98  Aligned_cols=14  Identities=43%  Similarity=0.925  Sum_probs=8.1

Q ss_pred             CccccCCcCcccCC
Q 044606          333 KVHECPVCFRVFSS  346 (413)
Q Consensus       333 kp~~C~~C~k~F~~  346 (413)
                      +.+.|..||+.|-.
T Consensus        17 rk~~Cr~Cg~~~C~   30 (57)
T cd00065          17 RRHHCRNCGRIFCS   30 (57)
T ss_pred             cccccCcCcCCcCh
Confidence            44566666666554


No 150
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=33.53  E-value=19  Score=27.91  Aligned_cols=11  Identities=36%  Similarity=0.561  Sum_probs=8.5

Q ss_pred             ccccccCcccc
Q 044606           38 MEKHKCRLCFK   48 (413)
Q Consensus        38 ~~~~~C~iC~K   48 (413)
                      -.+|.|++|+|
T Consensus        34 ~a~y~CpfCgk   44 (90)
T PTZ00255         34 HAKYFCPFCGK   44 (90)
T ss_pred             hCCccCCCCCC
Confidence            45688999976


No 151
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=33.52  E-value=22  Score=22.40  Aligned_cols=16  Identities=25%  Similarity=0.351  Sum_probs=10.5

Q ss_pred             cccCcccccCCChhhh
Q 044606           41 HKCRLCFKNFSNGRAL   56 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L   56 (413)
                      -.|+-|+|.|-+++.-
T Consensus         3 ~~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    3 GLCPRCGKGFHWASEC   18 (36)
T ss_dssp             -C-TTTSSSCS-TTT-
T ss_pred             ccCcccCCCcchhhhh
Confidence            3599999999998765


No 152
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.48  E-value=15  Score=26.15  Aligned_cols=11  Identities=18%  Similarity=0.603  Sum_probs=9.4

Q ss_pred             ccCcccccCCC
Q 044606           42 KCRLCFKNFSN   52 (413)
Q Consensus        42 ~C~iC~K~F~~   52 (413)
                      .|++|+++|.-
T Consensus        50 ~CPYC~t~y~l   60 (62)
T COG4391          50 VCPYCSTRYRL   60 (62)
T ss_pred             ecCccccEEEe
Confidence            49999999964


No 153
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=33.42  E-value=14  Score=36.18  Aligned_cols=79  Identities=20%  Similarity=0.302  Sum_probs=45.7

Q ss_pred             ccccCCccccccChhhhhhhhhh--cCC---CcccCCCCCCcccccccchhhhhh----cCCCCCCCccccCCcCcccCC
Q 044606          276 KYKCETCKKVFKSYQALGGHRAS--HKK---IKFYTPVQETELDQENAGASINLA----SPPLSVKKVHECPVCFRVFSS  346 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~--H~~---~kp~~C~~C~~~f~~~~~~~l~~h----~~~h~g~kp~~C~~C~k~F~~  346 (413)
                      -|.|.-|...|.....-+.|+++  |.-   .+.+.-  -+..+..+....+-..    ...-.+.-++.|.+|.|.|..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~l--PPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s   80 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASL--PPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFAS   80 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcC--CCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccC
Confidence            48999999999999888888874  431   111111  1111110010000000    001223557999999999999


Q ss_pred             chhhcccccc
Q 044606          347 GQALGGHKRT  356 (413)
Q Consensus       347 ~~~L~~H~r~  356 (413)
                      ..+-..|+..
T Consensus        81 ~~a~~~hl~S   90 (390)
T KOG2785|consen   81 PKAHENHLKS   90 (390)
T ss_pred             hhhHHHHHHH
Confidence            8888888653


No 154
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=33.23  E-value=21  Score=28.19  Aligned_cols=17  Identities=29%  Similarity=0.679  Sum_probs=14.5

Q ss_pred             ccccCcccccCCChhhh
Q 044606           40 KHKCRLCFKNFSNGRAL   56 (413)
Q Consensus        40 ~~~C~iC~K~F~~~~~L   56 (413)
                      +|.|.-||..|...+.+
T Consensus         2 pH~CtrCG~vf~~g~~~   18 (112)
T COG3364           2 PHQCTRCGEVFDDGSEE   18 (112)
T ss_pred             CceecccccccccccHH
Confidence            69999999999997543


No 155
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.67  E-value=15  Score=24.63  Aligned_cols=17  Identities=24%  Similarity=0.556  Sum_probs=13.5

Q ss_pred             cccCcccccCCChhhhh
Q 044606           41 HKCRLCFKNFSNGRALG   57 (413)
Q Consensus        41 ~~C~iC~K~F~~~~~L~   57 (413)
                      --|++|++-|++..--+
T Consensus        13 KICpvCqRPFsWRkKW~   29 (54)
T COG4338          13 KICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhhcCchHHHHHHH
Confidence            35999999999876544


No 156
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=32.03  E-value=22  Score=29.51  Aligned_cols=11  Identities=0%  Similarity=-0.421  Sum_probs=7.6

Q ss_pred             ccCCCCCCccc
Q 044606          304 FYTPVQETELD  314 (413)
Q Consensus       304 p~~C~~C~~~f  314 (413)
                      |++|..|++.|
T Consensus         1 PH~Ct~Cg~~f   11 (131)
T PF09845_consen    1 PHQCTKCGRVF   11 (131)
T ss_pred             CcccCcCCCCc
Confidence            56677777766


No 157
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=31.84  E-value=21  Score=27.68  Aligned_cols=12  Identities=33%  Similarity=0.731  Sum_probs=8.6

Q ss_pred             ccccccCccccc
Q 044606           38 MEKHKCRLCFKN   49 (413)
Q Consensus        38 ~~~~~C~iC~K~   49 (413)
                      -++|.|++|+|.
T Consensus        34 ~a~y~CpfCgk~   45 (90)
T PRK03976         34 RAKHVCPVCGRP   45 (90)
T ss_pred             hcCccCCCCCCC
Confidence            456889998763


No 158
>PRK12496 hypothetical protein; Provisional
Probab=30.97  E-value=27  Score=30.40  Aligned_cols=11  Identities=0%  Similarity=-0.532  Sum_probs=8.8

Q ss_pred             ccCCCCCCccc
Q 044606          304 FYTPVQETELD  314 (413)
Q Consensus       304 p~~C~~C~~~f  314 (413)
                      -|.|..|++.|
T Consensus       127 ~~~C~gC~~~~  137 (164)
T PRK12496        127 RKVCKGCKKKY  137 (164)
T ss_pred             eEECCCCCccc
Confidence            47788888877


No 159
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=30.54  E-value=29  Score=28.86  Aligned_cols=13  Identities=8%  Similarity=-0.205  Sum_probs=6.3

Q ss_pred             cccCCCCCCcccc
Q 044606          303 KFYTPVQETELDQ  315 (413)
Q Consensus       303 kp~~C~~C~~~f~  315 (413)
                      .-|+|..|++.|.
T Consensus        52 qRyrC~~C~~tf~   64 (129)
T COG3677          52 QRYKCKSCGSTFT   64 (129)
T ss_pred             cccccCCcCccee
Confidence            3455555555543


No 161
>KOG4377 consensus Zn-finger protein [General function prediction only]
Probab=30.49  E-value=31  Score=34.17  Aligned_cols=85  Identities=18%  Similarity=0.188  Sum_probs=53.6

Q ss_pred             cccC--CccccccChhhhhhhhhhcCCCc-------ccCCCCCCcccccccchhhhhhcCCCCCCC--------------
Q 044606          277 YKCE--TCKKVFKSYQALGGHRASHKKIK-------FYTPVQETELDQENAGASINLASPPLSVKK--------------  333 (413)
Q Consensus       277 ~~C~--~C~k~F~~~~~L~~H~~~H~~~k-------p~~C~~C~~~f~~~~~~~l~~h~~~h~g~k--------------  333 (413)
                      |.|.  .|.|   +.+++..|...|+...       -|.|.-|++.+++.-...-..|.+-+.++.              
T Consensus       314 yhC~~~~C~k---sTsdV~~h~nFht~~~n~GfrrthfhC~r~gCTdtfK~~khk~yh~kdda~~~dGfkkf~k~e~cay  390 (480)
T KOG4377|consen  314 YHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHFHCQRIGCTDTFKDSKHKPYHYKDDAGEIDGFKKFFKDENCAY  390 (480)
T ss_pred             chhhhcccCc---ccccccccCccccccccCceecceeEEeccCCccccccccccccccCcchhhhhhhhhhhccccCCc
Confidence            6776  4888   5677888888886532       367888887776553332233333333221              


Q ss_pred             ----------ccccC--CcCcccCCchhhcccccccccCCCCC
Q 044606          334 ----------VHECP--VCFRVFSSGQALGGHKRTHVTGLVAS  364 (413)
Q Consensus       334 ----------p~~C~--~C~k~F~~~~~L~~H~r~H~~~~~~~  364 (413)
                                .|.|.  -|+.+|...+.+..|.|.|....++.
T Consensus       391 ~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkrkheRqeqge  433 (480)
T KOG4377|consen  391 TGCKYSGICNHFHCDRLGCEATLYSVSQMASHKRKHERQEQGE  433 (480)
T ss_pred             cCcccccceeeeeecccCCceEEEehhhhhhhhhhhhhhhhcc
Confidence                      12232  27889999999999999987654443


No 162
>PRK04023 DNA polymerase II large subunit; Validated
Probab=30.04  E-value=36  Score=37.87  Aligned_cols=11  Identities=45%  Similarity=1.056  Sum_probs=8.0

Q ss_pred             CccccCCcccc
Q 044606          275 GKYKCETCKKV  285 (413)
Q Consensus       275 ~~~~C~~C~k~  285 (413)
                      ....|..||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            45678888876


No 163
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=29.43  E-value=24  Score=29.40  Aligned_cols=25  Identities=32%  Similarity=0.336  Sum_probs=21.0

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcc
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKF  304 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp  304 (413)
                      ..|-.|||.|.+   |++|+.+|-|--|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            579999999964   9999999988544


No 164
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=29.40  E-value=28  Score=29.21  Aligned_cols=16  Identities=19%  Similarity=0.493  Sum_probs=12.2

Q ss_pred             CCccccCCccccccCh
Q 044606          274 RGKYKCETCKKVFKSY  289 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~  289 (413)
                      ...+.|..||..|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3568999999888654


No 165
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=29.13  E-value=39  Score=28.80  Aligned_cols=9  Identities=33%  Similarity=0.907  Sum_probs=5.6

Q ss_pred             ccccCCcCc
Q 044606          334 VHECPVCFR  342 (413)
Q Consensus       334 p~~C~~C~k  342 (413)
                      .-.|+.||.
T Consensus       130 l~~Cp~C~~  138 (146)
T PF07295_consen  130 LPPCPKCGH  138 (146)
T ss_pred             CCCCCCCCC
Confidence            346777764


No 166
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=28.79  E-value=23  Score=35.47  Aligned_cols=32  Identities=28%  Similarity=0.500  Sum_probs=26.5

Q ss_pred             ccccccccccCcccccCCChhhhhhHHHh-hcC
Q 044606           34 SLFVMEKHKCRLCFKNFSNGRALGGHMRS-HML   65 (413)
Q Consensus        34 ~~~~~~~~~C~iC~K~F~~~~~L~~HmR~-Htg   65 (413)
                      +....+=|.||||.+.|.+-..|.-|.-. |.+
T Consensus         9 s~~i~egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen    9 SGEILEGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             cchhhhcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            34456778999999999999999999966 554


No 167
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=28.06  E-value=24  Score=36.68  Aligned_cols=29  Identities=17%  Similarity=0.300  Sum_probs=24.9

Q ss_pred             CCCccccCCcCcccCCchhhccccccccc
Q 044606          331 VKKVHECPVCFRVFSSGQALGGHKRTHVT  359 (413)
Q Consensus       331 g~kp~~C~~C~k~F~~~~~L~~H~r~H~~  359 (413)
                      ..+|..|..||++|.......+||-+|..
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhh
Confidence            35689999999999999999998888763


No 168
>PHA02446 hypothetical protein
Probab=27.58  E-value=35  Score=27.57  Aligned_cols=45  Identities=27%  Similarity=0.428  Sum_probs=30.8

Q ss_pred             cCCCCCCCCccchhhheeeeeeEEeeccccccccccccccCccccc
Q 044606            4 LSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKN   49 (413)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~K~   49 (413)
                      |-.|.-|-|++.+-++-||+ +.-+-..+.-....+.-+|++||..
T Consensus        27 lvrrrp~lpevelarr~~ct-vrtierdra~lp~a~~q~cp~cg~d   71 (166)
T PHA02446         27 LVRRRPNLPEVELARRSFCT-VRTIERDRADLPDAEQQQCPLCGQD   71 (166)
T ss_pred             HHhcCCCCchhHHhhhccce-eEeeecccccCchhhhhcCCCcccc
Confidence            44577788999988877765 3333344444556777889999973


No 169
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=27.05  E-value=13  Score=33.92  Aligned_cols=28  Identities=18%  Similarity=0.432  Sum_probs=19.0

Q ss_pred             CCccccCCcCcccCCchhhccccccccc
Q 044606          332 KKVHECPVCFRVFSSGQALGGHKRTHVT  359 (413)
Q Consensus       332 ~kp~~C~~C~k~F~~~~~L~~H~r~H~~  359 (413)
                      +..|.|++|+|.|.-..-..+|+..-|.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            4458888888888888888888775543


No 170
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=27.03  E-value=21  Score=27.01  Aligned_cols=12  Identities=33%  Similarity=0.650  Sum_probs=9.3

Q ss_pred             ccccccCccccc
Q 044606           38 MEKHKCRLCFKN   49 (413)
Q Consensus        38 ~~~~~C~iC~K~   49 (413)
                      -.+|.|.+|||.
T Consensus        34 haky~CsfCGK~   45 (92)
T KOG0402|consen   34 HAKYTCSFCGKK   45 (92)
T ss_pred             hhhhhhhhcchh
Confidence            346889999984


No 171
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=26.62  E-value=25  Score=34.02  Aligned_cols=75  Identities=16%  Similarity=0.071  Sum_probs=48.9

Q ss_pred             cccCCccccccChhhhhhhhhhcCCCcccCCCCCCccc-----ccccchhhhhhcCCCCCCCccccCC--c--C--cccC
Q 044606          277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELD-----QENAGASINLASPPLSVKKVHECPV--C--F--RVFS  345 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f-----~~~~~~~l~~h~~~h~g~kp~~C~~--C--~--k~F~  345 (413)
                      -.|..|.+.|.....|.+|+|... ++   |-+|.+.-     .+..-..|..|-+    .-.|.|.+  |  |  ..|.
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~H-E~---ChICD~v~p~~~QYFK~Y~~Le~HF~----~~hy~ct~qtc~~~k~~vf~  292 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRH-EA---CHICDMVGPIRYQYFKSYEDLEAHFR----NAHYCCTFQTCRVGKCYVFP  292 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhh-hh---hhhhhccCccchhhhhCHHHHHHHhh----cCceEEEEEEEecCcEEEec
Confidence            469999999999999999988644 34   44554332     1233344666654    33567754  4  3  3788


Q ss_pred             Cchhhccccccccc
Q 044606          346 SGQALGGHKRTHVT  359 (413)
Q Consensus       346 ~~~~L~~H~r~H~~  359 (413)
                      ....|..|+-.-++
T Consensus       293 ~~~el~~h~~~~h~  306 (493)
T COG5236         293 YHTELLEHLTRFHK  306 (493)
T ss_pred             cHHHHHHHHHHHhh
Confidence            88889999754443


No 172
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=26.35  E-value=12  Score=33.54  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=16.8

Q ss_pred             cccCCccccccChhhhhhhhh
Q 044606          277 YKCETCKKVFKSYQALGGHRA  297 (413)
Q Consensus       277 ~~C~~C~k~F~~~~~L~~H~~  297 (413)
                      ..|.+|.+.|.+...|..|+.
T Consensus       107 ~sCs~C~r~~Pt~hLLd~HI~  127 (253)
T KOG4173|consen  107 NSCSFCKRAFPTGHLLDAHIL  127 (253)
T ss_pred             chhHHHHHhCCchhhhhHHHH
Confidence            478888888888888888864


No 173
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=26.26  E-value=51  Score=31.80  Aligned_cols=37  Identities=5%  Similarity=0.064  Sum_probs=21.2

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCCCCccc
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELD  314 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f  314 (413)
                      ...|++||..= ..+ +.+.-....|.|-..|..|+..+
T Consensus       184 ~~~CPvCGs~P-~~s-~~~~~~~~~G~RyL~CslC~teW  220 (305)
T TIGR01562       184 RTLCPACGSPP-VAS-MVRQGGKETGLRYLSCSLCATEW  220 (305)
T ss_pred             CCcCCCCCChh-hhh-hhcccCCCCCceEEEcCCCCCcc
Confidence            45899999642 111 11111125667777888887665


No 174
>PTZ00448 hypothetical protein; Provisional
Probab=26.20  E-value=49  Score=32.51  Aligned_cols=24  Identities=29%  Similarity=0.463  Sum_probs=22.0

Q ss_pred             cccccCcccccCCChhhhhhHHHh
Q 044606           39 EKHKCRLCFKNFSNGRALGGHMRS   62 (413)
Q Consensus        39 ~~~~C~iC~K~F~~~~~L~~HmR~   62 (413)
                      -.|+|..|+-.|.+...-+.|||+
T Consensus       313 ~~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        313 NMLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CCccccccccccCCHHHHHHHhhh
Confidence            368999999999999999999998


No 175
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=26.14  E-value=37  Score=28.82  Aligned_cols=21  Identities=19%  Similarity=0.550  Sum_probs=16.2

Q ss_pred             CCccccCCcCcccCCchhhcc
Q 044606          332 KKVHECPVCFRVFSSGQALGG  352 (413)
Q Consensus       332 ~kp~~C~~C~k~F~~~~~L~~  352 (413)
                      +.-+.|+.|||.|-..++..+
T Consensus       122 ~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  122 DEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CeEEECCCCCCEecccccHHH
Confidence            346789999999988876654


No 176
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=26.05  E-value=66  Score=21.26  Aligned_cols=10  Identities=20%  Similarity=0.570  Sum_probs=5.3

Q ss_pred             CccccCCcCc
Q 044606          333 KVHECPVCFR  342 (413)
Q Consensus       333 kp~~C~~C~k  342 (413)
                      ..|+|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            3455555554


No 177
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=25.94  E-value=29  Score=24.26  Aligned_cols=13  Identities=31%  Similarity=0.659  Sum_probs=6.0

Q ss_pred             cccccccCccccc
Q 044606           37 VMEKHKCRLCFKN   49 (413)
Q Consensus        37 ~~~~~~C~iC~K~   49 (413)
                      ..++|.|++||-+
T Consensus        30 vLr~y~Cp~CgAt   42 (55)
T PF05741_consen   30 VLRKYVCPICGAT   42 (55)
T ss_dssp             TGGG---TTT---
T ss_pred             HHhcCcCCCCcCc
Confidence            5788999999975


No 178
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=25.76  E-value=20  Score=25.31  Aligned_cols=12  Identities=33%  Similarity=0.553  Sum_probs=6.7

Q ss_pred             cccCcccccCCC
Q 044606           41 HKCRLCFKNFSN   52 (413)
Q Consensus        41 ~~C~iC~K~F~~   52 (413)
                      ..||+|+|.+.+
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            579999998877


No 179
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=25.75  E-value=27  Score=34.20  Aligned_cols=56  Identities=16%  Similarity=0.262  Sum_probs=25.4

Q ss_pred             CccccCCccccccChhhh---hhhh-hhcCCC-cccCCCCCCcccccccchhhhhhcCCCCCCCc-cccCCcCcc
Q 044606          275 GKYKCETCKKVFKSYQAL---GGHR-ASHKKI-KFYTPVQETELDQENAGASINLASPPLSVKKV-HECPVCFRV  343 (413)
Q Consensus       275 ~~~~C~~C~k~F~~~~~L---~~H~-~~H~~~-kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp-~~C~~C~k~  343 (413)
                      +-+.|.+|.+++......   ..|. ..|... +.|+|..|+.......             .-| ..|..||-.
T Consensus       251 kav~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~sl~-------------r~P~~~C~~Cg~~  312 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTISLE-------------RLPKKHCSNCGSS  312 (344)
T ss_dssp             EEEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEESS-------------SS--S--TTT-S-
T ss_pred             EEEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeeecc-------------cCCCCCCCcCCcC
Confidence            458899998776655543   3342 334444 5689999997654221             112 479889864


No 180
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=25.67  E-value=22  Score=23.32  Aligned_cols=14  Identities=36%  Similarity=0.631  Sum_probs=9.1

Q ss_pred             cccccCcccccCCC
Q 044606           39 EKHKCRLCFKNFSN   52 (413)
Q Consensus        39 ~~~~C~iC~K~F~~   52 (413)
                      -+++|+.|++.|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            47899999999854


No 181
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=25.15  E-value=29  Score=27.38  Aligned_cols=20  Identities=30%  Similarity=0.338  Sum_probs=13.9

Q ss_pred             cCCCCCCCccccCCcCcccCC
Q 044606          326 SPPLSVKKVHECPVCFRVFSS  346 (413)
Q Consensus       326 ~~~h~g~kp~~C~~C~k~F~~  346 (413)
                      +..+.| +|+.|..||..|.-
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEE
Confidence            334455 68888889888753


No 182
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.13  E-value=29  Score=25.84  Aligned_cols=10  Identities=40%  Similarity=1.215  Sum_probs=5.8

Q ss_pred             cccCCccccc
Q 044606          277 YKCETCKKVF  286 (413)
Q Consensus       277 ~~C~~C~k~F  286 (413)
                      |+|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            5666666544


No 183
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=24.19  E-value=28  Score=37.21  Aligned_cols=24  Identities=21%  Similarity=0.392  Sum_probs=20.4

Q ss_pred             cccccccCcccccCCChhhhhhHH
Q 044606           37 VMEKHKCRLCFKNFSNGRALGGHM   60 (413)
Q Consensus        37 ~~~~~~C~iC~K~F~~~~~L~~Hm   60 (413)
                      ..+.-+||.|+..|+-...+..||
T Consensus       675 etRqRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  675 ETRQRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             HHhcCCCCCCCCCCCcccccccCC
Confidence            566778999999999998887775


No 184
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=23.90  E-value=49  Score=20.85  Aligned_cols=11  Identities=18%  Similarity=0.295  Sum_probs=5.6

Q ss_pred             cccCCcCcccC
Q 044606          335 HECPVCFRVFS  345 (413)
Q Consensus       335 ~~C~~C~k~F~  345 (413)
                      -.|..||-.+.
T Consensus        22 ~~Cd~cg~~L~   32 (36)
T PF05191_consen   22 GVCDNCGGELV   32 (36)
T ss_dssp             TBCTTTTEBEB
T ss_pred             CccCCCCCeeE
Confidence            45666654443


No 185
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=23.41  E-value=24  Score=34.63  Aligned_cols=71  Identities=24%  Similarity=0.175  Sum_probs=46.8

Q ss_pred             CCccccCCccccccChhhhhhhhhhcCCCc----ccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcC---cccCC
Q 044606          274 RGKYKCETCKKVFKSYQALGGHRASHKKIK----FYTPVQETELDQENAGASINLASPPLSVKKVHECPVCF---RVFSS  346 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~~~L~~H~~~H~~~k----p~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~---k~F~~  346 (413)
                      ..|-.|-.|++.|.+-.....||..+.|--    -|--+.-|        +--....++   ..-|.|-.|+   +.|.+
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~G--------Ll~YLgeKV---~~~~~CL~CN~~~~~f~s  232 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKG--------LLKYLGEKV---GIGFICLFCNELGRPFSS  232 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhH--------HHHHHHHHh---ccCceEEEeccccCcccc
Confidence            345789999999999999999999888721    11111000        000011111   2357888888   99999


Q ss_pred             chhhccccc
Q 044606          347 GQALGGHKR  355 (413)
Q Consensus       347 ~~~L~~H~r  355 (413)
                      ..+.+.||+
T Consensus       233 leavr~HM~  241 (390)
T KOG2785|consen  233 LEAVRAHMR  241 (390)
T ss_pred             cHHHHHHHh
Confidence            999999986


No 186
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=23.34  E-value=38  Score=28.88  Aligned_cols=17  Identities=18%  Similarity=0.178  Sum_probs=8.7

Q ss_pred             hcCCCCCCCccccCCcCc
Q 044606          325 ASPPLSVKKVHECPVCFR  342 (413)
Q Consensus       325 h~~~h~g~kp~~C~~C~k  342 (413)
                      |-..-.|+ .|.|..|+-
T Consensus       132 hn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         132 HNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             cccccccc-eEEeccCCc
Confidence            33333444 666666653


No 187
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=22.93  E-value=21  Score=23.30  Aligned_cols=17  Identities=35%  Similarity=0.550  Sum_probs=7.2

Q ss_pred             cCcccccCCChhhhhhH
Q 044606           43 CRLCFKNFSNGRALGGH   59 (413)
Q Consensus        43 C~iC~K~F~~~~~L~~H   59 (413)
                      |.+|++.|.....|..|
T Consensus         1 C~~C~~~~~~~~~~~v~   17 (47)
T PF01844_consen    1 CQYCGKPGSDNESLHVH   17 (47)
T ss_dssp             -TTT--B--GG-GEEEE
T ss_pred             CCCCCCcCccCcceEeE
Confidence            78899888877444433


No 188
>PF12907 zf-met2:  Zinc-binding
Probab=22.91  E-value=19  Score=23.38  Aligned_cols=25  Identities=24%  Similarity=0.498  Sum_probs=18.4

Q ss_pred             cccCcccccCCCh---hhhhhHHHh-hcC
Q 044606           41 HKCRLCFKNFSNG---RALGGHMRS-HML   65 (413)
Q Consensus        41 ~~C~iC~K~F~~~---~~L~~HmR~-Htg   65 (413)
                      +.|.||--.|..-   ..|.+|--. |..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            6899999777554   569988874 554


No 189
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=22.42  E-value=39  Score=27.63  Aligned_cols=27  Identities=26%  Similarity=0.541  Sum_probs=23.9

Q ss_pred             CCCCccccCCccccccChhhhhhhhhh
Q 044606          272 RSRGKYKCETCKKVFKSYQALGGHRAS  298 (413)
Q Consensus       272 ~~~~~~~C~~C~k~F~~~~~L~~H~~~  298 (413)
                      .|-+.|-|-.|.+-|.....|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            366779999999999999999999775


No 190
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=22.36  E-value=53  Score=32.91  Aligned_cols=36  Identities=19%  Similarity=0.324  Sum_probs=17.0

Q ss_pred             CCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCC
Q 044606          273 SRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQET  311 (413)
Q Consensus       273 ~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~  311 (413)
                      ...-|.|+.|.+.|+....+.   ..-...--|.|..|+
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCG  160 (436)
T ss_pred             ccccccCCccccchhhhHHHH---hhcccCceEEEecCC
Confidence            344566666666655433332   222222345555554


No 191
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=21.90  E-value=70  Score=21.42  Aligned_cols=16  Identities=19%  Similarity=0.079  Sum_probs=11.1

Q ss_pred             ccccCCcCcccCCchh
Q 044606          334 VHECPVCFRVFSSGQA  349 (413)
Q Consensus       334 p~~C~~C~k~F~~~~~  349 (413)
                      .|.|+.||..+.-...
T Consensus        20 ~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       20 RFVCRKCGYEEPIEQK   35 (52)
T ss_pred             EEECCcCCCeEECCCc
Confidence            6778888877665444


No 192
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=21.86  E-value=47  Score=26.89  Aligned_cols=8  Identities=25%  Similarity=0.609  Sum_probs=4.3

Q ss_pred             ccccCCcc
Q 044606          276 KYKCETCK  283 (413)
Q Consensus       276 ~~~C~~C~  283 (413)
                      .+.|..||
T Consensus        70 ~~~C~~Cg   77 (113)
T PRK12380         70 QAWCWDCS   77 (113)
T ss_pred             EEEcccCC
Confidence            35555555


No 193
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=21.78  E-value=32  Score=22.19  Aligned_cols=12  Identities=17%  Similarity=0.395  Sum_probs=7.9

Q ss_pred             ccccCCcCcccC
Q 044606          334 VHECPVCFRVFS  345 (413)
Q Consensus       334 p~~C~~C~k~F~  345 (413)
                      -|.|..|+..|.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            367777776654


No 194
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=21.78  E-value=31  Score=23.26  Aligned_cols=7  Identities=29%  Similarity=1.132  Sum_probs=2.1

Q ss_pred             cccCCcc
Q 044606          277 YKCETCK  283 (413)
Q Consensus       277 ~~C~~C~  283 (413)
                      |.|++|+
T Consensus        35 w~CP~C~   41 (47)
T PF00301_consen   35 WVCPVCG   41 (47)
T ss_dssp             -B-TTTS
T ss_pred             CcCcCCC
Confidence            3444443


No 195
>PF14369 zf-RING_3:  zinc-finger
Probab=21.62  E-value=51  Score=20.64  Aligned_cols=30  Identities=17%  Similarity=0.177  Sum_probs=16.5

Q ss_pred             eeeeeeEEeeccccccccccccccCcccccCC
Q 044606           20 LFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFS   51 (413)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~~~~~~C~iC~K~F~   51 (413)
                      ++|.-..++|.-.......  -.||.|+-.|-
T Consensus         3 ywCh~C~~~V~~~~~~~~~--~~CP~C~~gFv   32 (35)
T PF14369_consen    3 YWCHQCNRFVRIAPSPDSD--VACPRCHGGFV   32 (35)
T ss_pred             EeCccCCCEeEeCcCCCCC--cCCcCCCCcEe
Confidence            4444455555443322222  16999998884


No 196
>PRK04023 DNA polymerase II large subunit; Validated
Probab=21.33  E-value=71  Score=35.69  Aligned_cols=37  Identities=19%  Similarity=0.219  Sum_probs=23.2

Q ss_pred             ccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccC
Q 044606          276 KYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFS  345 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~  345 (413)
                      .+.|+.||..               ....|.|+.|+...                  .++.|+.||..-.
T Consensus       638 ~frCP~CG~~---------------Te~i~fCP~CG~~~------------------~~y~CPKCG~El~  674 (1121)
T PRK04023        638 YRRCPFCGTH---------------TEPVYRCPRCGIEV------------------EEDECEKCGREPT  674 (1121)
T ss_pred             cccCCCCCCC---------------CCcceeCccccCcC------------------CCCcCCCCCCCCC
Confidence            3677777764               23456777775442                  2577888886443


No 197
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=21.24  E-value=48  Score=32.10  Aligned_cols=82  Identities=15%  Similarity=0.216  Sum_probs=48.3

Q ss_pred             ccccCCccccccChhhhhhhhhh--cCCCcccCCC----------CCCcccccccchhhhhhcCC----C---------C
Q 044606          276 KYKCETCKKVFKSYQALGGHRAS--HKKIKFYTPV----------QETELDQENAGASINLASPP----L---------S  330 (413)
Q Consensus       276 ~~~C~~C~k~F~~~~~L~~H~~~--H~~~kp~~C~----------~C~~~f~~~~~~~l~~h~~~----h---------~  330 (413)
                      .+.|-.|.|.|..+..|+.|||.  |....|-.-.          .-+++.+-.. ..+.+-...    +         .
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~-~e~dret~~d~~E~D~~wsDw~ed  273 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVH-SEDDRETNEDINETDDTWSDWNED  273 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhh-hhhhhhhhccccccccchhhhhcC
Confidence            48999999999999999999974  6554442110          1122221000 000000000    0         0


Q ss_pred             CCCc--cccCCcCcccCCchhhcccccccc
Q 044606          331 VKKV--HECPVCFRVFSSGQALGGHKRTHV  358 (413)
Q Consensus       331 g~kp--~~C~~C~k~F~~~~~L~~H~r~H~  358 (413)
                      +.-+  -.|-.|....-....|..||++-|
T Consensus       274 ~a~a~~v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  274 DAEALSVVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             CCCccceEEEeeccchhhHHHHHHHHHHHH
Confidence            1122  489999998888999999998644


No 198
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=21.03  E-value=61  Score=21.48  Aligned_cols=25  Identities=28%  Similarity=0.251  Sum_probs=20.4

Q ss_pred             ccccccCcccccCCChhhhhhHHHh
Q 044606           38 MEKHKCRLCFKNFSNGRALGGHMRS   62 (413)
Q Consensus        38 ~~~~~C~iC~K~F~~~~~L~~HmR~   62 (413)
                      -.+|+|=.|.-+-.-.+.|-.||+-
T Consensus        18 p~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   18 PFKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             CccceeecCCcccchHHHHHHHHHH
Confidence            4567898898888888999999974


No 199
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=20.96  E-value=46  Score=23.65  Aligned_cols=7  Identities=43%  Similarity=0.999  Sum_probs=4.7

Q ss_pred             cCccccc
Q 044606           43 CRLCFKN   49 (413)
Q Consensus        43 C~iC~K~   49 (413)
                      |++||+.
T Consensus         6 C~~CG~~   12 (59)
T PF09889_consen    6 CPVCGKP   12 (59)
T ss_pred             CCcCCCc
Confidence            7777763


No 200
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=20.52  E-value=64  Score=32.46  Aligned_cols=32  Identities=6%  Similarity=-0.082  Sum_probs=22.6

Q ss_pred             CCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhh
Q 044606          306 TPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQAL  350 (413)
Q Consensus       306 ~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L  350 (413)
                      .|+.||.....             .|.+-|+|+.||+.+......
T Consensus       352 ~Cp~Cg~~m~S-------------~G~~g~rC~kCg~~~~~~~~~  383 (421)
T COG1571         352 VCPRCGGRMKS-------------AGRNGFRCKKCGTRARETLIK  383 (421)
T ss_pred             CCCccCCchhh-------------cCCCCcccccccccCCccccc
Confidence            68888876532             234489999999998876543


No 201
>COG4640 Predicted membrane protein [Function unknown]
Probab=20.38  E-value=56  Score=32.33  Aligned_cols=33  Identities=18%  Similarity=0.322  Sum_probs=0.0

Q ss_pred             heeeeeeEEeeccccccccccccccCcccccCCChhhhhh
Q 044606           19 LLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGG   58 (413)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~C~iC~K~F~~~~~L~~   58 (413)
                      |+||       +++.+....--++|+-||..|+.+.++..
T Consensus         1 M~fC-------~kcG~qk~Ed~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640           1 MKFC-------PKCGSQKAEDDVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             CCcc-------cccccccccccccccccCCcCCchhhhhh


No 202
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=20.21  E-value=75  Score=21.66  Aligned_cols=12  Identities=17%  Similarity=0.193  Sum_probs=7.8

Q ss_pred             CccccCCcCccc
Q 044606          333 KVHECPVCFRVF  344 (413)
Q Consensus       333 kp~~C~~C~k~F  344 (413)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            456777777654


No 203
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=20.15  E-value=64  Score=21.71  Aligned_cols=20  Identities=35%  Similarity=0.891  Sum_probs=13.8

Q ss_pred             CcCcccCCchhhcccccccc
Q 044606          339 VCFRVFSSGQALGGHKRTHV  358 (413)
Q Consensus       339 ~C~k~F~~~~~L~~H~r~H~  358 (413)
                      +|..-|.....-..|...|.
T Consensus        26 LC~~Cf~~g~~~~~H~~~H~   45 (49)
T cd02335          26 LCLECFSAGAEIGKHRNDHN   45 (49)
T ss_pred             hhHHhhhCcCCCCCCCCCCC
Confidence            35567777777777877774


No 204
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=20.13  E-value=50  Score=22.69  Aligned_cols=27  Identities=26%  Similarity=0.479  Sum_probs=16.8

Q ss_pred             CCccccCCccccccChhhhhhhhhhcC
Q 044606          274 RGKYKCETCKKVFKSYQALGGHRASHK  300 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~~~L~~H~~~H~  300 (413)
                      ...|+|+.|...|-..-.+-.|...|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CCeEECCCCCCccccCcChhhhccccC
Confidence            356999999999999988888876664


Done!